[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for paer1:AAL64927.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ug9A.bssp"
#ERROR : Can't open dsspfile "2b5dX.bssp"
#ERROR : Can't open dsspfile "1ufaA.bssp"

## Summary of PDB Search
:999
    3e-20  35%  1ug9A  [b.30.5 - a.102.1 - b.1.18 - b.1.9] GLUCODEXTRANASE
    2e-05  25%  2b5dX  [x.x.x] ALPHA-AMYLASE
    7e-04  30%  1ufaA  [c.6.2 - a.8.3] TT1467 PROTEIN
:999

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ug9A           ----------------------------------------------------------------------
2b5dX           ----------------------------------------------------------------------
1ufaA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ug9A           ----------------------------------------------------------------------
2b5dX           ----------------------------------------------------------------------
1ufaA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYTREDLKKVLQIHL
1ug9A           ----------------------------------------------------------------------
2b5dX           --------------------------------------------------------FYREHFEKILNVFR
1ufaA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ELIKQVLPVYKKLAEQGRIELVPVPYSHPLMPLLADMGAIYDLKLHVNLSNSLFKRYLGVTPTGVWPPEx
1ug9A           ----------------------------------------------------------------------
2b5dX           SYDGNILEGFKKYQETGKLEIVTCNATHAFLPLYQMYPEVVNAQITVGVKN--YEKHMKKHPRGIWLAE-
1ufaA           -----LVAAFRKAEEGGQVELITSNATHGYSPLLGYDEALW---AQIKTGVSTYRRHFAKDPTGFWLPE-


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ug9A           ----------------------------------------------------------------------
2b5dX           ----------------------------------------------------------------------
1ufaA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ug9A           ----------------------------------------------------------------------
2b5dX           ----------------------------------------------------------------------
1ufaA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ug9A           ----------------------------------------------------------------------
2b5dX           ----------------------------------------------------------------------
1ufaA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ug9A           ----------------------------------------------------------------------
2b5dX           ----------------------------------------------------------------------
1ufaA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ug9A           ----------------------------------------------------------------------
2b5dX           ----------------------------------------------------------------------
1ufaA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxADPVGDD
1ug9A           ---------------------------------------------------------------SDPAGDD
2b5dX           ----------------------------------------------------------------------
1ufaA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           FGPGRYQYPKNPVFKPGVFDLTEFSLYDVGDKLRFVFKVRELGDNPWGGPAGFSLQFFHVYINRGSGSRN
1ug9A           NGPGTYRYPTNSAYVPGAFDLTGVDVYDAGDDYAFVATIAGEVTNPWGGQA-ISHQRVNIYLGKGEGGAT
2b5dX           ----------------------------------------------------------------------
1ufaA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           DTLGLRVALCRDAAWDVALLIGPGWSGGNRIVYSDNTYVDDAMSIKVAPNNTVVADVPKRYIGEFNSSWK
1ug9A           PGLGTNINL--EHAWD-SVIVTDGRFDGAGVYAPDGTRTSAVSLLAVPEARQIVTRVPKAALGGLDARMS
2b5dX           ----------------------------------------------------------------------
1ufaA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           ITVFLTSWDGYGPDNIRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ug9A           VAMFGNAESGEGIGNVR-----------------------------------------------------
2b5dX           ----------------------------------------------------------------------
1ufaA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ug9A           ----------------------------------------------------------------------
2b5dX           ----------------------------------------------------------------------
1ufaA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxx
1ug9A           -------------------
2b5dX           -------------------
1ufaA           -------------------