[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for paer1:AAL65054.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2e87A.bssp"
#ERROR : Can't open dsspfile "2qu8A.bssp"
#ERROR : Can't open dsspfile "1udxA.bssp"
#ERROR : Can't open dsspfile "1lnzA.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "3ibyC.bssp"
#ERROR : Can't open dsspfile "3ibyA.bssp"
#ERROR : Can't open dsspfile "2wjhA.bssp"
#ERROR : Can't open dsspfile "2wjgB.bssp"
#ERROR : Can't open dsspfile "2wjgA.bssp"
#ERROR : Can't open dsspfile "1rflA.bssp"
#ERROR : Can't open dsspfile "2gjaB.bssp"
#ERROR : Can't open dsspfile "2gjaA.bssp"
#ERROR : Can't open dsspfile "2gj9B.bssp"
#ERROR : Can't open dsspfile "2gj9A.bssp"
#ERROR : Can't open dsspfile "3ievA.bssp"
#ERROR : Can't open dsspfile "3ibyB.bssp"
#ERROR : Can't open dsspfile "1xzqA.bssp"
#ERROR : Can't open dsspfile "1xzpA.bssp"
#ERROR : Can't open dsspfile "3ibyD.bssp"
#ERROR : Can't open dsspfile "3a1vA.bssp"
#ERROR : Can't open dsspfile "3a1uA.bssp"
#ERROR : Can't open dsspfile "3a1tA.bssp"
#ERROR : Can't open dsspfile "1wf3A.bssp"
#ERROR : Can't open dsspfile "1egaB.bssp"
#ERROR : Can't open dsspfile "1egaA.bssp"
#ERROR : Can't open dsspfile "3a1sB.bssp"
#ERROR : Can't open dsspfile "3a1sA.bssp"
#ERROR : Can't open dsspfile "2wjjB.bssp"
#ERROR : Can't open dsspfile "2wjjA.bssp"
#ERROR : Can't open dsspfile "2gj8D.bssp"
#ERROR : Can't open dsspfile "2gj8B.bssp"
#ERROR : Can't open dsspfile "2gj8A.bssp"
#ERROR : Can't open dsspfile "3a1vB.bssp"
#ERROR : Can't open dsspfile "2om7L.bssp"
#ERROR : Can't open dsspfile "1fnmA.bssp"
#ERROR : Can't open dsspfile "1eloA.bssp"
#ERROR : Can't open dsspfile "2efgA.bssp"
#ERROR : Can't open dsspfile "1lnzB.bssp"
#ERROR : Can't open dsspfile "3i92C.bssp"
#ERROR : Can't open dsspfile "3i92B.bssp"
#ERROR : Can't open dsspfile "3i8sB.bssp"
#ERROR : Can't open dsspfile "3i8xA.bssp"
#ERROR : Can't open dsspfile "2bm1A.bssp"
#ERROR : Can't open dsspfile "2wjiA.bssp"
#ERROR : Can't open dsspfile "1darA.bssp"
#ERROR : Can't open dsspfile "1mkyA.bssp"
#ERROR : Can't open dsspfile "3a1uB.bssp"
#ERROR : Can't open dsspfile "3i92A.bssp"

## Summary of PDB Search
:346
    3e-54  37%  2e87A  [x.x.x] HYPOTHETICAL PROTEIN PH1320
    5e-26  46%  2qu8A  [x.x.x] PUTATIVE NUCLEOLAR GTP-BINDING PROTEIN 1
    2e-10  36%  1udxA  [b.117.1 - c.37.1 - d.242.1] THE GTP-BINDING PROTEIN OBG
    1e-08  34%  1lnzA  [b.117.1 - c.37.1] SPO0B-ASSOCIATED GTP-BINDING PROTEIN
    4e-07  27%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    9e-07  28%  3ibyC  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
    9e-07  28%  3ibyA  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
    1e-06  26%  2wjhA  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
    1e-06  26%  2wjgB  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
    1e-06  26%  2wjgA  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
    2e-06  31%  1rflA  [c.37.1] PROBABLE TRNA MODIFICATION GTPASE TRME
    2e-06  31%  2gjaB  [x.x.x] TRNA MODIFICATION GTPASE TRME
    2e-06  31%  2gjaA  [x.x.x] TRNA MODIFICATION GTPASE TRME
    2e-06  31%  2gj9B  [x.x.x] TRNA MODIFICATION GTPASE TRME
    2e-06  31%  2gj9A  [x.x.x] TRNA MODIFICATION GTPASE TRME
    2e-06  28%  3ievA  [x.x.x] GTP-BINDING PROTEIN ERA
    2e-06  28%  3ibyB  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
    3e-06  35%  1xzqA  [d.250.1 - a.24.25 - c.37.1] PROBABLE TRNA MODIFICATION
    3e-06  35%  1xzpA  [d.250.1 - a.24.25 - c.37.1] PROBABLE TRNA MODIFICATION
    3e-06  28%  3ibyD  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
    3e-06  25%  3a1vA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    3e-06  25%  3a1uA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    3e-06  25%  3a1tA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    4e-06  31%  1wf3A  [c.37.1 - d.52.3] GTP-BINDING PROTEIN
    2e-05  26%  1egaB  [c.37.1 - d.52.3] PROTEIN (GTP-BINDING PROTEIN ERA)
    2e-05  26%  1egaA  [c.37.1 - d.52.3] PROTEIN (GTP-BINDING PROTEIN ERA)
    2e-05  35%  3a1sB  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    2e-05  35%  3a1sA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    5e-05  24%  2wjjB  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
    5e-05  24%  2wjjA  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
    5e-05  34%  2gj8D  [x.x.x] TRNA MODIFICATION GTPASE TRME
    5e-05  34%  2gj8B  [x.x.x] TRNA MODIFICATION GTPASE TRME
    5e-05  34%  2gj8A  [x.x.x] TRNA MODIFICATION GTPASE TRME
    7e-05  27%  3a1vB  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    1e-04  36%  2om7L  [x.x.x] ELONGATION FACTOR G
    1e-04  36%  1fnmA  [c.37.1 - b.43.3 - d.58.11 - d.14.1 - d.58.11] ELONGATION
    1e-04  36%  1eloA  [c.37.1 - b.43.3 - d.14.1 - d.58.11 (1ktvA)] ELONGATION
    1e-04  35%  2efgA  [c.37.1 - b.43.3 - d.14.1 - d.58.11] PROTEIN (ELONGATION
    2e-04  35%  1lnzB  [b.117.1 - c.37.1] SPO0B-ASSOCIATED GTP-BINDING PROTEIN
    2e-04  26%  3i92C  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
    2e-04  26%  3i92B  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
    2e-04  26%  3i8sB  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
    3e-04  26%  3i8xA  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
    3e-04  35%  2bm1A  [x.x.x] ELONGATION FACTOR G
    4e-04  26%  2wjiA  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
    4e-04  35%  1darA  [x.x.x] ELONGATION FACTOR G
    6e-04  37%  1mkyA  [c.37.1 - c.37.1 - d.52.5] PROBABLE GTP-BINDING PROTEIN ENGA
    7e-04  25%  3a1uB  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    0.001  26%  3i92A  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
:346

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxPYVYAADELISLFLTTYSREEARGSTAEPAFVKQKRLEIKRIVSSGKAIASILREMALRMP
2e87A           ---------PTVLTADELID---KAFRRAEKAASSFKPRGNKVKKARLRRVRTVSNVVRDNLRKVLERTP
2qu8A           ----------------------------------------------------------------------
1udxA           ----------------------------------------------------------------------
1lnzA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3ibyC           ----------------------------------------------------------------------
3ibyA           ----------------------------------------------------------------------
2wjhA           ----------------------------------------------------------------------
2wjgB           ----------------------------------------------------------------------
2wjgA           ----------------------------------------------------------------------
1rflA           ----------------------------------------------------------------------
2gjaB           ----------------------------------------------------------------------
2gjaA           ----------------------------------------------------------------------
2gj9B           ----------------------------------------------------------------------
2gj9A           ----------------------------------------------------------------------
3ievA           ----------------------------------------------------------------------
3ibyB           ----------------------------------------------------------------------
1xzqA           ----------------------------------------------------------------------
1xzpA           ----------------------------------------------------------------------
3ibyD           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
3a1uA           ----------------------------------------------------------------------
3a1tA           ----------------------------------------------------------------------
1wf3A           ----------------------------------------------------------------------
1egaB           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
2wjjB           ----------------------------------------------------------------------
2wjjA           ----------------------------------------------------------------------
2gj8D           ----------------------------------------------------------------------
2gj8B           ----------------------------------------------------------------------
2gj8A           ----------------------------------------------------------------------
3a1vB           ----------------------------------------------------------------------
2om7L           ----------------------------------------------------------------------
1fnmA           ----------------------------------------------------------------------
1eloA           ----------------------------------------------------------------------
2efgA           ----------------------------------------------------------------------
1lnzB           ----------------------------------------------------------------------
3i92C           ----------------------------------------------------------------------
3i92B           ----------------------------------------------------------------------
3i8sB           ----------------------------------------------------------------------
3i8xA           ----------------------------------------------------------------------
2bm1A           ----------------------------------------------------------------------
2wjiA           ----------------------------------------------------------------------
1darA           ----------------------------------------------------------------------
1mkyA           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
3i92A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FLDRLHPFYRELIDAVIGARAYKHVVAKVGNANLAVKAIAKEAITAVRTAPDKKALLDARRMYKARIIDL
2e87A           GLSTLPKFYQELVDVLVDRDTF-HKAAGIDWAIRIIRELEERYVERIRYSNDPNEIAELRRQFYGRVASV
2qu8A           ----------------------------------------------------------------------
1udxA           ----------------------------------------------------------------------
1lnzA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3ibyC           ----------------------------------------------------------------------
3ibyA           ----------------------------------------------------------------------
2wjhA           ----------------------------------------------------------------------
2wjgB           ----------------------------------------------------------------------
2wjgA           ----------------------------------------------------------------------
1rflA           ----------------------------------------------------------------------
2gjaB           ----------------------------------------------------------------------
2gjaA           ----------------------------------------------------------------------
2gj9B           ----------------------------------------------------------------------
2gj9A           ----------------------------------------------------------------------
3ievA           ----------------------------------------------------------------------
3ibyB           ----------------------------------------------------------------------
1xzqA           ----------------------------------------------------------------------
1xzpA           ----------------------------------------------------------------------
3ibyD           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
3a1uA           ----------------------------------------------------------------------
3a1tA           ----------------------------------------------------------------------
1wf3A           ----------------------------------------------------------------------
1egaB           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
2wjjB           ----------------------------------------------------------------------
2wjjA           ----------------------------------------------------------------------
2gj8D           ----------------------------------------------------------------------
2gj8B           ----------------------------------------------------------------------
2gj8A           ----------------------------------------------------------------------
3a1vB           ----------------------------------------------------------------------
2om7L           ----------------------------------------------------------------------
1fnmA           ----------------------------------------------------------------------
1eloA           ----------------------------------------------------------------------
2efgA           ----------------------------------------------------------------------
1lnzB           ----------------------------------------------------------------------
3i92C           ----------------------------------------------------------------------
3i92B           ----------------------------------------------------------------------
3i8sB           ----------------------------------------------------------------------
3i8xA           ----------------------------------------------------------------------
2bm1A           ----------------------------------------------------------------------
2wjiA           ----------------------------------------------------------------------
1darA           ----------------------------------------------------------------------
1mkyA           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
3i92A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LNDLRPELEKMREIVVFLRKLPSIDPELFTIVVAGAPNVGKSSFVRCVSTAKPEVAEYPFTTKQIHLGHI
2e87A           LRDIDDRLRYLNKAREVLKDLPVVDLEIPTVVIAGHPNVGKSTLLKALTTAKPEIASYPFTTRGINVGQF
2qu8A           --------------------LPSINPHKKTIILSGAPNVGKSSFMNIVSRANVDVQSY-----NLYVGHF
1udxA           --------------------------------LVGYPNAGKSSLLAAMTRAHPKIAPYPFTTLSPNLGVV
1lnzA           ---------KERYIVLELKVLADVG-------LVGFPSVGKSTLLSVVSSAKPKIADYHFTTLVPNLG-V
3a1wA           ------------------------------VALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVF
3ibyC           -------------------------------LLIGNPNCGKTTLFNALTNANQRVGNWPGVTVEKKTGEF
3ibyA           -------------------------------LLIGNPNCGKTTLFNALTNANQRVGNWPGVTVEKKTGEF
2wjhA           ----------------------------YEIALIGNPNVGKSTIFNALTGENVYIGNWPGVTVEKKEGEF
2wjgB           ----------------------------YEIALIGNPNVGKSTIFNALTGENVYIGNWPGVTVEKKEGEF
2wjgA           ----------------------------YEIALIGNPNVGKSTIFNALTGENVYIGNWPGVTVEKKEGEF
1rflA           ------------------------------VVIAGRPNAGKSSLLNALAGREAAVTDIAGTTRDVLREHI
2gjaB           ------------------------------VVIAGRPNAGKSSLLNALAGREAAVTDIAGTTRDVLREHI
2gjaA           ------------------------------VVIAGRPNAGKSSLLNALAGREAAVTDIAGTTRDVLREHI
2gj9B           ------------------------------VVIAGRPNAGKSSLLNALAGREAAVTDIAGTTRDVLREHI
2gj9A           ------------------------------VVIAGRPNAGKSSLLNALAGREAAVTDIAGTTRDVLREHI
3ievA           ------------------------------VAIVGKPNVGKSTLLNNLLGTKVSIISPKAGTTRMRVLGV
3ibyB           -------------------------------LLIGNPNCGKTTLFNALTNANQRVGNWPGVTVEKKTGEF
1xzqA           ------------------------------MVIVGKPNVGKSTLLRLLNEDRAIVTDIPGTTRDVISEEI
1xzpA           ------------------------------MVIVGKPNVGKSTLLRLLNEDRAIVTDIPGTTRDVISEEI
3ibyD           -------------------------------LLIGNPNCGKTTLFNALTNANQRVGNWPGVTVEKKTGEF
3a1vA           ------------------------------VALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVF
3a1uA           ------------------------------VALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVF
3a1tA           ------------------------------VALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVF
1wf3A           ------------------------------VAIVGKPNVGKSTLLNNLLGVKAPISPRPQTTRK-RLRGI
1egaB           ------------------------------IAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGI
1egaA           ------------------------------IAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGI
3a1sB           ------------------------------VALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVF
3a1sA           ------------------------------VALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVF
2wjjB           ----------------------------YEIALIGNPNVGKSTIFNALTGENVYIGNWPGVTVEKKEGEF
2wjjA           ----------------------------YEIALIGNPNVGKSTIFNALTGENVYIGNWPGVTVEKKEGEF
2gj8D           ------------------------------VVIAGRPNAGKSSLLNALAGREAAVTDIAGTTRDVLREHI
2gj8B           ------------------------------VVIAGRPNAGKSSLLNALAGREAAVTDIAGTTRDVLREHI
2gj8A           ------------------------------VVIAGRPNAGKSSLLNALAGREAAVTDIAGTTRDVLREHI
3a1vB           ------------------------------VALAGCPNVGKTSLFNALTGTKQYVANWPGVT--VEKKEV
2om7L           -------------------------------------NIGIAAHIDAGKTTTTERILY--YTGRIAVTTC
1fnmA           -------------------------------------NIGIAAHIDAGKTTTTERILY--YTGRIAVTTC
1eloA           -------------------------------------NIGIAAHIDAGKTTTTERILY--YTGRIAVTTC
2efgA           -------------------------------------NIGIAAHIDAGKTTTTERILY-YTGRIAAVTTC
1lnzB           ---------KERYIVLELKVLADVG-------LVGFPSVGKSTLLSVVSSAKPKIPNLGVETDD------
3i92C           -----------------------------TIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQF
3i92B           -----------------------------TIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQF
3i8sB           -----------------------------TIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQF
3i8xA           -----------------------------TIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQF
2bm1A           ---------------------------LRNIVIAAHIDAGKTTTTERILYYTGRIITAAVTT-------C
2wjiA           ----------------------------YEIALIGNPNVGKSTIFNALTGENVYIG-----TVEKKEGEF
1darA           -------------------------------------NIGIAAHIDAGKTTTTERILY--YTGRAAVTTC
1mkyA           -----------------------------TVLIVGRPNVGKSTFNKLVKDPVQDTVEW------------
3a1uB           ------------------------------VALAGCPNVGKTSLFNALTGTK----QYVANTVEKKEGVF
3i92A           -----------------------------TIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQF


                         .         .         .         +         .         .         .:280
query           FLRGDRVQVIDTPGLLDRPLSERNQIEKQAILALRHLAGVIVFVVDPTPHSGYSLEMQERLWREIKEGFS
2e87A           EDGYFRYQIIDTPGLLDRPISERNEIEKQAILALRYLGNLIIYIFDPSEHCGFPLEEQIHLFEEVHGEFD
2qu8A           DHKLNKYQIIDTPGLLDRAFENRNTIEMTTITALAHINGVILFIIDISEQCGLTIKEQINLFYSIKSVFN
1udxA           EVEEERFTLADIPGIIE----GASEGKGLGLEFLRHIARVLLYVLDAADE---PLKTLETLRKEVGAYDP
1lnzA           ETDDGRSFVADLPGLIE----GAHQGVGLGHQFLRHITRVIVHVIDSDPYDDY-LTINQELSEYNLRLTE
3a1wA           TYKGYTINLIDLPGTYSLGYSSIDEKIARDYL-LKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILA
3ibyC           LLGEHLIEITDLPGVYSL-VSQDEQIAAQSVIDLEY--DCIINVIDAC-HLERHLYLTSQLFE-----LG
3ibyA           LLGEHLIEITDLPGVYSL-VSQDEQIAAQSVIDLEY--DCIINVIDAC-HLERHLYLTSQLFE-----LG
2wjhA           EYNGEKFKVVDLPGVYSLTANSIDEIIARDYI-INEKPDLVVNIVDAT-----ALERNLYLTLQLME-MG
2wjgB           EYNGEKFKVVDLPGVYSLTANSIDEIIARDYI-INEKPDLVVNIVDAT-----ALERNLYLTLQLME-MG
2wjgA           EYNGEKFKVVDLPGVYSLTANSIDEIIARDYI-INEKPDLVVNIVDAT-----ALERNLYLTLQLME-MG
1rflA           HIDGMPLHIIDTAGLREAS-DEVERIGIERAWQEIEQADRVLFMVDGTTTDAVD---PAEIWPEFIARLP
2gjaB           HIDGMPLHIIDTAGLREAS-DEVERIGIERAWQEIEQADRVLFMVDGTTTDAVD---PAEIWPEFIARLP
2gjaA           HIDGMPLHIIDTAGLREAS-DEVERIGIERAWQEIEQADRVLFMVDGTTTDAVD---PAEIWPEFIARLP
2gj9B           HIDGMPLHIIDTAGLREAS-DEVERIGIERAWQEIEQADRVLFMVDGTTTDAVD---PAEIWPEFIARLP
2gj9A           HIDGMPLHIIDTAGLREAS-DEVERIGIERAWQEIEQADRVLFMVDGTTTDAVD---PAEIWPEFIARLP
3ievA           KNIPNEAQIIDTPGIYEPKKSDMVEIAKQSL----EEADVILFMIDAT--EGWR-PRDEEIYQNFIKPLN
3ibyB           LLGEHLIEITDLPGVYSEGISQDEQIAAQSVIDLEY--DCIINVIDAC-HLERHLYLTSQLFE-----LG
1xzqA           VIRGILFRIVDTAGVRSNDLVERLGIER--TLQEIEKADIVLFVLD------------------------
1xzpA           VIRGILFRIVDTAGVRSNDLVERLGIER--TLQEIEKADIVLFVLD------------------------
3ibyD           LLGEHLIEITDLPGVYSLVASQDEQIAAQSVIDLEY--DCIINVIDAC-HLERHLYLTSQLFE-----LG
3a1vA           TYKGYTINLIDLPGTYSLGYSSIDEKIARDYL-LKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILA
3a1uA           TYKGYTINLIDLPGTYSLGYSSIDEKIARDYL-LKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILA
3a1tA           TYKGYTINLIDLPGTYSLGYSSIDEKIARDYL-LKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILA
1wf3A           LTEGRRIVFVDTPG-LHKPMDALGEFMDQEVYEALADVNAVVWVVDPTPED----ELVARALKPLVG--K
1egaB           HTEGAYQAIVDTPGLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWT----PDDEMVLNKLREG-K
1egaA           HTEGAYQAIVDTPGLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWT----PDDEMVLNKLREG-K
3a1sB           TYKGYTINLIDLPG--------------------------------------------------------
3a1sA           TYKGYTINLIDLPG--------------------------------------------------------
2wjjB           EYNGEKFKVVDLPGVYSLTANSIDEIIARDYI-INEKPDLVVNIVDAT----------------------
2wjjA           EYNGEKFKVVDLPGVYSLTANSIDEIIARDYI-INEKPDLVVNIVDAT----------------------
2gj8D           HIDGP-LHIIDTAGLVERIGIERAWQEIEQADRVLFVDGTTTDAVDPA-----------EIWPEFIARLP
2gj8B           HIDGP-LHIIDTAGLVERIGIERAWQEIEQADRVLFVDGTTTDAVDPA-----------EIWPEFIARLP
2gj8A           HIDGP-LHIIDTAGLVERIGIERAWQEIEQADRVLFVDGTTTDAVDPA-----------EIWPEFIARLP
3a1vB           FYKGYTINLIDLPGTYSLGYSSIDEKIARDYL-LKGDADLVILVAD-----SVNPEQSLYLLLEILEMEK
2om7L           FWKDHRINIIDTPGHVDFTI----EVER----SMRVLDGAIV-VFD----SSQGVEPQETVWRQ-AEKYK
1fnmA           FWKDHRINIIDTPGHVDFTI----EVER----SMRVLDGAIV-VFD----SSQGVEPQETVWRQ-AEKYK
1eloA           FWKDHRINIIDTPGHVDFTI----EVER----SMRVLDGAIV-VFD----SSQGVEPQETVWRQ-AEKYK
2efgA           FWKDHRINIIDTPGHVDFTI----EVER----SMRVLDGAIV-VFD----SSQGVEPQETVWRQ-AEKYK
1lnzB           ----GRSFVADLPGLI-----EGHQF-------LRHITRVIVHVIDSDPYDDY-LTINQELSEYNLRLTE
3i92C           STTDHQVTLVDLPGTYSTTISSQTSLDEQ--IACHYIADLLINVVDAS-----NLERNLYLTLQLLE-LG
3i92B           STTDHQVTLVDLPGTYSTTISSQTSLDEQ--IACHYIADLLINVVDAS-----NLERNLYLTLQLLE-LG
3i8sB           STTDHQVTLVDLPGTYSTTISSQTSLDEQ--IACHYIADLLINVVDAS-----NLERNLYLTLQLLE-LG
3i8xA           STTDHQVTLVDLPGTYS--LTTQTSLDEQ--IACHYIADLLINVVDAS-----NLERNLYLTLQLLE-LG
2bm1A           FWKDHRINIIDTPGHVDFTI----EVER----SMRVLDGAIV-VFD----SSQGVEPQETVWRQ-AEKYK
2wjiA           EYNGEKFKVVDLPGVYSLTANSIDEIIARDYI-INEKPDLVVNIVDAT-----ALERNLYLTLQLME-MG
1darA           FWKDHRINIIDTPGHVDFTI----EVER----SMRVLDGAIV-VFD----SSQGVEPQETVWRQ-AEKYK
1mkyA           --YGKTFKLVDTCGVFDNPQDIISQ-KKEVTLNIRE-ADLVLFVVD------------------------
3a1uB           TYKGYTINLIDLPGTYSLGYSSIDEKIARDYL-LKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILA
3i92A           STTDHQVTLVDLPGTYS--LTQTSLDEQIACYILSGDADLLINVVDAS-----NLERNLYLTLQLLE-LG


                         .         *         .         .         .         .         +:350
query           APAVAVLNKIDIATEEELEKARAIFAPIGEISTLNCRGTKEVMDYVLQKYYVPxxxxxxxxxxxxx
2e87A           LPFLVVINKIDVADEENIKRLEKFVKEKGKISALKGTGIDLVKEEIIK------------------
2qu8A           KSIVIGFNKID-------------------------------------------------------
1udxA           APSLVALNKVDL-LEEEAVKALA-------------------------------------------
1lnzA           RPQIIVANKDPEAAEEAFKEKLTDDYPVFPISAVTREGLRELL-----------------------
3a1wA           MTAIDEAKKID---RYELQKHLGI--PVVFTSSVTGEGLEELKEKIVE------------------
3ibyC           KPVVVALNMMDIA-----------------------------------------------------
3ibyA           KPVVVALNMMDIA-----------------------------------------------------
2wjhA           ANLLLALNKMDLAKSLGIE-----------------------------------------------
2wjgB           ANLLLALNKMDLAKSLGIE-----------------------------------------------
2wjgA           ANLLLALNKMDLAKSLGIE-----------------------------------------------
1rflA           APITVVRNKADITGE---------------------------------------------------
2gjaB           APITVVRNKADITGE---------------------------------------------------
2gjaA           APITVVRNKADITGE---------------------------------------------------
2gj9B           APITVVRNKADITGE---------------------------------------------------
2gj9A           APITVVRNKADITGE---------------------------------------------------
3ievA           KPVIVVINKIDLPLIDEIHKKHPELTEIVPISALKGANLDELVKTILK--YLP-------------
3ibyB           KPVVVALNMMDIA-----------------------------------------------------
1xzqA           ------------------------------------------------------------------
1xzpA           ------------------------------------------------------------------
3ibyD           KPVVVALNMMDIA-----------------------------------------------------
3a1vA           MTAIDEAKKTGMKIDRELQKHLGI--PVVFTSSVTGEGLEELKEKIVE------------------
3a1uA           MTAIDEAKKTGMKIDRELQKHLGI--PVVFTSSVTGEGLEELKEKIVE------------------
3a1tA           MTAIDEAKKTGMKIDRELQKHLGI--PVVFTSSVTGEGLEELKEKIVE------------------
1wf3A           VPILLVGNKLDAAKPEEAMKAYHELLPEAEPRMLSALDERQVAE----------------------
1egaB           APVILAVNKVDNVQEK--------------------------------------------------
1egaA           APVILAVNKVDNVQEK--------------------------------------------------
3a1sB           ------------------------------------------------------------------
3a1sA           ------------------------------------------------------------------
2wjjB           ------------------------------------------------------------------
2wjjA           ------------------------------------------------------------------
2gj8D           APITVVRNKADITGE---------------------------------------------------
2gj8B           APITVVRNKADITGE---------------------------------------------------
2gj8A           APITVVRNKADITGE---------------------------------------------------
3a1vB           KVILAMTKKTGMKIDRELQKHLGI--PVVFTSSVTGEGLEELKEKIVE------------------
2om7L           VPRIAFANKMDIRTMQERLGARPVVLPIGREDTFS-------------------------------
1fnmA           VPRIAFANKMDIRTMQERLGARPVVLPIGREDTFS-------------------------------
1eloA           VPRIAFANKMDIRTMQERLGARPVVLPIGREDTFS-------------------------------
2efgA           VPRIAFANKMDIRTMQERLGARPVVLPIGREDTFS-------------------------------
1lnzB           RPQIIVANKDPEAAEEAFKEKLTDDYPVFPISAVTREGLRELL-----------------------
3i92C           IPCIVALNMLDIAEKQNI------------------------------------------------
3i92B           IPCIVALNMLDIAEKQNI------------------------------------------------
3i8sB           IPCIVALNMLDIAEKQNI------------------------------------------------
3i8xA           IPCIVALNMLDIAEKQNI------------------------------------------------
2bm1A           VPRIAFANKMDIRTMQERLGARPVVLPIGREDTFS-------------------------------
2wjiA           ANLLLALNKMDLAKSLGIE-----------------------------------------------
1darA           VPRIAFANKMDIRTMQERLGARPVVLPIGREDTFS-------------------------------
1mkyA           ------------------------------------------------------------------
3a1uB           MTAIDEAKKTGMKIDRELQKHLGI--PVVFTSSVTGEGLEELKEKIVE------------------
3i92A           IPCIVALNMLDIAEKQNI------------------------------------------------