[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for paer1:AAL65085.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cb8A.bssp"
#ERROR : Can't open dsspfile "3c8fA.bssp"
#ERROR : Can't open dsspfile "1r30B.bssp"
#ERROR : Can't open dsspfile "1r30A.bssp"
#ERROR : Can't open dsspfile "1tv7B.bssp"
#ERROR : Can't open dsspfile "1tv7A.bssp"
#ERROR : Can't open dsspfile "2fb2B.bssp"
#ERROR : Can't open dsspfile "2fb2A.bssp"

## Summary of PDB Search
:364
    4e-08  24%  3cb8A  [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME
    4e-08  24%  3c8fA  [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME
    1e-05  28%  1r30B  [c.1.28] BIOTIN SYNTHASE
    1e-05  28%  1r30A  [c.1.28] BIOTIN SYNTHASE
    1e-04  21%  1tv7B  [c.1.28] MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN A
    1e-04  21%  1tv7A  [c.1.28] MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN A
    1e-04  21%  2fb2B  [x.x.x] MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN A
    1e-04  21%  2fb2A  [x.x.x] MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN A
:364

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cb8A           ----------------------------------------------------------------------
3c8fA           ----------------------------------------------------------------------
1r30B           ----------------------------------------------------------------------
1r30A           ----------------------------------------------------------------------
1tv7B           ----------------------------------------------------------------------
1tv7A           ----------------------------------------------------------------------
2fb2B           ----------------------------------------------------------------------
2fb2A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxHFYPGTSAVTISTWGCNFPCAWCQNWHLSKTASPAGAYVPPERVVEWALE
3cb8A           -----------------------PGIRFITFFQ-GCLMRCLYCHNRDTWDTHGGKEVTVEDKEVVTYRMN
3c8fA           -----------------------PGIRFITFFQ-GCLMRCLYCHNRDTWDTHGGKEVTVEDKEVVTYRMN
1r30B           --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
1r30A           --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
1tv7B           -----------------------------------CNFRCDYCMP---KEVFGDDFVFLPKNRIAKVYAE
1tv7A           -----------------------------------CNFRCDYCMP---KEVFGDDFVFLPKNRIAKVYAE
2fb2B           -----------------------------------CNFRCDYCMP---KEVFGDDFVFLPKNRIAKVYAE
2fb2A           -----------------------------------CNFRCDYCMP---KEVFGDDFVFLPKNRIAKVYAE


                         +         .         .         .         .         *         .:210
query           NGDSGVNVSFNEPTLLAEYAEEVFRLARARGLHASINTNGYLTEEAVRRLAEAGMEGMNIDIKGGRETYR
3cb8A           ASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRDPVIDELLEV-TDLVMLDLKQNDEIHQ
3c8fA           ASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRDPVIDELLEV-TDLVMLDLKQNDEIHQ
1r30B           AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
1r30A           AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
1tv7B           LGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLF
1tv7A           LGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLF
2fb2B           LGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLF
2fb2A           LGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLF


                         .         .         .         +         .         .         .:280
query           RWLAANFDKFLSTARHAKGMGIHVEFTYLVIPGVNDHEAEEVIEAVASFGRETPLHITAYYPAHKxxxxx
3cb8A           NLVGVSNHRTLEFAKYLANKNVKVWIRYVVVPGWSDDDAHRLGEFTRDMGNVEKIELLPYHELGK-----
3c8fA           NLVGVSNHRTLEFAKYLANKNVKVWIRYVVVPGWSDDDAHRLGEFTRDMGNVEKIELLPYHELGK-----
1r30B           NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
1r30A           NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
1tv7B           QSINNRNIKILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLE--------------------------
1tv7A           QSINNRNIKILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLE--------------------------
2fb2B           QSINNRNIKILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLE--------------------------
2fb2A           QSINNRNIKILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLE--------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cb8A           ----------------------------------------------------------------------
3c8fA           ----------------------------------------------------------------------
1r30B           ----------------------------------------------------------------------
1r30A           ----------------------------------------------------------------------
1tv7B           ----------------------------------------------------------------------
1tv7A           ----------------------------------------------------------------------
2fb2B           ----------------------------------------------------------------------
2fb2A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxx
3cb8A           --------------
3c8fA           --------------
1r30B           --------------
1r30A           --------------
1tv7B           --------------
1tv7A           --------------
2fb2B           --------------
2fb2A           --------------