[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for paer1:AAL64265.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2fnaA.bssp"
#ERROR : Can't open dsspfile "2qenA.bssp"

## Summary of PDB Search
:360
    1e-58  43%  2fnaA  [x.x.x] CONSERVED HYPOTHETICAL PROTEIN
    1e-37  34%  2qenA  [x.x.x] WALKER-TYPE ATPASE
:360

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLTLILGMRRVGKTSVVKAATYGKLRIYIDARYFEEKRY
2fnaA           --------------------------------ITLVLGLRRTGKSSIIKIGI-NELNIYLDLRKFEERNY
2qenA           --------------------------------LTLLLGIRRVGKSSLLRAFLNERPGILIDCRLYAERGH


                         .         .         *         .         .         .         .:140
query           ISYGDXXXXXXXXXXXXXXXXXXXGELLSKIRGVSVAGVDVKFEIGRNAPSFAEILEAFDQWAREQGERL
2fnaA           ISYKDFLLELQKEINKLVKRLPSLLKALKNIQGI-VIGNEIKF----NRLSFANLLESFEQASKDN---V
2qenA           ITREELIKELQSTISP-----------FQKFQSKFKISLNLKFTLEPRKLSLREVFRELNDLGEELGE-F


                         +         .         .         .         .         *         .:210
query           VLIIDEAQELAKLRGRTLLPPLGYAYDNLRNISMVFTGSKAGLLLRFLRLEDPHSPLFGRYFEKIELGPF
2fnaA           IIVLDEAQELVKLRGVNLLPALAYAYDNLKRIKFI-SGSE-GLLYDYLRVEDPESPLFGRAFSTVELKPF
2qenA           IVAFDEAQYLGSRGGKELLALFAYAYDSLPNLKIILTGSEVGLLHDFLKITDYESPLYGRIAGEVLVKPF


                         .         .         .         +         .         .         .:280
query           SRELSVQFLTKGFEEAGVRVSRELIDRAVDELDGVVGWLAYFGLRAVKKPDSALEETLEYAARLAAAEFC
2fnaA           SREEAIEFLRRGFQEADIDFKD--YEVVYEKIGGIPGWLTYFGFIYLKNLDFAINQTLEYAKKLILKEFE
2qenA           DKDTSVEFLKRGFREVNLDVPENEIEEAVELLDGIPGWLVVFGVEYLRNGDRAMKRTLEVAKGLIMGELE


                         .         *         .         .         .         .         +:350
query           NFVQYMGSQRYIHVAKVCKNGARWSEVKRYLQAVEGKPITDYEVTKLLKNLVDYGFLEKRGEIYLVPDPV
2fnaA           NFLREIARKRYLNIRTLSKCG-KWSDVKRALELEEGIEISDSEIYNYLTQLTKHSWIIKEGEKYCPSEPL
2qenA           ELRR--RSPRYVDILRAIALGNRWSLIRDYL-AVKGTKIPEPRLYALLENLKKMNWIVEEDNTYKIADPV


                         .         .         .         .         *         .         .:420
query           LRTALQxxxx
2fnaA           ISLA------
2qenA           VATVLR----