[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for paer1:AAL64120.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3hj9B.bssp"
#ERROR : Can't open dsspfile "3hj9A.bssp"
#ERROR : Can't open dsspfile "3eo7A.bssp"
#ERROR : Can't open dsspfile "3hoiA.bssp"
#ERROR : Can't open dsspfile "2isjA.bssp"
#ERROR : Can't open dsspfile "3gr3A.bssp"
#ERROR : Can't open dsspfile "1bkjA.bssp"
#ERROR : Can't open dsspfile "3ge5B.bssp"
#ERROR : Can't open dsspfile "3ge5A.bssp"
#ERROR : Can't open dsspfile "3g14B.bssp"
#ERROR : Can't open dsspfile "3g14A.bssp"

## Summary of PDB Search
:274
    2e-18  36%  3hj9B  [x.x.x] OXIDOREDUCTASE
    2e-18  36%  3hj9A  [x.x.x] OXIDOREDUCTASE
    2e-14  31%  3eo7A  [x.x.x] PUTATIVE NITROREDUCTASE
    9e-13  36%  3hoiA  [x.x.x] FMN-DEPENDENT NITROREDUCTASE BF3017
    3e-07  32%  2isjA  [x.x.x] BLUB
    6e-06  35%  3gr3A  [x.x.x] NITROREDUCTASE
    2e-05  33%  1bkjA  [d.90.1] NADPH-FLAVIN OXIDOREDUCTASE
    7e-05  38%  3ge5B  [x.x.x] PUTATIVE NAD(P)H:FMN OXIDOREDUCTASE
    7e-05  38%  3ge5A  [x.x.x] PUTATIVE NAD(P)H:FMN OXIDOREDUCTASE
    8e-04  33%  3g14B  [x.x.x] NITROREDUCTASE FAMILY PROTEIN
    8e-04  33%  3g14A  [x.x.x] NITROREDUCTASE FAMILY PROTEIN
:274

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRKRTGADVEKVLLPYPRLRGVVSVEEALA
3hj9B           -----------------------------------------RPAVGTSERVITLPEPRTSGPLGT---LW
3hj9A           -----------------------------------------RPAVGTSERVITLPEPRTSGPLGT---LW
3eo7A           ------------------------------------------------------------------EITH
3hoiA           ---------------------------------------------------IQLPKPDNRA--GLLKALS
2isjA           ---------------------------------------------------------------AVYRAIE
3gr3A           --------------------------------------------------------------IDIFQSIL
1bkjA           ----------------------------------------------------------------------
3ge5B           ----------------------------------------------------------------IEDFFR
3ge5A           ----------------------------------------------------------------IEDFFR
3g14B           ----------------------------------------------------------------------
3g14A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NRRSVREFREEPLTLEELGQILWAAYGISETRYGLRTAPSAGAQYPLEVYVVVGEHGVKTGDGYLKPGVY
3hj9B           LRKSTREFDQQPLPLKQLSELLWAAAGVNRSLGGGRTAPSPYGETVIDVYVA------------LPAGLY
3hj9A           LRKSTREFDQQPLPLKQLSELLWAAAGVNRSLGGGRTAPSPYGETVIDVYVA------------LPAGLY
3eo7A           KRRSTRAYNGEELTFDELKALLDFTYQPQNIDQSLDNSPDYFDLNLIETFIAV------CGVQGLEAGCY
3hoiA           ERHSTREYASKALSNTDLSDLLWAANGINRSSEGKRTAPSANRQ-DIDIYVV------------LPQGTY
2isjA           TRRDVREFLPEPLSEELIARLLGAAH----------QAPSVGFMQPWNFVLVRQDE--------TREKVW
3gr3A           SRKSIRAFTDQPVTQETIREILKLA----------ARAPSGTNLQPWQVIVLTGKILQKVGSGIKGEREY
1bkjA           ----------------------------------------------------------------------
3ge5B           TRRSVRKFIDRPVEEEKLA-ILEAG----------RIAPSAHNYQPWHFLVVREEEGRKR----LAP---
3ge5A           TRRSVRKFIDRPVEEEKLA-ILEAG----------RIAPSAHNYQPWHFLVVREEEGRKR----LAP---
3g14B           ----------------------------------------------------------------------
3g14A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           HYDPHSHTLTLKKTGDFREALYQAALEQIWVLKAPVSLIFTAVYSRTXXXXXXXXXXXXXPMDLGHAGQN
3hj9B           RYDPVHHCLELKRAADLRSTGYQD------FVGAPLDLVFVANHGR----QEPPKLRETFSXXXXXXXXX
3hj9A           RYDPVHHCLELKRAADLRSTGYQD------FVGAPLDLVFVANHGR----QEPPKLRETFSXXXXXXXXX
3eo7A           YYAPKAQELRQIRFKNFRRELHFLCLGQELGRDAAAVIFHTSDLKSAIAQYGDRVYRYLH--DAGHLGQR
3hoiA           LYDAKGHKLNLISEGDHRSAV---AGGQAFVNNAPXXXXXXXXXXKLGDAKSNHVQLG---ADAGIVSQN
2isjA           QAFQRANDEAAEMFSGERQAKYRS-LKLEGIRKAPLSICVTC--DRTRGGAVVLGRTHNPQMDLYSAVQN
3gr3A           HYYPRQKSLGIQK-GD-QEKLHQKA-KNFLFYGAPVGLLFTIDHDEGSW------------LDLGF---Q
1bkjA           -----------------RNELAQFAGNQAYVESAAEFLVFCIDYQRPDVQADFTELTLIGAVDSGIMAQN
3ge5B           ------------------------CSQQPWFPGAPIYIITLGDHQRAWKRGAGDSVD----IDTSIA---
3ge5A           ------------------------CSQQPWFPGAPIYIITLGDHQRAWKRGAGDSVD----IDTSIA---
3g14B           --------------------------------------------------------------------EH
3g14A           --------------------------------------------------------------------EH


                         .         .         .         +         .         .         .:280
query           VYLQATALGLGTVAVGAFYDDQVAEILDLPDGETPLYIMPIGRPxxxxxxxxxxxxxxxxxxxx
3hj9B           XYLYCASAGLGAVVRGWLNRRQLAE-HSLNEDEEPILSQTIGR---------------------
3hj9A           XYLYCASAGLGAVVRGWLNRRQLAE-HSLNEDEEPILSQTIGR---------------------
3eo7A           LNLAAIQLNLGVSGIGGFFDDQVNEVLGIPNDEAVIYITTLGRP--------------------
3hoiA           ISLFCSAARLATV---------------------------------------------------
2isjA           LWLAARAEGVGVGWVSIFHESEIKAILGIPD---------------------------------
3gr3A           TILAARGFGLDTCAQAAFYHKQIRSLLSVP----------------------------------
1bkjA           CLLAAESMGLGGVYIGGLRNSQVDELLGLPENSAVLFGMCLGHP--------------------
3ge5B           TYLEAHSLGLGCTWVCAFDQALCSEIFDIP-SHTPVSILALG----------------------
3ge5A           TYLEAHSLGLGCTWVCAFDQALCSEIFDIP-SHTPVSILALG----------------------
3g14B           IVLGATDEGYGTCWIAAFNENKIKEALKIPDNLRVVALTPLGVP--------------------
3g14A           IVLGATDEGYGTCWIAAFNENKIKEALKIPDNLRVVALTPLGVP--------------------