[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for paer1:AAL64489.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2vpyA.bssp"
#ERROR : Can't open dsspfile "2ivfA.bssp"
#ERROR : Can't open dsspfile "2v45A.bssp"
#ERROR : Can't open dsspfile "2napA.bssp"
#ERROR : Can't open dsspfile "2v3vA.bssp"
#ERROR : Can't open dsspfile "2jioA.bssp"
#ERROR : Can't open dsspfile "2e7zA.bssp"
#ERROR : Can't open dsspfile "1kqfA.bssp"
#ERROR : Can't open dsspfile "1fdiA.bssp"
#ERROR : Can't open dsspfile "1aa6A.bssp"
#ERROR : Can't open dsspfile "1cxtA.bssp"
#ERROR : Can't open dsspfile "1cxsA.bssp"
#ERROR : Can't open dsspfile "1eu1A.bssp"
#ERROR : Can't open dsspfile "2dmrA.bssp"
#ERROR : Can't open dsspfile "1h0hA.bssp"
#ERROR : Can't open dsspfile "1e60C.bssp"
#ERROR : Can't open dsspfile "1h5nA.bssp"
#ERROR : Can't open dsspfile "1e5vA.bssp"
#ERROR : Can't open dsspfile "1e61C.bssp"
#ERROR : Can't open dsspfile "1e61A.bssp"
#ERROR : Can't open dsspfile "4dmrA.bssp"
#ERROR : Can't open dsspfile "1tmoA.bssp"
#ERROR : Can't open dsspfile "1e60A.bssp"
#ERROR : Can't open dsspfile "1dmrA.bssp"
#ERROR : Can't open dsspfile "1e18A.bssp"
#ERROR : Can't open dsspfile "1dmsA.bssp"
#ERROR : Can't open dsspfile "1siwA.bssp"
#ERROR : Can't open dsspfile "1r27A.bssp"
#ERROR : Can't open dsspfile "1q16A.bssp"
#ERROR : Can't open dsspfile "1ogyA.bssp"
#ERROR : Can't open dsspfile "1g8kA.bssp"

## Summary of PDB Search
:816
    5e-53  32%  2vpyA  [x.x.x] THIOSULFATE REDUCTASE
    9e-26  31%  2ivfA  [x.x.x] ETHYLBENZENE DEHYDROGENASE ALPHA-SUBUNIT
    1e-22  30%  2v45A  [x.x.x] PERIPLASMIC NITRATE REDUCTASE
    1e-22  30%  2napA  [c.81.1 - b.52.2] PROTEIN (PERIPLASMIC NITRATE REDUCTASE)
    4e-22  30%  2v3vA  [x.x.x] PERIPLASMIC NITRATE REDUCTASE
    4e-22  30%  2jioA  [x.x.x] PERIPLASMIC NITRATE REDUCTASE
    3e-21  30%  2e7zA  [x.x.x] ACETYLENE HYDRATASE AHY
    4e-15  25%  1kqfA  [c.81.1 - b.52.2] FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE,
    4e-14  27%  1fdiA  [x.x.x] FORMATE DEHYDROGENASE H
    4e-14  27%  1aa6A  [x.x.x] FORMATE DEHYDROGENASE H
    6e-14  27%  1cxtA  [x.x.x] DIMETHYLSULFOXIDE REDUCTASE
    8e-14  27%  1cxsA  [x.x.x] DIMETHYLSULFOXIDE REDUCTASE
    1e-13  27%  1eu1A  [c.81.1 - b.52.2] DIMETHYL SULFOXIDE REDUCTASE
    2e-13  27%  2dmrA  [x.x.x] DMSO REDUCTASE
    3e-13  26%  1h0hA  [c.81.1 - b.52.2] FORMATE DEHYDROGENASE (LARGE SUBUNIT)
    5e-13  27%  1e60C  [c.81.1 - b.52.2] DMSO REDUCTASE
    7e-13  27%  1h5nA  [c.81.1 - b.52.2] DMSO REDUCTASE
    7e-13  27%  1e5vA  [c.81.1 - b.52.2] DMSO REDUCTASE
    1e-12  27%  1e61C  [c.81.1 - b.52.2] DMSO REDUCTASE
    1e-12  27%  1e61A  [c.81.1 - b.52.2] DMSO REDUCTASE
    2e-12  27%  4dmrA  [x.x.x] DMSO REDUCTASE
    3e-12  26%  1tmoA  [x.x.x] TRIMETHYLAMINE N-OXIDE REDUCTASE
    3e-12  27%  1e60A  [c.81.1 - b.52.2] DMSO REDUCTASE
    3e-12  27%  1dmrA  [x.x.x] DMSO REDUCTASE
    1e-11  34%  1e18A  [c.81.1 - b.52.2] DMSO REDUCTASE.
    6e-09  30%  1dmsA  [x.x.x] DMSO REDUCTASE
    7e-08  27%  1siwA  [c.81.1 - b.52.2] RESPIRATORY NITRATE REDUCTASE 1 ALPHA CHAIN
    7e-08  27%  1r27A  [c.81.1 - b.52.2] RESPIRATORY NITRATE REDUCTASE 1 ALPHA CHAIN
    7e-08  27%  1q16A  [c.81.1 - b.52.2] RESPIRATORY NITRATE REDUCTASE 1 ALPHA CHAIN
    3e-07  25%  1ogyA  [c.81.1 - b.52.2] PERIPLASMIC NITRATE REDUCTASE
    6e-04  28%  1g8kA  [c.81.1 - b.52.2] ARSENITE OXIDASE
:816

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVRNGQRMYLL
2vpyA           ---------------------------------------------------------------GNRVYKV
2ivfA           ----------------------------------------------------------------------
2v45A           ------------------------------------------------------------VKDGKAVAIQ
2napA           ------------------------------------------------------------VKDGKAVAIQ
2v3vA           ------------------------------------------------------------VKDGKAVAIQ
2jioA           ------------------------------------------------------------VKDGKAVAIQ
2e7zA           ----------------------------------------------------------------------
1kqfA           ----------------------------------------------------------------------
1fdiA           ----------------------------------------------------------------------
1aa6A           ----------------------------------------------------------------------
1cxtA           ------------------------------------------------------------VENGRAVAFE
1cxsA           ------------------------------------------------------------VENGRAVAFE
1eu1A           ------------------------------------------------------------VENGRAVAFE
2dmrA           ------------------------------------------------------------VENGRATAFT
1h0hA           ----------------------------------------------------------------------
1e60C           ------------------------------------------------------------VENGRATAFT
1h5nA           ------------------------------------------------------------VENGRATAFT
1e5vA           ------------------------------------------------------------VENGRATAFT
1e61C           ------------------------------------------------------------VENGRATAFT
1e61A           ------------------------------------------------------------VENGRATAFT
4dmrA           ------------------------------------------------------------VENGRATAFT
1tmoA           ----------------------------------------------------------------------
1e60A           ------------------------------------------------------------VENGRATAFT
1dmrA           ------------------------------------------------------------VENGRATAFT
1e18A           ------------------------------------------------------------VENGRATAFT
1dmsA           ------------------------------------------------------------VENGRATAFT
1siwA           ----------------------------------------------------------------------
1r27A           ----------------------------------------------------------------------
1q16A           ----------------------------------------------------------------------
1ogyA           ----------------------------------------------------------------------
1g8kA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PNPKHPQPGMCFRPASALQLWNHPLRLKKPLKRVGERGEGKFQEVDWETALNEIAQRLREIVQRYGPESV
2vpyA           ENPKS-RGRLCPRGQGAPQTTYDPDRLKRPLIRVSQRGEGKYRVATWEEALDHIAKKMLEIREKYGPEAI
2ivfA           -------------------------RVKYPLKRVGKRGEGKWKRVSWDEAAGDIADSIIDSFEAQGSDSI
2v45A           GNPNNHNAGLCLKGSLLIPVLNSKERVTQPLVR--RHKGGKLEPVSWDEALDLMASRFRSSIDMYGPNSV
2napA           GNPNNHNAGLCLKGSLLIPVLNSKERVTQPLVR--RHKGGKLEPVSWDEALDLMASRFRSSIDMYGPNSV
2v3vA           GDPNNHNAGLCLKGSLLIPVLNSKERVTQPLVR--RHKGGKLEPVSWDEALDLMASRFRSSIDMYGPNSV
2jioA           GDPNNHNAGLCLKGSLLIPVLNSKERVTQPLVR--RHKGGKLEPVSWDEALDLMASRFRSSIDMYGPNSV
2e7zA           PHPTTPPNSICMKSVNADTIRTHKDRVLYPLKNVGKRGEQRWERISWDQALDXXXXXXXXXXXXYGPESV
1kqfA           -DPDHPRGALCPKGAGLLDYVNSENRLRYPEYRAP--GSDKWQRISWEEAFSRIAKLMKNFIEK-NEQGV
1fdiA           -------------------------RLKTPMIR-RQRG-GKLEPVSWDEALNYVAERLSAIKEKYGPDAI
1aa6A           -------------------------RLKTPMIR-RQRG-GKLEPVSWDEALNYVAERLSAIKEKYGPDAI
1cxtA           PWDKDPAPS--HQLPGVLDSIYSPTRIKYPMVRRSTRGNGDFVRVTWDEALDLVARELKRVQESYGPTGT
1cxsA           PWDKDPAPS--HQLPGVLDSIYSPTRIKYPMVRRSTRGNGDFVRVTWDEALDLVARELKRVQESYGPTGT
1eu1A           PWDKDPAPS--HQLPGVLDSIYSPTRIKYPMVRRSTRGNGDFVRVTWDEALDLVARELKRVQESYGPTGT
2dmrA           PWEKDPHPSPML--AGVLDSIYSPTRIKYPMVRRSTRGNGDFVRVSWDQALDLVAAEVKRVEETYGPEGV
1h0hA           -DPDHPEGSLCAKGASTWQLAENERRPANPLYRAP--GSDQWEEKSWDWMLDTIAERVAQVVNRCGIASV
1e60C           PWEKDPHPSPML--AGVLDSIYSPTRIKYPMVRRSTRGNGDFVRVSWDQALDLVAAEVKRVEETYGPEGV
1h5nA           PWEKDPHPSPML--AGVLDSIYSPTRIKYPMVRRSTRGNGDFVRVSWDQALDLVAAEVKRVEETYGPEGV
1e5vA           PWEKDPHPSPML--AGVLDSIYSPTRIKYPMVRRSTRGNGDFVRVSWDQALDLVAAEVKRVEETYGPEGV
1e61C           PWEKDPHPSPML--AGVLDSIYSPTRIKYPMVRRSTRGNGDFVRVSWDQALDLVAAEVKRVEETYGPEGV
1e61A           PWEKDPHPSPML--AGVLDSIYSPTRIKYPMVRRSTRGNGDFVRVSWDQALDLVAAEVKRVEETYGPEGV
4dmrA           PWEKDPHPSPML--AGVLDSIYSPTRIKYPMVRRSTRGNGDFVRVSWDQALDLVAAEVKRVEETYGPSGV
1tmoA           ----------------------NPSRVRYPMVRLDQRGDFRFVRVTWDKALTLFKHSLDEVQTQYGPSGL
1e60A           PWEKDPHPSPML--AGVLDSIYSPTRIKYPMVRRSTRGNGDFVRVSWDQALDLVAAEVKRVEETYGPEGV
1dmrA           PWEKDPHPSPML--AGVLDSIYSPTRIKYPMVRRSTRGNGDFVRVSWDQALDLVAAEVKRVEETYGPEGV
1e18A           PWEKDPHPSPML--AGVLDSIYSPTRIKYPMVRRSTRGNGDFVRVSWDQALDLVAAEVKRVEETYGPQGV
1dmsA           PWEKDPHPTPMLE--GVLDSIYSPTRIKYPMVRRSTRGNGDFVRVSWDQALDLVAAEVKRVEETYGPQGV
1siwA           ------------------------------------RGRGGFVRSSWQEVNELIAASNVYTIKNYGPDRV
1r27A           ------------------------------------RGRGGFVRSSWQEVNELIAASNVYTIKNYGPDRV
1q16A           ------------------------------------RGRGGFVRSSWQEVNELIAASNVYTIKNYGPDRV
1ogyA           -------------------------RLTTPLLRMKDHKEGEFAPVSWDEAFDVMAAQAKLVLKEKAPEAV
1g8kA           -------------------------------------------DTTWDHAMALYAGLIKKTLDKDGPQGV


                         +         .         .         .         .         *         .:210
query           AFTRHDHMSWILPFIASVIGTPNIISHEGTCHAASTAVRKFVLGASGPSSVDPDYENANYILLIGRNLDA
2vpyA           AFFGHGTGDWFVDFLPAAWGSPNAAKPSSLCTAPREVASQWVFGRPIGGHEPIDWENARYIVLIGHHIDT
2ivfA           AWGAGFRMTYLMDGVSPDINVDIGDTYMGAFHTFG----KMHMGYSADNLLD-----AELIFMTCSNWSY
2v45A           AWYGSGQCLTEESYVANKIGTNNVDGNPRLCMASAVGGYVTSFGKDEPMGTYADIDQATCFFIIGSNTSE
2napA           AWYGSGQCLTEESYVANKIGTNNVDGNPRLCMASAVGGYVTSFGKDEPMGTYADIDQATCFFIIGSNTSE
2v3vA           AWYGSGQCLTEESYVANKIGTNNVDGNPRLCMASAVGGYVTSFGKDEPMGTYADIDQATCFFIIGSNTSE
2jioA           AWYGSGQCLTEESYVANKIGTNNVDGNPRLCMASAVGGYVTSFGKDEPMGTYADIDQATCFFIIGSNTSE
2e7zA           SQTEINQQSGTLRRFMNLLGSPNWTSAMYMCIGNTAGVHRVTHGSYSFAS----FADSNCLLFIGKNLSN
1kqfA           TVNR-----WLSTGMLCASGASNAVDNQARVHGPTVASLAPTFGRGAMTNHWVDIKNANVVMVMGGNAAE
1fdiA           QTTTGNETNYVMKFARAVIGTNN-VDCCARVHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNADS
1aa6A           QTTTGNETNYVMKFARAVIGTNN-VDCCARVHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNADS
1cxtA           FGGSYGHNCQVLMRRALNLAGGFVNSSGDYSTAAAQIIMPHVMGTL------EVYEQQTAWPVVVENTDL
1cxsA           FGGSYGHNCQVLMRRALNLAGGFVNSSGDYSTAAAQIIMPHVMGTL------EVYEQQTAWPVVVENTDL
1eu1A           FGGSYGHNCQVLMRRALNLAGGFVNSSGDYSTAAAQIIMPHVMGTL------EVYEQQTAWPVVVENTDL
2dmrA           FGGSY---GWKSP---------------GRLHNCTTLLRRMLTLAGGYVNGAGDYSTAQVIMVLAENTEV
1h0hA           GSAAMDNEEWIYQAWLRSLGL-FYIEHQARIHSATVAALAESYGRGAMTNHWIDLKNSDVILMMGSN--P
1e60C           FGGSY---GWKSP---------------GRLHNCTTLLRRMLTLAGGYVNGAGDYSTAQVIMVLAENTEV
1h5nA           FGGSY---GWKSP---------------GRLHNCTTLLRRMLTLAGGYVNGAGDYSTAQVIMVLAENTEV
1e5vA           FGGSY---GWKSP---------------GRLHNCTTLLRRMLTLAGGYVNGAGDYSTAQVIMVLAENTEV
1e61C           FGGSY---GWKSP---------------GRLHNCTTLLRRMLTLAGGYVNGAGDYSTAQVIMVLAENTEV
1e61A           FGGSY---GWKSP---------------GRLHNCTTLLRRMLTLAGGYVNGAGDYSTAQVIMVLAENTEV
4dmrA           FGGSY---GWKSP---------------GRLHNCTTLLRRMLTLAGGYVNGAGDYSTAQVIMVLAENTEV
1tmoA           RATGQLHSS--TSHMQRAVGMHNYVKKIGDYSTAGQTILPYVLGAQGTSSNDP-YKN----LQVGWNAET
1e60A           FGGSY---GWKSP---------------GRLHNCTTLLRRMLTLAGGYVNGAGDYSTAQVIMVLAENTEV
1dmrA           FGGSY---GWKSP---------------GRLHNCTTLLRRMLTLAGGYVNGAGDYSTAQVIMVLAENTEV
1e18A           FGGSY---GWKSP---------------GRLHNCTTLLRRMLTLAGGYVNGAGDYSTAQVIMVLAENTEV
1dmsA           FGGSY---GWKSP---------------GRLHNCTTLLRRMLTLAGGYVNGAGDYSTAQVIMVLAENTEV
1siwA           AFSPIPAMSMVSARYLSLIGGTCLSFYDWYCDLPPASPQTWGEQTDVPESAD--WYNSSYIIAWGSNVQT
1r27A           AFSPIPAMSMVSARYLSLIGGTCLSFYDWYCDLPPASPQTWGEQTDVPESAD--WYNSSYIIAWGSNVQT
1q16A           AFSPIPAMSMVSARYLSLIGGTCLSFYDWYCDLPPASPQTWGEQTDVPESAD--WYNSSYIIAWGSNVQT
1ogyA           GMFGSGQWTIWEGYAASKLRSNNLDPNARHCMASAATAFMRTFGMDEPMGCYDDFEAADAFVLWGSNM-A
1g8kA           FFSCFDHNTWGTKLMFSAIQTPMVRIHNSECHATRE------MGIGELNNAYEDAQLADVIWSIGNNLNH


                         .         .         .         +         .         .         .:280
query           AMGHIRRLTVAREKGXXXXXXDPRAPNLAYSSVEWIPINPGTDAAFVLSLIYVIISEGLYDAAFLKKYTN
2vpyA           HNTQLQDFALALKNGAKVVVVDPRFSTAAAKAHRWLPIKPGTDTALLLAWIHVLIYEDLYDKEYVAKYT-
2ivfA           TYSSYHFLSEARYKGAEVVVIAPDFNPTTPAADLHVPVRVGSDAAFWLGLSQVMIDEKLFDRQFVCEQTD
2v45A           AHPVLFRRIARREPGVKIIVADPRRTNTSRIADMHVAFRPGTDLAFMHSMAWVIINEELDNPRFWQRYVN
2napA           AHPVLFRRIARREPGVKIIVADPRRTNTSRIADMHVAFRPGTDLAFMHSMAWVIINEELDNPRFWQRYVN
2v3vA           AHPVLFRRIARREPGVKIIVADPRRTNTSRIADMHVAFRPGTDLAFMHSMAWVIINEELDNPRFWQRYVN
2jioA           AHPVLFRRIARREPGVKIIVADPRRTNTSRIADMHVAFRPGTDLAFMHSMAWVIINEELDNPRFWQRYVN
2e7zA           HVSQFNDLKAALKRGCKLIVLDPRRTKVAEMADIWLPLRYGTDAALFLGMINVIINEQLYDKEFVENW--
1kqfA           AVGFRWAMEAKNNNDATLIVVDPRFTRTASVADIYAPIRSGTDITFLSGVLRYLIENNKINAEYVKHYTN
1fdiA           HPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRT-
1aa6A           HPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRT-
1cxtA           MVGAYAGMKALKEKGTRVICINPRTETADYFGADVVSPRPQTDVALMLGMAHTLYSEDLHDKDFLENCTT
1cxsA           MVGAYAGMKALKEKGTRVICINPRTETADYFGADVVSPRPQTDVALMLGMAHTLYSEDLHDKDFLENCTT
1eu1A           MVGAYAGMKALKEKGTRVIINPVRTETADYFGADVVSPRPQTDVALMLGMAHTLYSEDLHDKDFLENCTT
2dmrA           MVGAYPGLEALKAKGTKVIVIDPRTKTVEFFGAEHITPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
1h0hA           AENHFKWVMRAKDKGATLIHVDPRYTRTSTKCDLYAPLRSGSDIAFLNGMTKYILEKELYFKDYVVNYTN
1e60C           MVGAYPGLEALKAKGTKVIVIDPRTKTVEFFGAEHITPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
1h5nA           MVGAYPGLEALKAKGTKVIVIDPRTKTVEFFGAEHITPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
1e5vA           MVGAYPGLEALKAKGTKVIVIDPRTKTVEFFGAEHITPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
1e61C           MVGAYPGLEALKAKGTKVIVIDPRTKTVEFFGAEHITPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
1e61A           MVGAYPGLEALKAKGTKVIVIDPRTKTVEFFGAEHITPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
4dmrA           MVGAYPGLEALKAKGTKVIVIDPRTKTVEFFGAEHITPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
1tmoA           SFAYLAQLKEKVKQGKIRVISDPVVTKTAYLGCEQLYVNPQTDVTLMLAIAHEMISKKLYDDKFIQGYS-
1e60A           MVGAYPGLEALKAKGTKVIVIDPRTKTVEFFGAEHITPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
1dmrA           MVGAYPGLEALKAKGTKVIVIDPRTKTVEFFGAEHITPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
1e18A           MVGAYPGLEALKAKGTKVIVIDPRTKTVEFFGAEHITPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
1dmsA           MVGAYPGLEALKAKGTKVIVIDPRTKTVEFFGADHVTPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
1siwA           RTPDAHFFTEVRYKGTKTVAVTPDYAEIAKLCDLWLAPKQGTDAAMALAMGHVMLRESQYFTDYVRRYTD
1r27A           RTPDAHFFTEVRYKGTKTVAVTPDYAEIAKLCDLWLAPKQGTDAAMALAMGHVMLRESQYFTDYVRRYTD
1q16A           RTPDAHFFTEVRYKGTKTVAVTPDYAEIAKLCDLWLAPKQGTDAAMALAMGHVMLRESQYFTDYVRRYTD
1ogyA           EMHPIRRLSHEHVRVAVLSTFTHRSSDLSDTP---IIFRPGTDRAILNYIAHHIISTGRVNRDFVDRHTN
1g8kA           WLPNLQGATTSKKKERFPNENFPQAPSVAIARVLHLAIEPGTDTALFNGLFTYVVEQGWIDKPFIEAHT-


                         .         *         .         .         .         .         +:350
query           APFLIKPDGQPLTQKDLGQEGTAYLVYDNAAKSLAPHDKAQDPALDYEGEVQTPAGVIKVKTAFRLLAER
2vpyA           ----------------VGFE------------ELKAHVKDFTPEW-AEKHTEIPAQVIR-EVAREMAAHK
2ivfA           LPLLVRMDGKFLSAEDVGGEAKQFYFFDEKAGSVRKASRGTMPALEGTFSARLKNGTIQVRTVFEGLREH
2v45A           ---FMDAEGKP---------------------------------SDFEG--------------YKAFLE-
2napA           ---FMDAEGKP---------------------------------SDFEG--------------YKAFLE-
2v3vA           ---FMDAEGKP---------------------------------SDFEG--------------YKAFLE-
2jioA           ---FMDAEGKP---------------------------------SDFEG--------------YKAFLE-
2e7zA           ---------------------------------------------------------------FEELKER
1kqfA           ASLLVR--------DDFAFEDGLFSGYDAEKRQ---YDKSSNYQLDENGYAKRDETLTHPRCVWNLLKEH
1fdiA           ----------------------------------------------------------------------
1aa6A           ----------------------------------------------------------------------
1cxtA           GFDLF----------------AAYLTGES------------------DGTPKT--------------AEW
1cxsA           GFDLF----------------AAYLTGES------------------DGTPKT--------------AEW
1eu1A           GFDLF----------------AAYLTGES------------------DGTPKT--------------AEW
2dmrA           G-------------------------FDKFL-----------PYLDGETD-STP------KTA-------
1h0hA           ASFIV-------------GEGFAFELFAGYNKETRKYDKSKGFERDENGNPKRDETLKHPRCVFQIMKKH
1e60C           G-------------------------FDKFL-----------PYLDGETD-STP------KTA-------
1h5nA           G-------------------------FDKFL-----------PYLDGETD-STP------KTA-------
1e5vA           G-------------------------FDKFL-----------PYLDGETD-STP------KTA-------
1e61C           G-------------------------FDKFL-----------PYLDGETD-STP------KTA-------
1e61A           G-------------------------FDKFL-----------PYLDGETD-STP------KTA-------
4dmrA           G-------------------------FDKFL-----------PYLDGETD-STP------KTA-------
1tmoA           ----------------LGFE--EFVPYVMGTK---------------DGVAKTP----------------
1e60A           G-------------------------FDKFL-----------PYLDGETD-STP------KTA-------
1dmrA           G-------------------------FDKFL-----------PYLDGETD-STP------KTA-------
1e18A           G-------------------------FDKFL-----------PYLDGETD-STP------KTA-------
1dmsA           GPYLMETDSTPKT---------------------------------------------------------
1siwA           MPMLV-----------------------------------------------------------------
1r27A           MPMLV-----------------------------------------------------------------
1q16A           MPMLV-----------------------------------------------------------------
1ogyA           F---------ALGATDIGY-------------GLRPEHQLQXXXXXXXXXXMTP-------TDFETFAAL
1g8kA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AAKYTPENAEKITGIPADTIRRIAREFATSRGVAEDGWYTAKNGNDFDAYRAILILNALVGNIDKRGGLC
2vpyA           PRAVLPPTRHNV-------------------------WY----GDDTYRVMALLYVNVLLGNYGRPGGFY
2ivfA           LKDYTPEKASAKCGVPVSLIRELGRKVAKKRTCSYIGFSSAKSYHGDLMERSLFLAMALSGNWGKPG---
2v45A           --NYRPEKVAEICRVPVEQIYGAARAFAES-AATMSLWCMGINQRVQGVFANNLILHLITGQICRPGATS
2napA           --NYRPEKVAEICRVPVEQIYGAARAFAES-AATMSLWCMGINQRVQGVFANNLILHLITGQICRPGATS
2v3vA           --NYRPEKVAEICRVPVEQIYGAARAFAES-AATMSLWCMGINQRVQGVFANNLILHLITGQICRPGATS
2jioA           --NYRPEKVAEICRVPVEQIYGAARAFAES-AATMSLWCMGINQRVQGVFANNLILHLITGQICRPGATS
2e7zA           VQEYPLDKVAEITGCDAGEIRKAAVMFATE-SPASIPWATDMQKNSCSAIRAQCILRAIVGSFVNGAEIL
1kqfA           VSRYTPDVVENICGTPKADFLKVCEVLAST----------------------------------------
1fdiA           ---YTPESVEDITGVSASEIRQAARMYAQAKSAAILGMGVTQFYQGVETVRSLTSLAMLTGNLGKRGGAC
1aa6A           ---YTPESVEDITGVSASEIRQAARMYAQAKSAAILGMGVTQFYQGVETVRSLTSLAMLTGNLGKRGGAC
1cxtA           AAE--------ICGLPAEQIRELARSFVAGRTMLAAGWSIQRMHHGEQAHWMLVTL-ASMXXXXXXXXXX
1cxsA           AAE--------ICGLPAEQIRELARSFVAGRTMLAAGWSIQRMHHGEQAHWMLVTLASMXXXXXSNGG--
1eu1A           AAE--------ICGLPAEQIRELARSFVAGRTMLAAGWSIQRMHHGEQAHWMLVTLASMXXXXXSNGG--
2dmrA           ------EWAEGISGVPAETIKELARLFESKRTMLAAGWSMQRMHHGEQAHWMLVTLASMXXXXXXXXXXX
1h0hA           YERYDLDKISAICGTPKELILKV-----------------------------------------------
1e60C           ------EWAEGISGVPAETIKELARLFESKRTMLAAGWSMQRMHHGEQAHWMLVTLASMXXXXXXXXXXX
1h5nA           ------EWAEGISGVPAETIKELARLFESKRTMLAAGWSMQRMHHGEQAHWMLVTLASMXXXXXXXXXXX
1e5vA           ------EWAEGISGVPAETIKELARLFESKRTMLAAGWSMQRMHHGEQAHWMLVTLASMXXXXXXXXXXX
1e61C           ------EWAEGISGVPAETIKELARLFESKRTMLAAGWSMQRMHHGEQAHWMLVTLASMXXXXXXXXXXX
1e61A           ------EWAEGISGVPAETIKELARLFESKRTMLAAGWSMQRMHHGEQAHWMLVTLASMXXXXXXXXXXX
4dmrA           ------EWAEGISGVPAETIKELARLFESKRTMLAAGWSMQRMHHGEQAHWMLVTLASMXXXXXXXXXXX
1tmoA           ------EWAAPICGVEAHVIRDLAKTLVKGRTQFMMGWCIQRQQHGEQPYWMAAVLATMIGQIGLPXXXX
1e60A           ------EWAEGISGVPAETIKELARLFESKRTMLAAGWSMQRMHHGEQAHWMLVTLASMXXXXXXXXXXX
1dmrA           ------EWAEGISGVPAETIKELARLFESKRTMLAAGWSMQRMHHGEQAHWMLVTLASMXXXXXXXXXXX
1e18A           ------EWAEGISGVPAETIKELARLFESKRTMLAAGW--------------------------------
1dmsA           ----------------------------------------------------------------------
1siwA           ----------------------------------------------------------------------
1r27A           ----------------------------------------------------------------------
1q16A           ----------------------------------------------------------------------
1ogyA           VSEYTLEKAAEISGVXXXXXXXXXXXYADPDRKWMSLWTMGFNQHGVWANHMVYNLHLLTGKISEPGNSP
1g8kA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           FQESSKFPSAVTVFQDRIETIIGHVLPPIKAQRLDRLKYPETPATFDALLDAIIEEKPYPVKALFIVATS
2vpyA           IAQSXXXXXXXXXXXXXXXXXXXXXXPEGFKPRADKGKFFARSTAIQELIEPMITGEPYPIKGLFAYGIN
2ivfA           ----------------------------------------------------------------------
2v45A           FSLTGQ-PNACGGVRD--GGALSHLLPPNAKHRAEMEKLPEPGYHTVALFEALGRG---DVKCMIICETN
2napA           FSLTGQ-PNACGGVRD--GGALSHLLPPNAKHRAEMEKLPEPGYHTVALFEALGRG---DVKCMIICETN
2v3vA           FSLTGQ-PNACGGVRD--GGALSHLLPPNAKHRAEMEKLPEPGYHTVALFEALGRG---DVKCMIICETN
2jioA           FSLTGQ-PNACGGVRD--GGALSHLLPPNAKHRAEMEKLPEPGYHTVALFEALGRG---DVKCMIICETN
2e7zA           IQMHEALPEEKKKLQLGTETYTGMSALEEPSERVYGVKYFHNMGAFTALFTAMATEKPYPVKAFFALASN
1kqfA           ----------------------------------------------------------------------
1fdiA           --DMGALPDTYPGYQ--------YVKDPANREKFAKAWGVES---LPAHTGYRISELPHEVRAAYIMGED
1aa6A           --DMGALPDTYPGYQ--------YVKDPANREKFAKAWGVES---LPAHTGYRISELPHEVRAAYIMGED
1cxtA           XXXSYHYSNGGSPTSD------GPALGGISARVVDMLLNPGGEFQFNG------ATATYPVKLAYWAGGN
1cxsA           -SPTSDGPALGGISDGGWATSIP------CARVVDMLLNPGGEFQFNG------ATATYPVKLAYWAGGN
1eu1A           -SPTSDGP-ALGGISDGGE---GGATSIPCARVVDMLLNPGGEFQFNG------ATATYPVKLAYWAGGN
2dmrA           XXSXXXXXXALAGITDGGAATKGASVIPV-ARVVDMLENPGAEFDFNG-----TRSKFPDVKMAYWVGGN
1h0hA           ----------------------------------------------------------------------
1e60C           XXSXXXXXXALAGITDGGAASGASVIP--VARVVDMLENPGAEFDFNG-----TRSKFPDVKMAYWVGGN
1h5nA           XXSXXXXXXALAGITDGGASVI-----PV-ARVVDMLENPGAEFDFNG-----TRSKFPDVKMAYWVGGN
1e5vA           XXSXXXXXXALAGITDGGASVI-----PV-ARVVDMLENPGAEFDFNG-----TRSKFPDVKMAYWVGGN
1e61C           XXSYHYXXXXXXXXXXXALAGIGASVIPV-ARVVDMLENPGAEFDFNG-----TRSKFPDVKMAYWVGGN
1e61A           XXSYHYXXXXXXXXXXXALAGIGASVIPV-ARVVDMLENPGAEFDFNG-----TRSKFPDVKMAYWVGGN
4dmrA           XXSYHYXXAGITDGGKGPEWLAASVIP--VARVVDMLENPGAEFDFNG-----TRSKFPDVKMAYWVGGN
1tmoA           XXXXXXXXXXXXXXXXXXXXXXXRNLDENQKPLFDSSDFKGASSTIPVAIDAILEKVVYPIKMMIFSGNN
1e60A           XXSYHYXXGAATKGPEWLAASGASVIP--VARVVDMLENPGAEFDFNG-----TRSKFPDVKMAYWVGGN
1dmrA           XXSYHYXXGAATKGPEWLAASGASVIP--VARVVDMLENPGAEFDFNG-----TRSKFPDVKMAYWVGGN
1e18A           ----------------------------------------------------------------------
1dmsA           ----------------------------------------------------------------------
1siwA           ----------------------------------------------------------------------
1r27A           ----------------------------------------------------------------------
1q16A           ----------------------------------------------------------------------
1ogyA           FSLTGQ-PFAVGTFAHRLPADMVVTNPEHRAHAEEIWKLPAGLLPDWVGAHAVEQDRKYWVQVNNNMQAA
1g8kA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           PFHRDVNTXXXXXXXXXXXXIVAIDILPQDHIDWSDYVLPDLMFLEREEIGSIKWSLHAGIRYSHKVLDP
2vpyA           LFHSIPNVPRTKEALKNLDLYVAIDVLPQEHVMWADVILPEATYLERYD--DFVLVAHKTPFIQLRTPAH
2ivfA           ----------------------------------------------------------------------
2v45A           PAHTLPNNKVHKAMSHPESFIVCIEAFPDATLEYADLVLPPAFWCERDGVGERRYSL------TEKAVDP
2napA           PAHTLPNNKVHKAMSHPESFIVCIEAFPDATLEYADLVLPPAFWCERDGVGERRYSL------TEKAVDP
2v3vA           PAHTLPNNKVHKAMSHPESFIVCIEAFPDATLEYADLVLPPAFWCERDGVGERRYSL------TEKAVDP
2jioA           PAHTLPNNKVHKAMSHPESFIVCIEAFPDATLEYADLVLPPAFWCERDGVGERRYSL------TEKAVDP
2e7zA           ALMGYANQQNALKGLMNQDLVVCYDQFMTPTAQLADYVLPGDHWLERPVVQP-NWEGIPFGNTSQQVVEP
1kqfA           ----------------------------------------------------------------------
1fdiA           PLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFT---AADRGFQRFFKAVEP
1aa6A           PLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFT---AADRGFQRFFKAVEP
1cxtA           PFAHHQDRNRMLKAWEKLETFIVQDFQWTATARHADIVLPATTSYERNDIESVGDYSNRAILAMKKVVDP
1cxsA           PFAHHQDRNRMLKAWEKLETFIVQDFQWTATARHADIVLPATTSYERNDIESVGDYSNRAILAMKKVVDP
1eu1A           PFAHHQDRNRMLKAWEKLETFIVQDFQWTATARHADIVLPATTSYERNDIESVGDYSNRAILAMKKVVDP
2dmrA           PFHQDRNRMVKAWEKLETFVVHDFQWTPTAR--HADIVLPATTSYERNDIETIGDYSNTGILAMKKIVEP
1h0hA           ----------------------------------------------------------------------
1e60C           PFHQDRNRMVKAWEKLETFVVHDFQWTPTAR--HADIVLPATTSYERNDIETIGDYSNTGILAMKKIVEP
1h5nA           PFHQDRNRMVKAWEKLETFVVHDFQWTPTAR--HADIVLPATTSYERNDIETIGDYSNTGILAMKKIVEP
1e5vA           PFHQDRNRMVKAWEKLETFVVHDFQWTPTAR--HADIVLPATTSYERNDIETIGDYSNTGILAMKKIVEP
1e61C           PFHQDRNRMVKAWEKLETFVVHDFQWTPTAR--HADIVLPATTSYERNDIETIGDYSNTGILAMKKIVEP
1e61A           PFHQDRNRMVKAWEKLETFVVHDFQWTPTAR--HADIVLPATTSYERNDIETIGDYSNTGILAMKKIVEP
4dmrA           PFHQDRNRMVKAWEKLETFVVHDFQWTPTAR--HADIVLPATTSYERNDIETIGDYSNTGILAMKKIVEP
1tmoA           PWNHHQDRNRMKQAFHKLECVVTVDVNWTATCRFSDIVLPACTTYERNDIDVYGAYANRGILAMQKMVEP
1e60A           PFHQDRNRMVKAWEKLETFVVHDFQWTPTAR--HADIVLPATTSYERNDIETIGDYSNTGILAMKKIVEP
1dmrA           PFHQDRNRMVKAWEKLETFVVHDFQWTPTAR--HADIVLPATTSYERNDIETIGDYSNTGILAMKKIVEP
1e18A           ----------------------------------------------------------------------
1dmsA           ----------------------------------------------------------------------
1siwA           ----------------------------------------------------------------------
1r27A           ----------------------------------------------------------------------
1q16A           ----------------------------------------------------------------------
1ogyA           P---NIDQETYPGYRNPENFIVVSDAYPTVTGRAADLVLPAAMWVEKEAYGNAERRTH----FWHQLVEA
1g8kA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           PPGVDARSAFWALMEIIRRAFPEKAKIVEYDEKYADYNAFEHYEKKFFEAALRKLAETWKLDFEEIKEAL
2vpyA           EPLFDTKPGWWIARELLRLGL----------EQYFPWKTIEEY----LETRLQSLG----LDLETMKGTL
2ivfA           ----------------------------------------------------------------------
2v45A           PG--QCRPTVNTLVEFARRA--------------------------------------------------
2napA           PG--QCRPTVNTLVEFARRA--------------------------------------------------
2v3vA           PG--QCRPTVNTLVEFARRA--------------------------------------------------
2jioA           PG--QCRPTVNTLVEFARRA--------------------------------------------------
2e7zA           AG--EAKDEYYFIRELAVRMGLE-----------------EHFPWKDRLELINYRISPTGMEWEEYQKQY
1kqfA           ----------------------------------------------------------------------
1fdiA           K--WDLKTDWQIISEIATRGYP-----MHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWRDTSDA-
1aa6A           K--WDLKTDWQIISEIATRGYP-----MHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWRDTSDA-
1cxtA           L--YEARSDYDIFAALAER-LGKGAEFTEGRDEMGWISSF--YEAAVKQAEFKNVAMPSFEDFEGIVEFP
1cxsA           L--YEARSDYDIFAALAER-LGKGAEFTEGRDEMGWISSF--YEAAVKQAEFKNVAMPSFEDFEGIVEFP
1eu1A           L--YEARSDYDIFAALAER-LGKGAEFTEGRDEMGWISSF--YEAAVKQAEFKNVAMPSFEDFEGIVEFP
2dmrA           L--YEARSDYDIFAAVAER-LGKGAEFTEGKDEMGWIKSFYDDAAKQGKAAGVQMPAFDAFWAEGIVEFP
1h0hA           ----------------------------------------------------------------------
1e60C           L--YEARSDYDIFAAVAER-LGKGAEFTEGKDEMGWIKSFYDDAAKQGKAAGVEMPAFDAFWAEGIVEFP
1h5nA           L--YEARSDYDIFAAVAER-LGKGAEFTEGKDEMGWIKSFYDDAAKQGKAAGVQMPAFDAFWAEGIVEFP
1e5vA           L--YEARSDYDIFAAVAER-LGKGAEFTEGKDEMGWIKSFYDDAAKQGKAAGVQMPAFDAFWAEGIVEFP
1e61C           L--YEARSDYDIFAAVAER-LGKGAEFTEGKDEMGWIKSFYDDAAKQGKAAGVEMPAFDAFWAEGIVEFP
1e61A           L--YEARSDYDIFAAVAER-LGKGAEFTEGKDEMGWIKSFYDDAAKQGKAAGVEMPAFDAFWAEGIVEFP
4dmrA           L--YEARSDYDIFAAVAER-LGKGAEFTEGKDEMGWIKSFYDDAAKQGKAAGVQMPAFDAFWAEGIVEFP
1tmoA           L--FDSLSDF----EIFTRFAAVLGKEKEYTRNMGEYNECKAANAGKFE--MPDFATFWKQGYVHF----
1e60A           L--YEARSDYDIFAAVAER-LGKGAEFTEGKDEMGWIKSFYDDAAKQGKAAGVEMPAFDAFWAEGIVEFP
1dmrA           L--YEARSDYDIFAAVAER-LGKGAEFTEGKDEMGWIKSFYDDAAKQGKAAGVQMPAFDAFWAEGIVEFP
1e18A           ----------------------------------------------------------------------
1dmsA           ----------------------------------------------------------------------
1siwA           ----------------------------------------------------------------------
1r27A           ----------------------------------------------------------------------
1q16A           ----------------------------------------------------------------------
1ogyA           PG--EARSDLWQLMEFSKRFTTDEVWPEEILSAAPAYRGKTLFEVLFANGSVDRFASDVNPDHANHEAAL
1g8kA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           ERDGFYILKKKTYETRPYKTPLGTPSGKVEIYTLRALKYGIDPLPDWIPPVYKIPQASDEFYLVNGKDNF
2vpyA           VQRGKPWLEDWEKEGR---LPFGTASGKIELYCQRFKEAGHQPLPVF---TXXXXXXXGFYRLLYGRS--
2ivfA           ----------------------------------------------------------------------
2v45A           ----------------------------------------------------------------------
2napA           ----------------------------------------------------------------------
2v3vA           ----------------------------------------------------------------------
2jioA           ----------------------------------------------------------------------
2e7zA           T----YMSKLPDY-FGPEGVGVATPSGKVELYSSVFEKLGYDPLPYYHEPLISDPELAKEYPLIREDSNF
1kqfA           ----------------------------------------------------------------------
1fdiA           DQGTSYLFKEK----------FDTPNGLAQFFTC-----------DWVAPIDKL---TDEYPMVLSTVRE
1aa6A           DQGTSYLFKEK----------FDTPNGLAQFFTC-----------DWVAPIDKL---TDEYPMVLSTVRE
1cxtA           ITEGANFVRYADFREDPLFNPLGTPSGLIEIYSKNIEKMGYDDCPTWMEPAERLGGAGAKYPL-------
1cxsA           ITEGANFVRYADFREDPLFNPLGTPSGLIEIYSKNIEKMGYDDCPTWMEPAERLGGAGAKYPL-------
1eu1A           ITEGANFVRYADFREDPLFNPLGTPSGLIEIYSKNIEKMGYDDCPTWMEPAERLGGAGAKYPL-------
2dmrA           VTDGADFVRYASFREDXXXXXXXXXXXXIEIYSKNIEKMGYDDCPTWMEPLERL----------------
1h0hA           ----------------------------------------------------------------------
1e60C           VTDGADFVRYASFREDXXXXXXXXXXXXIEIYSKNIEKMGYDDCPTWMEPLERL----------------
1h5nA           VTDGADFVRYASFREDXXXXXXXXXXXXIEIYSKNIEKMGYDDCPTWMEPLERL----------------
1e5vA           VTDGADFVRYASFREDXXXXXXXXXXXXIEIYSKNIEKMGYDDCPTWMEPLERL----------------
1e61C           VTDGADFVRYASFREDXXXXXXXXXXXXIEIYSKNIEKMGYDDCPTWMEPLERL----------------
1e61A           VTDGADFVRYASFREDXXXXXXXXXXXXIEIYSKNIEKMGYDDCPTWMEPLERL----------------
4dmrA           VTDGADFVRYASFREDXXXXXXXXXXXXIEIYSKNIEKMGYDDCPTWMEPLERL----------------
1tmoA           -GDGEVWTRHADFRNDPEINPLGTPSGLIEIFSRKIDQFGYDDCPTWMEKTERSPGSDKHPIWLQSCHPD
1e60A           VTDGADFVRYASFREDXXXXXXXXXXXXIEIYSKNIEKMGYDDCPTWMEPLERL----------------
1dmrA           VTDGADFVRYASFREDXXXXXXXXXXXXIEIYSKNIEKMGYDDCPTWMEPLERL----------------
1e18A           ----------------------------------------------------------------------
1dmsA           ----------------------------------------------------------------------
1siwA           ----------------------------------------------------------------------
1r27A           ----------------------------------------------------------------------
1q16A           ----------------------------------------------------------------------
1ogyA           --FGFYPQKGLFEEYAAFGRGHGHDLAPFDTYEVRGLHWGFDPYPDGRAVILGVPESPDEFWLVTGREHW
1g8kA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           VSAHMVMVKNAKWIADRTVWMNPADAERLGIKDGDVVELEGLDNGFKAMAVVKVTNRVKPGVLFTYAFVG
2vpyA           -PVHTFARTQNNWVPENEVWIHKEEAKRLGLKEGDYVMLVNQDGVKEGPVRVKPTARIRKDCVY------
2ivfA           ----------------------------------------------------------------------
2v45A           ----------------------------------------------------------------------
2napA           ----------------------------------------------------------------------
2v3vA           ----------------------------------------------------------------------
2jioA           ----------------------------------------------------------------------
2e7zA           QSCYHQILRDAE--PDPVALLHPKTAQSLGLPSGEWIWVE------------------------------
1kqfA           ----------------------------------------------------------------------
1fdiA           VGHYSCMTGNCAALAALAAQINTEDAKRLGIEDEALVWVHSRKG--KIITRAQVSDRPNKGAIYTYQWWI
1aa6A           VGHYSCMTGNCAALAALAAQINTEDAKRLGIEDEALVWVHSRKG--KIITRAQVSDRPNKGAIY------
1cxtA           ----------------------------------------------------------------------
1cxsA           ----------------------------------------------------------------------
1eu1A           ----------------------------------------------------------------------
2dmrA           ----------------------------------------------------------------------
1h0hA           ----------------------------------------------------------------------
1e60C           ----------------------------------------------------------------------
1h5nA           ----------------------------------------------------------------------
1e5vA           ----------------------------------------------------------------------
1e61C           ----------------------------------------------------------------------
1e61A           ----------------------------------------------------------------------
4dmrA           ----------------------------------------------------------------------
1tmoA           KRLHSQMCESREYNGREPVYISPVDAKARGIKDGDIVRV-------------------------------
1e60A           ----------------------------------------------------------------------
1dmrA           ----------------------------------------------------------------------
1e18A           ----------------------------------------------------------------------
1dmsA           ----------------------------------------------------------------------
1siwA           ----------------------------------------------------------------------
1r27A           ----------------------------------------------------------------------
1q16A           ----------------------------------------------------------------------
1ogyA           HSGSMTLPELYKAFPGAVCFMHPEDARSRGLNRGSEVRVISRRGEIRTRLETRGRNRMPRGVVF------
1g8kA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           GRTSKLISGEYQFLKEGINPQWFTTGKVEPVxxxxxxxxxxxxxxx
2vpyA           ----------------------------------------------
2ivfA           ----------------------------------------------
2v45A           ----------------------------------------------
2napA           ----------------------------------------------
2v3vA           ----------------------------------------------
2jioA           ----------------------------------------------
2e7zA           ----------------------------------------------
1kqfA           ----------------------------------------------
1fdiA           GACNELVTENLSPITK--TPEYYCAVRVEPI---------------
1aa6A           ----------------------------------------------
1cxtA           ----------------------------------------------
1cxsA           ----------------------------------------------
1eu1A           ----------------------------------------------
2dmrA           ----------------------------------------------
1h0hA           ----------------------------------------------
1e60C           ----------------------------------------------
1h5nA           ----------------------------------------------
1e5vA           ----------------------------------------------
1e61C           ----------------------------------------------
1e61A           ----------------------------------------------
4dmrA           ----------------------------------------------
1tmoA           ----------------------------------------------
1e60A           ----------------------------------------------
1dmrA           ----------------------------------------------
1e18A           ----------------------------------------------
1dmsA           ----------------------------------------------
1siwA           ----------------------------------------------
1r27A           ----------------------------------------------
1q16A           ----------------------------------------------
1ogyA           ----------------------------------------------
1g8kA           ----------------------------------------------