[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for paer1:AAL64972.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3guvA.bssp"
#ERROR : Can't open dsspfile "1gdtA.bssp"
#ERROR : Can't open dsspfile "1zr2B.bssp"
#ERROR : Can't open dsspfile "1zr2A.bssp"

## Summary of PDB Search
:251
    4e-06  28%  3guvA  [x.x.x] SITE-SPECIFIC RECOMBINASE, RESOLVASE FAMILY
    8e-05  24%  1gdtA  [c.53.1 - a.4.1] PROTEIN (GAMMA DELTA RESOLVASE)
    1e-04  24%  1zr2B  [x.x.x] TRANSPOSON GAMMA-DELTA RESOLVASE
    1e-04  24%  1zr2A  [x.x.x] TRANSPOSON GAMMA-DELTA RESOLVASE
:251

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xITAVTYIRVSTEEQDPENQRVFLERWAGERGIYIVKHYVDVGVSGATEPWERPAFRQMASEVDKLEPRP
3guvA           -IKVYLYTRVSTSIQSLEAQKSRMKAFAIYNDYEIVGEYEDAGKSGKSIEG-RIQFNRMMEDIKSGKDGV
1gdtA           ------YARVSTSQQSLDIQVRALK----DAGVKANRIFTDKASGSSSDRKGLDLLRMKVEEGD------
1zr2B           ------YARVSTSQQSLDIQVRALK----DAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGD------
1zr2A           ------YARVSTSQQSLDIQVRALK----DAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGD------


                         .         .         *         .         .         .         .:140
query           RVLLVYEISRLVRSFQELFTLLDVVENRLGLVVVSASEREQALQNLDGVYRQFLRAVLAFVATMEREFIR
3guvA           SFVLVFKLSRFARNAADVLSTLQIMQD-YGVNLICVED------GIDSSKDKLMISVLSAVAEIERENIR
1gdtA           -VILVKKLDRLGRDTADMIQLIKEFDAQ----GVSIRFIDDGIST-DGEMGKMVVTILSAVAQAERQRIL
1zr2B           -VILVKKLDRLGRDTADMIQLIKEFDAQ----GVSIRFIDDGIST-DSYIGKMVVTILSAVAQAERQRIL
1zr2A           -VILVKKLDRLGRDTADMIQLIKEFDAQ----GVSIRFIDDGIST-DSYIGKMVVTILSAVAQAERQRIL


                         +         .         .         .         .         *         .:210
query           QRTKTALERARLQGKVWNVAEKRRDLTQAVVEMYLSGASLRETARAFGLSLYEVRRILSNAxxxxxxxxx
3guvA           QTMEGCIQKAR-----------------------------------------------------------
1gdtA           ERTNEGRQEAMAKGVVF--GRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINES---------
1zr2B           QRTNEGRQEAMAKGVVF--GRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINES---------
1zr2A           QRTNEGRQEAMAKGVVF--GRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINES---------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3guvA           -----------------------------------------
1gdtA           -----------------------------------------
1zr2B           -----------------------------------------
1zr2A           -----------------------------------------