[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for paer1:AAL64528.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2zkqj.bssp"
#ERROR : Can't open dsspfile "1s1hJ.bssp"
#ERROR : Can't open dsspfile "2j00J.bssp"
#ERROR : Can't open dsspfile "1vs5J.bssp"
#ERROR : Can't open dsspfile "2gy9J.bssp"
#ERROR : Can't open dsspfile "3bbnJ.bssp"
#ERROR : Can't open dsspfile "3d3bJ.bssp"
#ERROR : Can't open dsspfile "3d3cK.bssp"
#ERROR : Can't open dsspfile "3d3cJ.bssp"

## Summary of PDB Search
:106
    4e-17  33%  2zkqj  [x.x.x] 40S RIBOSOMAL PROTEIN S20E
    6e-16  36%  1s1hJ  [i.1.1] 40S RIBOSOMAL PROTEIN S20
    1e-14  40%  2j00J  [d.58.15 (1fjgJ)] 30S RIBOSOMAL PROTEIN S10
    6e-13  39%  1vs5J  [x.x.x] 30S RIBOSOMAL PROTEIN S10
    2e-12  39%  2gy9J  [x.x.x] 30S RIBOSOMAL SUBUNIT PROTEIN S10
    4e-10  33%  3bbnJ  [x.x.x] RIBOSOMAL PROTEIN S10
    4e-09  43%  3d3bJ  [x.x.x] 30S RIBOSOMAL PROTEIN S10
    5e-09  43%  3d3cK  [x.x.x] 30S RIBOSOMAL PROTEIN S10
    5e-09  43%  3d3cJ  [x.x.x] 30S RIBOSOMAL PROTEIN S10
:106

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxRKVRIRLYGTNPADVEQVAREIVDLAKKMGVQVRGPIPLPTRRLIVTVRRAPSGQGYHTFDHWE
2zkqj           -------RIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQ
1s1hJ           -------KIRITLTSTKVKQLENVSSNIVKNAEQHNLVKKGPVRLPTKVLKISTRKTPNGEGSKTWETYE
2j00J           -------KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPF-KHKDSREHFE
1vs5J           -------RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
2gy9J           -------RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
3bbnJ           ------QKIRIKLRSYWVPLIEDSCKQIMDAARTTNAKTMGPVPLPTKKRIFCVLKSPHVHKDARF-HFE
3d3bJ           ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTR----------------------
3d3cK           ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTR----------------------
3d3cJ           ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTR----------------------


                         .         .         *         .         .         .         .:140
query           MRISKRLIDIEASERVLRRLMTIRVPDTVKIELQLx
2zkqj           MRIHKRLIDLHSPSEIVKQITSISIEPGVEVEV---
1s1hJ           MRIHKRYIDLEAPVQIVKRITQITIEPGVDVEV---
2j00J           LRTHNRLVDINPNRKTIEQLMTLDLPTGVEIEIK--
1vs5J           IRTHLRLVDIEPTEKTVDALMRLDLAAGVDVQISL-
2gy9J           IRTHLRLVDIEPTEKTVDALMRLDLAAGVDVQI---
3bbnJ           IRTHQRLIDIYPTAQTIDSLMQLDLPAGVDVEVKL-
3d3bJ           SRTHLRLVDIEPTEKTVDALMRLDLAAGVDVQISL-
3d3cK           SRTHLRLVDIEPTEKTVDDLMRLDLAAGVDVQISL-
3d3cJ           SRTHLRLVDIEPTEKTVDDLMRLDLAAGVDVQISL-