[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for paer1:AAL64909.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1k3rB.bssp"
#ERROR : Can't open dsspfile "1k3rA.bssp"

## Summary of PDB Search
:270
    2e-29  41%  1k3rB  [c.116.1 - b.40.4] CONSERVED PROTEIN MT0001
    2e-29  41%  1k3rA  [c.116.1 - b.40.4] CONSERVED PROTEIN MT0001
:270

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxSIAIPHDFLSEIPDEAGKVRKLGYLARAAAIFKAEYIIIYHYGTPRREDIDFAKTVLEYLVTPPYLRK
1k3rB           --SLFIPDSLTAETGDLKIKTYKVVLIARAASIFGVKRIVIYH------DDADFIRDILTYMDTPQYLRR
1k3rA           --SLFIPDSLTAETGDLKIKTYKVVLIARAASIFGVKRIVIYH------DDADFIRDILTYMDTPQYLRR


                         .         .         *         .         .         .         .:140
query           KVYKIDNRLKLAGLLPPLKIPSHTVPVEPRIGEIREGIVERWDGYYSLIYIGGGKYAKVPKPYPIGTRLL
1k3rB           KVFPIMRELKHVGILPPLRTPHHPTG-KPVTGEYRQGLTVKRVKKGTLVDIGADKLA------------L
1k3rA           KVFPIMRELKHVGILPPLRTPHHPTG-KPVTGEYRQGLTVKRVKKGTLVDIGADKLA------------L


                         +         .         .         .         .         *         .:210
query           VRIEGTTSRPDTYRAAVYRGAPPDYWGYKIDVRPLQNLSEGFDTVILTGKEGKSICEAKPKIGKKTLVVF
1k3rB           CREKLTVNRIMSFRVVIEPDEPEDYWGYEVDTR--RNLAEGADVVVATSRNASPITEVKTRMAREAAILF
1k3rA           CREKLTVNRIMSFRVVIEPDEPEDYWGYEVDTR--RNLAEGADVVVATSRNASPITEVKTRMAREAAILF


                         .         .         .         +         .         .         .:280
query           GGPRKGVDEIFREAGLEPPGELINFAPGQGVETIRTEEAVFIVLSILNYIAKxxxxxxxx
1k3rB           GGPYKGLPEIDADI-------WVNTLPGQCTETVRTEEAVLATLSVFNMLTQ--------
1k3rA           GGPYKGLPEIDADI-------WVNTLPGQCTETVRTEEAVLATLSVFNMLTQ--------