[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for paer1:AAL65069.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dydB.bssp"
#ERROR : Can't open dsspfile "3dydA.bssp"
#ERROR : Can't open dsspfile "1h1cD.bssp"
#ERROR : Can't open dsspfile "1h1cC.bssp"
#ERROR : Can't open dsspfile "1h1cB.bssp"
#ERROR : Can't open dsspfile "1h1cA.bssp"
#ERROR : Can't open dsspfile "1uu2B.bssp"
#ERROR : Can't open dsspfile "1uu2A.bssp"
#ERROR : Can't open dsspfile "1uu1C.bssp"
#ERROR : Can't open dsspfile "1uu1B.bssp"
#ERROR : Can't open dsspfile "1uu1A.bssp"
#ERROR : Can't open dsspfile "1uu0D.bssp"
#ERROR : Can't open dsspfile "1uu0C.bssp"
#ERROR : Can't open dsspfile "1uu0B.bssp"
#ERROR : Can't open dsspfile "1uu0A.bssp"
#ERROR : Can't open dsspfile "2f8jB.bssp"
#ERROR : Can't open dsspfile "2f8jA.bssp"
#ERROR : Can't open dsspfile "1lkcA.bssp"
#ERROR : Can't open dsspfile "1lc8A.bssp"
#ERROR : Can't open dsspfile "1lc7A.bssp"
#ERROR : Can't open dsspfile "1lc5A.bssp"
#ERROR : Can't open dsspfile "1bkgA.bssp"
#ERROR : Can't open dsspfile "1b5oA.bssp"
#ERROR : Can't open dsspfile "2z1zA.bssp"
#ERROR : Can't open dsspfile "1gd9A.bssp"
#ERROR : Can't open dsspfile "3eiaB.bssp"
#ERROR : Can't open dsspfile "3eiaA.bssp"
#ERROR : Can't open dsspfile "3ei9B.bssp"
#ERROR : Can't open dsspfile "3ei9A.bssp"
#ERROR : Can't open dsspfile "3ei8A.bssp"
#ERROR : Can't open dsspfile "3ei7B.bssp"
#ERROR : Can't open dsspfile "3ei7A.bssp"
#ERROR : Can't open dsspfile "3ei6B.bssp"
#ERROR : Can't open dsspfile "3ei6A.bssp"
#ERROR : Can't open dsspfile "1djuB.bssp"
#ERROR : Can't open dsspfile "1djuA.bssp"
#ERROR : Can't open dsspfile "1gc3A.bssp"
#ERROR : Can't open dsspfile "5bj4A.bssp"
#ERROR : Can't open dsspfile "5bj3A.bssp"
#ERROR : Can't open dsspfile "1bjwA.bssp"
#ERROR : Can't open dsspfile "1b5pA.bssp"
#ERROR : Can't open dsspfile "2douB.bssp"
#ERROR : Can't open dsspfile "2douA.bssp"
#ERROR : Can't open dsspfile "3ffhB.bssp"
#ERROR : Can't open dsspfile "3ffhA.bssp"
#ERROR : Can't open dsspfile "1pg8A.bssp"
#ERROR : Can't open dsspfile "2z20B.bssp"
#ERROR : Can't open dsspfile "2z20A.bssp"
#ERROR : Can't open dsspfile "2gb3F.bssp"
#ERROR : Can't open dsspfile "2gb3E.bssp"
#ERROR : Can't open dsspfile "2gb3D.bssp"
#ERROR : Can't open dsspfile "2gb3C.bssp"
#ERROR : Can't open dsspfile "2gb3B.bssp"
#ERROR : Can't open dsspfile "2gb3A.bssp"
#ERROR : Can't open dsspfile "3ezsB.bssp"
#ERROR : Can't open dsspfile "3ezsA.bssp"
#ERROR : Can't open dsspfile "1w7nA.bssp"
#ERROR : Can't open dsspfile "1w7lA.bssp"
#ERROR : Can't open dsspfile "1d2fB.bssp"
#ERROR : Can't open dsspfile "1d2fA.bssp"
#ERROR : Can't open dsspfile "3fvsA.bssp"
#ERROR : Can't open dsspfile "1j32A.bssp"
#ERROR : Can't open dsspfile "1ijiA.bssp"
#ERROR : Can't open dsspfile "1geyA.bssp"
#ERROR : Can't open dsspfile "1gexA.bssp"
#ERROR : Can't open dsspfile "1gewA.bssp"
#ERROR : Can't open dsspfile "1fg7A.bssp"
#ERROR : Can't open dsspfile "1yizA.bssp"
#ERROR : Can't open dsspfile "1yiyA.bssp"
#ERROR : Can't open dsspfile "2r5cB.bssp"
#ERROR : Can't open dsspfile "2r5cA.bssp"
#ERROR : Can't open dsspfile "1o4sB.bssp"
#ERROR : Can't open dsspfile "1o4sA.bssp"
#ERROR : Can't open dsspfile "3dzzB.bssp"
#ERROR : Can't open dsspfile "3dzzA.bssp"

## Summary of PDB Search
:315
    3e-07  30%  3dydB  [x.x.x] TYROSINE AMINOTRANSFERASE
    3e-07  30%  3dydA  [x.x.x] TYROSINE AMINOTRANSFERASE
    1e-06  26%  1h1cD  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-06  26%  1h1cC  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-06  26%  1h1cB  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-06  26%  1h1cA  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-06  26%  1uu2B  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-06  26%  1uu2A  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-06  26%  1uu1C  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-06  26%  1uu1B  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-06  26%  1uu1A  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-06  26%  1uu0D  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-06  26%  1uu0C  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-06  26%  1uu0B  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-06  26%  1uu0A  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-06  26%  2f8jB  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-06  26%  2f8jA  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-06  26%  1lkcA  [c.67.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    2e-06  26%  1lc8A  [c.67.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    2e-06  26%  1lc7A  [c.67.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    2e-06  26%  1lc5A  [c.67.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    3e-06  24%  1bkgA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    3e-06  24%  1b5oA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    4e-06  30%  2z1zA  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    4e-06  35%  1gd9A  [c.67.1] ASPARTATE AMINOTRANSFERASE
    4e-06  30%  3eiaB  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    4e-06  30%  3eiaA  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    4e-06  30%  3ei9B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    4e-06  30%  3ei9A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    4e-06  30%  3ei8A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    4e-06  30%  3ei7B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    4e-06  30%  3ei7A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    4e-06  30%  3ei6B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    4e-06  30%  3ei6A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    4e-06  35%  1djuB  [c.67.1] AROMATIC AMINOTRANSFERASE
    4e-06  35%  1djuA  [c.67.1] AROMATIC AMINOTRANSFERASE
    5e-06  24%  1gc3A  [c.67.1] ASPARTATE AMINOTRANSFERASE
    5e-06  24%  5bj4A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    5e-06  24%  5bj3A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    5e-06  26%  1bjwA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    5e-06  24%  1b5pA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    9e-06  27%  2douB  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    9e-06  27%  2douA  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    2e-05  23%  3ffhB  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-05  23%  3ffhA  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    6e-05  37%  1pg8A  [c.67.1] METHIONINE GAMMA-LYASE
    8e-05  32%  2z20B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    8e-05  32%  2z20A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    8e-05  29%  2gb3F  [x.x.x] ASPARTATE AMINOTRANSFERASE
    8e-05  29%  2gb3E  [x.x.x] ASPARTATE AMINOTRANSFERASE
    8e-05  29%  2gb3D  [x.x.x] ASPARTATE AMINOTRANSFERASE
    8e-05  29%  2gb3C  [x.x.x] ASPARTATE AMINOTRANSFERASE
    8e-05  29%  2gb3B  [x.x.x] ASPARTATE AMINOTRANSFERASE
    8e-05  29%  2gb3A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    8e-05  32%  3ezsB  [x.x.x] AMINOTRANSFERASE ASPB
    8e-05  32%  3ezsA  [x.x.x] AMINOTRANSFERASE ASPB
    1e-04  26%  1w7nA  [c.67.1] KYNURENINE--OXOGLUTARATE TRANSAMINASE I
    1e-04  26%  1w7lA  [c.67.1] KYNURENINE--OXOGLUTARATE TRANSAMINASE I
    1e-04  35%  1d2fB  [c.67.1] MALY PROTEIN
    1e-04  35%  1d2fA  [c.67.1] MALY PROTEIN
    2e-04  25%  3fvsA  [x.x.x] KYNURENINE--OXOGLUTARATE TRANSAMINASE 1
    3e-04  27%  1j32A  [c.67.1] ASPARTATE AMINOTRANSFERASE
    7e-04  29%  1ijiA  [c.67.1] HISTIDINOL PHOSPHATE AMINOTRANSFERASE
    7e-04  29%  1geyA  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    7e-04  29%  1gexA  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    7e-04  29%  1gewA  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    7e-04  29%  1fg7A  [c.67.1] HISTIDINOL PHOSPHATE AMINOTRANSFERASE
    9e-04  20%  1yizA  [x.x.x] KYNURENINE AMINOTRANSFERASE GLUTAMINE
    9e-04  20%  1yiyA  [x.x.x] KYNURENINE AMINOTRANSFERASE GLUTAMINE
    9e-04  20%  2r5cB  [x.x.x] KYNURENINE AMINOTRANSFERASE
    9e-04  20%  2r5cA  [x.x.x] KYNURENINE AMINOTRANSFERASE
    9e-04  23%  1o4sB  [c.67.1] ASPARTATE AMINOTRANSFERASE
    9e-04  23%  1o4sA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    9e-04  31%  3dzzB  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    9e-04  31%  3dzzA  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
:315

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYDIPRQNLAIVSGAQEGNFLAFLAVK
3dydB           ---------------------------------------------------------------LAVLANP
3dydA           ---------------------------------------------------------------LAVLANP
1h1cD           ----------------------------------------------LSKNNVSVGNGADEIIYVLF----
1h1cC           ----------------------------------------------LSKNNVSVGNGADEIIYVLF----
1h1cB           ----------------------------------------------LSKNNVSVGNGADEIIYVLF----
1h1cA           ----------------------------------------------LSKNNVSVGNGADEIIYVLF----
1uu2B           ----------------------------------------------LSKNNVSVGNGADEIIYVMMLMF-
1uu2A           ----------------------------------------------LSKNNVSVGNGADEIIYVMMLMF-
1uu1C           ----------------------------------------------LSKNNVSVGNGADEIIYVMMLMF-
1uu1B           ----------------------------------------------LSKNNVSVGNGADEIIYVMMLMF-
1uu1A           ----------------------------------------------LSKNNVSVGNGADEIIYVMMLMF-
1uu0D           ----------------------------------------------LSKNNVSVGNGADEIIYVMMLMF-
1uu0C           ----------------------------------------------LSKNNVSVGNGADEIIYVMMLMF-
1uu0B           ----------------------------------------------LSKNNVSVGNGADEIIYVMMLMF-
1uu0A           ----------------------------------------------LSKNNVSVGNGADEIIYVMMLMF-
2f8jB           ----------------------------------------------LSKNNVSVGNGADEIIYVMMLMF-
2f8jA           ----------------------------------------------LSKNNVSVGNGADEIIYVMMLMF-
1lkcA           --------------------------------------------HQVPASWILAGNGETESIFTVASGLK
1lc8A           --------------------------------------------HQVPASWILAGNGETESIFTVASGLK
1lc7A           --------------------------------------------HQVPASWILAGNGETESIFTVASGLK
1lc5A           --------------------------------------------HQVPASWILAGNGETESIFTVASGLK
1bkgA           ----------------------------------------------------------------------
1b5oA           ----------------------------------------------------------------------
2z1zA           ----------------------------------------------------------------------
1gd9A           ----------------------------------------------------------------------
3eiaB           ----------------------------------------------------------------------
3eiaA           ----------------------------------------------------------------------
3ei9B           ----------------------------------------------------------------------
3ei9A           ----------------------------------------------------------------------
3ei8A           ----------------------------------------------------------------------
3ei7B           ----------------------------------------------------------------------
3ei7A           ----------------------------------------------------------------------
3ei6B           ----------------------------------------------------------------------
3ei6A           ----------------------------------------------------------------------
1djuB           ----------------------------------------------------------------------
1djuA           ----------------------------------------------------------------------
1gc3A           ----------------------------------------------------------------------
5bj4A           ----------------------------------------------------------------------
5bj3A           ----------------------------------------------------------------------
1bjwA           ----------------------------------------------------------------------
1b5pA           ----------------------------------------------------------------------
2douB           ----------------------------------------------------------------------
2douA           ----------------------------------------------------------------------
3ffhB           ----------------------------------------------------------------------
3ffhA           ----------------------------------------------------------------------
1pg8A           ----------------------------------------------------------------------
2z20B           ----------------------------------------------------------------------
2z20A           ----------------------------------------------------------------------
2gb3F           ---------------------------------------------DVKPENVLVTNGGSEAILFSFIANP
2gb3E           ---------------------------------------------DVKPENVLVTNGGSEAILFSFIANP
2gb3D           ---------------------------------------------DVKPENVLVTNGGSEAILFSFIANP
2gb3C           ---------------------------------------------DVKPENVLVTNGGSEAILFSFIANP
2gb3B           ---------------------------------------------DVKPENVLVTNGGSEAILFSFIANP
2gb3A           ---------------------------------------------DVKPENVLVTNGGSEAILFSFIANP
3ezsB           ----------------------------------------------------------------------
3ezsA           ----------------------------------------------------------------------
1w7nA           -----------------------------------------------PLRNVLVTVGGYGALFTAFQALV
1w7lA           -----------------------------------------------PLRNVLVTVGGYGALFTAFQALV
1d2fB           ----------------------------------------------------------------------
1d2fA           ----------------------------------------------------------------------
3fvsA           -----------------------------------------------PLRNVLVTVGGYGALFTAFQALV
1j32A           --------------------------------------------------NILVTNGGKQSIFNLMLAIE
1ijiA           -------------------------------------------------EQVLVSRGADEGIELAFCEPG
1geyA           -------------------------------------------------EQVLVSRGADEGIELAFCEPG
1gexA           -------------------------------------------------EQVLVSRGADEGIELAFCEPG
1gewA           -------------------------------------------------EQVLVSRGADEGIELAFCEPG
1fg7A           -------------------------------------------------------------NYAQYAGVK
1yizA           ----------------------------------------------------------------------
1yiyA           ----------------------------------------------------------------------
2r5cB           ----------------------------------------------------------------------
2r5cA           ----------------------------------------------------------------------
1o4sB           ---------------------------------------------DISPDQVVVTNGAKQALFNAFMALL
1o4sA           ---------------------------------------------DISPDQVVVTNGAKQALFNAFMALL
3dzzB           ----------------------------------------------------------------------
3dzzA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PEYAVITVPEYEPIIKLPSSLGVRHVKVWDVWEAPIKPGGVLIFSNPNNPTGRYLEKRELAELADEARRK
3dydB           GQNILVPRPGFSLYKTLAESMGIE-VKLYNLWEIDLKQTACLIVNNPSNPCGSVFSKRHLQKILAVAARQ
3dydA           GQNILVPRPGFSLYKTLAESMGIE-VKLYNLWEIDLKQTACLIVNNPSNPCGSVFSKRHLQKILAVAARQ
1h1cD           -DRSVFFPPTYSCYRIFAKAVGAKFLEVLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERIL----KT
1h1cC           -DRSVFFPPTYSCYRIFAKAVGAKFLEVLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERIL----KT
1h1cB           -DRSVFFPPTYSCYRIFAKAVGAKFLEVLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERIL----KT
1h1cA           -DRSVFFPPTYSCYRIFAKAVGAKFLEVLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERIL----KT
1uu2B           -DRSVFFPPTYSCYRIFAKAVGAKFLEVLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERIL----KT
1uu2A           -DRSVFFPPTYSCYRIFAKAVGAKFLEVLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERIL----KT
1uu1C           -DRSVFFPPTYSCYRIFAKAVGAKFLEVLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERIL----KT
1uu1B           -DRSVFFPPTYSCYRIFAKAVGAKFLEVLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERIL----KT
1uu1A           -DRSVFFPPTYSCYRIFAKAVGAKFLEVLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERIL----KT
1uu0D           -DRSVFFPPTYSCYRIFAKAVGAKFLEVLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERIL----KT
1uu0C           -DRSVFFPPTYSCYRIFAKAVGAKFLEVLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERIL----KT
1uu0B           -DRSVFFPPTYSCYRIFAKAVGAKFLEVLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERIL----KT
1uu0A           -DRSVFFPPTYSCYRIFAKAVGAKFLEVLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERIL----KT
2f8jB           -DRSVFFPPTYSCYRIFAKAVGAKFLEVLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERIL----KT
2f8jA           -DRSVFFPPTYSCYRIFAKAVGAKFLEVLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERIL----KT
1lkcA           PRRAMIVTPGFAEYGRALAQSGLREADGWQLTDAILEALDCLFLCTPNNPTGLLPERPLLQAIADRCKSL
1lc8A           PRRAMIVTPGFAEYGRALAQSGLREADGWQLTDAILEALDCLFLCTPNNPTGLLPERPLLQAIADRCKSL
1lc7A           PRRAMIVTPGFAEYGRALAQSGLREADGWQLTDAILEALDCLFLCTPNNPTGLLPERPLLQAIADRCKSL
1lc5A           PRRAMIVTPGFAEYGRALAQSGLREADGWQLTDAILEALDCLFLCTPNNPTGLLPERPLLQAIADRCKSL
1bkgA           -----------------------------------------LVVNSPNNPTGAVYPKEVLEALARLAVEH
1b5oA           -----------------------------------------LVVNSPNNPTGAVYPKEVLEALARLAVEH
2z1zA           ----------------------------------------IIFFCSPNNPTGAAATREQLTQLVEFAKKN
1gd9A           -----------------------------------------LIINSPCNPTGAVLTKKDLEEIADFVVEH
3eiaB           ----------------------------------------IIFFCSPNNPTGAAATREQLTQLVEFAKKN
3eiaA           ----------------------------------------IIFFCSPNNPTGAAATREQLTQLVEFAKKN
3ei9B           ----------------------------------------IIFFCSPNNPTGAAATREQLTQLVEFAKKN
3ei9A           ----------------------------------------IIFFCSPNNPTGAAATREQLTQLVEFAKKN
3ei8A           ----------------------------------------IIFFCSPNNPTGAAATREQLTQLVEFAKKN
3ei7B           ----------------------------------------IIFFCSPNNPTGAAATREQLTQLVEFAKKN
3ei7A           ----------------------------------------IIFFCSPNNPTGAAATREQLTQLVEFAKKN
3ei6B           ----------------------------------------IIFFCSPNNPTGAAATREQLTQLVEFAKKN
3ei6A           ----------------------------------------IIFFCSPNNPTGAAATREQLTQLVEFAKKN
1djuB           -----------------------------------------LIINSPCNPTGAVLTKKDLEEIADFVVEH
1djuA           -----------------------------------------LIINSPCNPTGAVLTKKDLEEIADFVVEH
1gc3A           -----------------------------------------LVVNSPNNPTGAVYPKEVLEALARLAVEH
5bj4A           -----------------------------------------LVVNSPNNPTGAVYPKEVLEALARLAVEH
5bj3A           -----------------------------------------LVVNSPNNPTGAVYPKEVLEALARLAVEH
1bjwA           -----------------------------------------LVVNSPNNPTGAVYPKEVLEALARLAVEH
1b5pA           -----------------------------------------LVVNSPNNPTGAVYPKEVLEALARLAVEH
2douB           ----------------------------------------VLLLNYPNNPTGAVADWGYFEEALGLARKH
2douA           ----------------------------------------VLLLNYPNNPTGAVADWGYFEEALGLARKH
3ffhB           ---------------------------------------------NPNNPTGNYIELADIQAFLDRV-PS
3ffhA           ---------------------------------------------NPNNPTGNYIELADIQAFLDRV-PS
1pg8A           ----------------------LRHVDMADLQEAAMTPATVIYFESPANPN---MHMADIAGVAKIARKH
2z20B           ----------------------------------------IIFFCSPNNPTGAAATREQLTQLVEFAKKN
2z20A           ----------------------------------------IIFFCSPNNPTGAAATREQLTQLVEFAKKN
2gb3F           GDEILVLEPFYANYNAFAKIAGVKLIPVTRREEGFAIPQNLIVLSNPCNPTGVVYGKDE-RYLVEIAERH
2gb3E           GDEILVLEPFYANYNAFAKIAGVKLIPVTRREEGFAIPQNLIVLSNPCNPTGVVYGKDE-RYLVEIAERH
2gb3D           GDEILVLEPFYANYNAFAKIAGVKLIPVTRREEGFAIPQNLIVLSNPCNPTGVVYGKDE-RYLVEIAERH
2gb3C           GDEILVLEPFYANYNAFAKIAGVKLIPVTRREEGFAIPQNLIVLSNPCNPTGVVYGKDE-RYLVEIAERH
2gb3B           GDEILVLEPFYANYNAFAKIAGVKLIPVTRREEGFAIPQNLIVLSNPCNPTGVVYGKDE-RYLVEIAERH
2gb3A           GDEILVLEPFYANYNAFAKIAGVKLIPVTRREEGFAIPQNLIVLSNPCNPTGVVYGKDE-RYLVEIAERH
3ezsB           --------------------------------EKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKH
3ezsA           --------------------------------EKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKH
1w7nA           DEGDEVIIIEYEPMTMMPGELGSSSNWQLDPMELAGKFTSALVLNTPNNPLGKVFSREELELVASLCQQH
1w7lA           DEGDEVIIIEYEPMTMMPGELGSSSNWQLDPMELAGKFTSALVLNTPNNPLGKVFSREELELVASLCQQH
1d2fB           ----------------------------------------IMLLCSPQNPTGKVWTCDELEIMADLCERH
1d2fA           ----------------------------------------IMLLCSPQNPTGKVWTCDELEIMADLCERH
3fvsA           DEGDEVIIIEYEPMTMMPGPIQNGELGSSSNWQLPMELAGALVLNTPNNPLGKVFSREELELVASLCQQH
1j32A           PDEVIIPAPSYPEMVKLPTTVETQFVSPEQIRQAITPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEA
1ijiA           KDAILYCPPTYGMYSVSAETIGVRTVPTLDNWQLDLKLDGVKVVCSPNNPTGQLINPQDFRTLLELTRGK
1geyA           KDAILYCPPTYGMYSVSAETIGVRTVPTLDNWQLDLKLDGVKVVCSPNNPTGQLINPQDFRTLLELTRGK
1gexA           KDAILYCPPTYGMYSVSAETIGVRTVPTLDNWQLDLKLDGVKVVCSPNNPTGQLINPQDFRTLLELTRGK
1gewA           KDAILYCPPTYGMYSVSAETIGVRTVPTLDNWQLDLKLDGVKVVCSPNNPTGQLINPQDFRTLLELTRGK
1fg7A           PEQVLVSEPGKDAILYCPPTYGYRTVPTLDNWQLDLKLDGVKVVCSPNNPTGQLINPQDFRTLLELTRGK
1yizA           ----------------------------------------MIIINTPHNPLGKVMDRAELEVVANLCKKW
1yiyA           ----------------------------------------MIIINTPHNPLGKVMDRAELEVVANLCKKW
2r5cB           ----------------------------------------MIIINTPHNPLGKVMDRAELEVVANLCKKW
2r5cA           ----------------------------------------MIIINTPHNPLGKVMDRAELEVVANLCKKW
1o4sB           DPFSPVWVSYIPQIILAGGTVNVVETFMSKNFQPSLEEEGLLVINSPNNPTGVVYRREFLEGLVRLAKKR
1o4sA           DPFSPVWVSYIPQIILAGGTVNVVETFMSKNFQPSLEEEGLLVINSPNNPTGVVYRREFLEGLVRLAKKR
3dzzB           ----------------------------WADLEEKLATPSVRVFCNPHNPIGYAWSEEEVKRIAELCAKH
3dzzA           ----------------------------WADLEEKLATPSVRVFCNPHNPIGYAWSEEEVKRIAELCAKH


                         +         .         .         .         .         *         .:210
query           GAYLIIDIIFSDFVTDDLRGFPLENVAYSHSTDKFYTHDLRAGWVFGDEEIVRRVKYLKDLANPGPXXXX
3dydB           CVPILADEIYGDMVFSDCKYEPLATL----STDRWLVPGWRLGWIFGNEIRDGLVKLSQRILGPCTIVQG
3dydA           CVPILADEIYGDMVFSDCKYEPLATL----STDRWLVPGWRLGWIFGNEIRDGLVKLSQRILGPCTIVQG
1h1cD           GAFVALDEAYYEFHGESYVDFKYENLAVIRTFSKFSLAAQRVGYVVASEKFI------------------
1h1cC           GAFVALDEAYYEFHGESYVDFKYENLAVIRTFSKFSLAAQRVGYVVASEKFI------------------
1h1cB           GAFVALDEAYYEFHGESYVDFKYENLAVIRTFSKFSLAAQRVGYVVASEKFI------------------
1h1cA           GAFVALDEAYYEFHGESYVDFKYENLAVIRTFSKFSLAAQRVGYVVASEKFI------------------
1uu2B           GAFVALDEAYYEFHGESYVDFKYENLAVIRTFSKFSLAAQRVGYVVASEKFI------------------
1uu2A           GAFVALDEAYYEFHGESYVDFKYENLAVIRTFSKFSLAAQRVGYVVASEKFI------------------
1uu1C           GAFVALDEAYYEFHGESYVDFKYENLAVIRTFSKFSLAAQRVGYVVASEKFI------------------
1uu1B           GAFVALDEAYYEFHGESYVDFKYENLAVIRTFSKFSLAAQRVGYVVASEKFI------------------
1uu1A           GAFVALDEAYYEFHGESYVDFKYENLAVIRTFSKFSLAAQRVGYVVASEKFI------------------
1uu0D           GAFVALDEAYYEFHGESYVDFKYENLAVIRTFSKFSLAAQRVGYVVASEKFI------------------
1uu0C           GAFVALDEAYYEFHGESYVDFKYENLAVIRTFSKFSLAAQRVGYVVASEKFI------------------
1uu0B           GAFVALDEAYYEFHGESYVDFKYENLAVIRTFSKFSLAAQRVGYVVASEKFI------------------
1uu0A           GAFVALDEAYYEFHGESYVDFKYENLAVIRTFSKFSLAAQRVGYVVASEKFI------------------
2f8jB           GAFVALDEAYYEFHGESYVDFKYENLAVIRTFSKFSLAAQRVGYVVASEKFI------------------
2f8jA           GAFVALDEAYYEFHGESYVDFKYENLAVIRTFSKFSLAAQRVGYVVASEKFI------------------
1lkcA           NINLILDEAFIDFIPHETGFIPAPHIWVLRSLTKFYAPGLRLGYLVNSDD--------------------
1lc8A           NINLILDEAFIDFIPHETGFIPAPHIWVLRSLTKFYAPGLRLGYLVNSDD--------------------
1lc7A           NINLILDEAFIDFIPHETGFIPAPHIWVLRSLTKFYAPGLRLGYLVNSDD--------------------
1lc5A           NINLILDEAFIDFIPHETGFIPAPHIWVLRSLTKFYAPGLRLGYLVNSDD--------------------
1bkgA           DFYLVSDEIYEHLLYEGERVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIA
1b5oA           DFYLVSDEIYEHLLYEGERVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIA
2z1zA           GSIIVYDSAYAMYMSDD-----------------------------------------------------
1gd9A           DLIVISDEVYEHFIYDDARHYSIASL--------------------------------------------
3eiaB           GSIIVYDSAYAMYMSDD-----------------------------------------------------
3eiaA           GSIIVYDSAYAMYMSDD-----------------------------------------------------
3ei9B           GSIIVYDSAYAMYMSDD-----------------------------------------------------
3ei9A           GSIIVYDSAYAMYMSDD-----------------------------------------------------
3ei8A           GSIIVYDSAYAMYMSDD-----------------------------------------------------
3ei7B           GSIIVYDSAYAMYMSDD-----------------------------------------------------
3ei7A           GSIIVYDSAYAMYMSDD-----------------------------------------------------
3ei6B           GSIIVYDSAYAMYMSDD-----------------------------------------------------
3ei6A           GSIIVYDSAYAMYMSDD-----------------------------------------------------
1djuB           DLIVISDEVYEHFIYDDARHYSIASL--------------------------------------------
1djuA           DLIVISDEVYEHFIYDDARHYSIASL--------------------------------------------
1gc3A           DFYLVSDEIYEHLLYEGERVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSRQSTTSPDTIA
5bj4A           DFYLVSDEIYEHLLYEGERVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSRQSTTSPDTIA
5bj3A           DFYLVSDEIYEHLLYEGERVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSRQSTTSPDTIA
1bjwA           DFYLVSDEIYEHLLYEG-EHFSPGRVAPEHTAAAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIA
1b5pA           DFYLVSDEIYEHLLYEGERVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSRQSTTSPDTIA
2douB           GLWLIHDNPYVDQVYEGEAPSPLERVVELFSLSKSYNAGFRLGFALGSEEALARLERVKGVIDFNQYAGV
2douA           GLWLIHDNPYVDQVYEGEAPSPLERVVELFSLSKSYNAGFRLGFALGSEEALARLERVKGVIDFNQYAGV
3ffhB           DVLVVLDEAYIEYVTPQPEKHTYKNLIITRTFSKIYLASARVGYGIADKEIIRQLNIVRPPFNTTSIGQK
3ffhA           DVLVVLDEAYIEYVTPQPEKHTYKNLIITRTFSKIYLASARVGYGIADKEIIRQLNIVRPPFNTTSIGQK
1pg8A           GATVVVD---NTYCTPYLQR-PLELGAVVHSATKYLSGDITAGIVVGSQALVDRIRLLKDM---------
2z20B           GSIIVYDSAYA-YSDDNPRSIGAEEVAETASFSKYFT-GVRLGW--------------------------
2z20A           GSIIVYDSAYA-YSDDNPRSIGAEEVAETASFSKYFT-GVRLGW--------------------------
2gb3F           GLFLIVDEVYSEIV--------------------------------------------------------
2gb3E           GLFLIVDEVYSEIV--------------------------------------------------------
2gb3D           GLFLIVDEVYSEIV--------------------------------------------------------
2gb3C           GLFLIVDEVYSEIV--------------------------------------------------------
2gb3B           GLFLIVDEVYSEIV--------------------------------------------------------
2gb3A           GLFLIVDEVYSEIV--------------------------------------------------------
3ezsB           DFILINDECYSEIYENTPPPSLLENVLVIHSLSKSSAPGLRSGFIAGDSRLLEKYK--------------
3ezsA           DFILINDECYSEIYENTPPPSLLENVLVIHSLSKSSAPGLRSGFIAGDSRLLEKYK--------------
1w7nA           DVVCITDEVYQWMVYDSLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLR--------------
1w7lA           DVVCITDEVYQWMVYDGHQHISIERTLTIGSAGTFSATGWKVGWVLGPDHIMKHLR--------------
1d2fB           GVRVISDEIHMDMVWGEQPHIPWSNVA-------------------------------------------
1d2fA           GVRVISDEIHMDMVWGEQPHIPWSNVA-------------------------------------------
3fvsA           DVVCITDEVYQWMVYDGHQHISIERTLTIGSAGTFSATGWKVGWVLGPDHIMKHLR--------------
1j32A           GLWVLSDEIYEKILYDD-----------------------------------------------------
1ijiA           -AIVVADEAYIEFCPQSLAGWLAEHLAILRTLSKFALAGLRCGFTLANEEVI------------------
1geyA           -AIVVADEAYIEFCPQSLAGWLAEHLAILRTLSKFALAGLRCGFTLANEEVI------------------
1gexA           -AIVVADEAYIEFCPQSLAGWLAEHLAILRTLSKFALAGLRCGFTLANEEVI------------------
1gewA           -AIVVADEAYIEFCPQSLAGWLAEHLAILRTLSKFALAGLRCGFTLANEEVI------------------
1fg7A           -AIVVADEAYIEFCPQSLAGWLAEHLAILRTLSKFALAGLRCGFTLANEEVINLLKVI------------
1yizA           NVLCVSDEVYEHMVFEPFEHIRIERTITIGSAGTFSLTGWKIGWAYGPEALLKNLQ--------------
1yiyA           NVLCVSDEVYEHMVFETLPGMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQ--------------
2r5cB           NVLCVSDEVYEHMVFETLPGMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQ--------------
2r5cA           NVLCVSDEVYEHMVFEPFEHIRIERTITIGSAGTFSLTGWKIGWAYGPEALLKNLQ--------------
1o4sB           NFYIISDEVYDSLVTDEFTSIGFDRIVYINGFSKSHSTGWRVGYLISSEKVATAVSKIQ-----------
1o4sA           NFYIISDEVYDSLVTDEFTSIGFDRIVYINGFSKSHSTGWRVGYLISSEKVATAVSKIQ-----------
3dzzB           QVLLISDEIHGDLVLTD-----------------------------------------------------
3dzzA           QVLLISDEIHGDLVLTD-----------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXXVKRRNLSIIKPNATALLTRFPNALYKPHMPIALIPTGCNDAKLAERLLAMGVKTVPG
3dydB           ALKSILCRTPGEFY-HNTLSFLKSNADGALAAIPGAMYMVGIEMEHFPEFENDVEFTERLVAQSVHCLPA
3dydA           ALKSILCRTPGEFY-HNTLSFLKSNADGALAAIPGAMYMVGIEMEHFPEFENDVEFTERLVAQSVHCLPA
1h1cD           ----------------------------------------------------------------------
1h1cC           ----------------------------------------------------------------------
1h1cB           ----------------------------------------------------------------------
1h1cA           ----------------------------------------------------------------------
1uu2B           ----------------------------------------------------------------------
1uu2A           ----------------------------------------------------------------------
1uu1C           ----------------------------------------------------------------------
1uu1B           ----------------------------------------------------------------------
1uu1A           ----------------------------------------------------------------------
1uu0D           ----------------------------------------------------------------------
1uu0C           ----------------------------------------------------------------------
1uu0B           ----------------------------------------------------------------------
1uu0A           ----------------------------------------------------------------------
2f8jB           ----------------------------------------------------------------------
2f8jA           ----------------------------------------------------------------------
1lkcA           ----------------------------------------------------------------------
1lc8A           ----------------------------------------------------------------------
1lc7A           ----------------------------------------------------------------------
1lc5A           ----------------------------------------------------------------------
1bkgA           QWATLEALTNQEASRRRDXXXXXXXXXXXKAVRPSGAFYVLMDTS--PIAPDEVRAAERLLEAGVAVVPG
1b5oA           QWATLEALTNQEASRRRDXXXXXXXXXXXKAVRPSGAFYVLMDTS--PIAPDEVRAAERLLEAGVAVVPG
2z1zA           ----------------------------------------------------------------------
1gd9A           ----------------------------------------------------------------------
3eiaB           ----------------------------------------------------------------------
3eiaA           ----------------------------------------------------------------------
3ei9B           ----------------------------------------------------------------------
3ei9A           ----------------------------------------------------------------------
3ei8A           ----------------------------------------------------------------------
3ei7B           ----------------------------------------------------------------------
3ei7A           ----------------------------------------------------------------------
3ei6B           ----------------------------------------------------------------------
3ei6A           ----------------------------------------------------------------------
1djuB           ----------------------------------------------------------------------
1djuA           ----------------------------------------------------------------------
1gc3A           QWATLEALTNQEASRRRDXXXXXXXXXXXKAVRPSGAFYVLMDTS--PIAPDEVRAAERLLEAGVAVVPG
5bj4A           QWATLEALTNQEASRRRDXXXXXXXXXXXKAVRPSGAFYVLMDTS--PIAPDEVRAAERLLEAGVAVVPG
5bj3A           QWATLEALTNQEASRRRDXXXXXXXXXXXKAVRPSGAFYVLMDTS--PIAPDEVRAAERLLEAGVAVVPG
1bjwA           QWATLEALTNQEASRRRDXXXXXXXXXXXKAVRPSGAFYVLMDTS--PIAPDEVRAAERLLEAGVAVVPG
1b5pA           QWATLEALTNQEASRRRDXXXXXXXXXXXKAVRPSGAFYVLMDTS--PIAPDEVRAAERLLEAGVAVVPG
2douB           LRMGVEALKTPKEVVRGYARVYRERALGMAEALKGSLLPPRATMYLLPEGVDDLEFGLRLVERGV-----
2douA           LRMGVEALKTPKEVVRGYARVYRERALGMAEALKGSLLPPRATMYLLPEGVDDLEFGLRLVERGV-----
3ffhB           LAIEAIKDQAFIGECRTSNANGIKQYEAFAKRFEKVLYPANGNFVLIDLGIEAGTIFSYLEKNGYITRSG
3ffhA           LAIEAIKDQAFIGECRTSNANGIKQYEAFAKRFEKVLYPANGNFVLIDLGIEAGTIFSYLEKNGYITRSG
1pg8A           ----------------------------------------------------------------------
2z20B           ----------------------------------------------------------------------
2z20A           ----------------------------------------------------------------------
2gb3F           ----------------------------------------------------------------------
2gb3E           ----------------------------------------------------------------------
2gb3D           ----------------------------------------------------------------------
2gb3C           ----------------------------------------------------------------------
2gb3B           ----------------------------------------------------------------------
2gb3A           ----------------------------------------------------------------------
3ezsB           ----------------------------------------------------------------------
3ezsA           ----------------------------------------------------------------------
1w7nA           ----------------------------------------------------------------------
1w7lA           ----------------------------------------------------------------------
1d2fB           ----------------------------------------------------------------------
1d2fA           ----------------------------------------------------------------------
3fvsA           ----------------------------------------------------------------------
1j32A           ----------------------------------------------------------------------
1ijiA           ----------------------------------------------------------------------
1geyA           ----------------------------------------------------------------------
1gexA           ----------------------------------------------------------------------
1gewA           ----------------------------------------------------------------------
1fg7A           ----------------------------------------------------------------------
1yizA           ----------------------------------------------------------------------
1yiyA           ----------------------------------------------------------------------
2r5cB           ----------------------------------------------------------------------
2r5cA           ----------------------------------------------------------------------
1o4sB           ----------------------------------------------------------------------
1o4sA           ----------------------------------------------------------------------
3dzzB           ----------------------------------------------------------------------
3dzzA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RLFQAPYSIRVGLGVEEPPRFREALEILAQxxxxx
3dydB           TCFEYPNFIRVVITVPE------------------
3dydA           TCFEYPNFIRVVITVPE------------------
1h1cD           -----------------------------------
1h1cC           -----------------------------------
1h1cB           -----------------------------------
1h1cA           -----------------------------------
1uu2B           -----------------------------------
1uu2A           -----------------------------------
1uu1C           -----------------------------------
1uu1B           -----------------------------------
1uu1A           -----------------------------------
1uu0D           -----------------------------------
1uu0C           -----------------------------------
1uu0B           -----------------------------------
1uu0A           -----------------------------------
2f8jB           -----------------------------------
2f8jA           -----------------------------------
1lkcA           -----------------------------------
1lc8A           -----------------------------------
1lc7A           -----------------------------------
1lc5A           -----------------------------------
1bkgA           TDFAAFGHVRLSYATSE-ENLRKALERFAR-----
1b5oA           TDFAAFGHVRLSYATSE-ENLRKALERFAR-----
2z1zA           -----------------------------------
1gd9A           -----------------------------------
3eiaB           -----------------------------------
3eiaA           -----------------------------------
3ei9B           -----------------------------------
3ei9A           -----------------------------------
3ei8A           -----------------------------------
3ei7B           -----------------------------------
3ei7A           -----------------------------------
3ei6B           -----------------------------------
3ei6A           -----------------------------------
1djuB           -----------------------------------
1djuA           -----------------------------------
1gc3A           TDFAAFGHVRLSYATSE-ENLRKALERFAR-----
5bj4A           TDFAAFGHVRLSYATSE-ENLRKALERFAR-----
5bj3A           TDFAAFGHVRLSYATSE-ENLRKALERFAR-----
1bjwA           TDFAAFGHVRLSYATSE-ENLRKALERFAR-----
1b5pA           TDFAAFGHVRLSYATSE-ENLRKALERFAR-----
2douB           -----------------------------------
2douA           -----------------------------------
3ffhB           AALGFPTAVRITIGKEE------------------
3ffhA           AALGFPTAVRITIGKEE------------------
1pg8A           -----------------------------------
2z20B           -----------------------------------
2z20A           -----------------------------------
2gb3F           -----------------------------------
2gb3E           -----------------------------------
2gb3D           -----------------------------------
2gb3C           -----------------------------------
2gb3B           -----------------------------------
2gb3A           -----------------------------------
3ezsB           -----------------------------------
3ezsA           -----------------------------------
1w7nA           -----------------------------------
1w7lA           -----------------------------------
1d2fB           -----------------------------------
1d2fA           -----------------------------------
3fvsA           -----------------------------------
1j32A           -----------------------------------
1ijiA           -----------------------------------
1geyA           -----------------------------------
1gexA           -----------------------------------
1gewA           -----------------------------------
1fg7A           -----------------------------------
1yizA           -----------------------------------
1yiyA           -----------------------------------
2r5cB           -----------------------------------
2r5cA           -----------------------------------
1o4sB           -----------------------------------
1o4sA           -----------------------------------
3dzzB           -----------------------------------
3dzzA           -----------------------------------