[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL62792.1

[Show Plain Result]


## Summary of Sequence Search
    1::394
    6::196     2e-22  38%  218 aa  Y553_MYCBO RecName: Full=Uncharacterized glycosyltransferase
    6::196     2e-22  38%  218 aa  Y539_MYCTU RecName: Full=Uncharacterized glycosyltransferase
   19::213     2e-16  32%  243 aa  Y1222_METJA RecName: Full=Uncharacterized protein MJ1222;
    9::222     7e-16  33%  241 aa  DPM1_DROME RecName: Full=Probable dolichol-phosphate
    5::218     1e-14  31%  236 aa  DPM1_SCHPO RecName: Full=Dolichol-phosphate mannosyltransferase;   
   28::241     3e-12  30%  260 aa  DPM1_BOVIN RecName: Full=Dolichol-phosphate mannosyltransferase;   
   28::241     9e-12  32%  260 aa  DPM1_MOUSE RecName: Full=Dolichol-phosphate mannosyltransferase;   
   28::241     2e-11  31%  260 aa  DPM1_HUMAN RecName: Full=Dolichol-phosphate mannosyltransferase;   
   27::240     2e-11  30%  259 aa  DPM1_PIG RecName: Full=Dolichol-phosphate mannosyltransferase;     
   24::249     4e-11  29%  254 aa  DPM1_DICDI RecName: Full=Dolichol-phosphate mannosyltransferase;   
   10::248     6e-11  29%  327 aa  ARNC_YERE8 RecName: Full=Undecaprenyl-phosphate
   10::238     2e-10  29%  325 aa  ARNC_EDWI9 RecName: Full=Undecaprenyl-phosphate
   10::248     4e-10  27%  327 aa  ARNC_YERPY RecName: Full=Undecaprenyl-phosphate
   10::248     4e-10  27%  327 aa  ARNC_YERPS RecName: Full=Undecaprenyl-phosphate
   10::248     4e-10  27%  327 aa  ARNC_YERPP RecName: Full=Undecaprenyl-phosphate
   10::248     4e-10  27%  327 aa  ARNC_YERPB RecName: Full=Undecaprenyl-phosphate
    8::240     5e-10  28%  327 aa  ARNC_PECCP RecName: Full=Undecaprenyl-phosphate
   10::242     6e-10  28%  326 aa  ARNC_ESCF3 RecName: Full=Undecaprenyl-phosphate
   10::205     6e-10  28%  322 aa  ARNC_ECOUT RecName: Full=Undecaprenyl-phosphate
   10::205     6e-10  28%  322 aa  ARNC_ECOL6 RecName: Full=Undecaprenyl-phosphate
   10::205     6e-10  28%  322 aa  ARNC_ECOL5 RecName: Full=Undecaprenyl-phosphate
   10::205     6e-10  28%  322 aa  ARNC_ECOK1 RecName: Full=Undecaprenyl-phosphate
   10::205     6e-10  28%  322 aa  ARNC_ECO81 RecName: Full=Undecaprenyl-phosphate
   10::205     6e-10  28%  322 aa  ARNC_ECO45 RecName: Full=Undecaprenyl-phosphate
   10::205     6e-10  28%  322 aa  ARNC_ECO27 RecName: Full=Undecaprenyl-phosphate
   10::248     8e-10  27%  327 aa  ARNC_YERPN RecName: Full=Undecaprenyl-phosphate
   10::248     8e-10  27%  327 aa  ARNC_YERPG RecName: Full=Undecaprenyl-phosphate
   10::248     8e-10  27%  327 aa  ARNC_YERPE RecName: Full=Undecaprenyl-phosphate
   10::248     8e-10  27%  327 aa  ARNC_YERPA RecName: Full=Undecaprenyl-phosphate
    8::240     8e-10  28%  327 aa  ARNC_ERWCT RecName: Full=Undecaprenyl-phosphate
   10::205     2e-09  28%  322 aa  ARNC_ECOSM RecName: Full=Undecaprenyl-phosphate
    9::247     2e-09  27%  337 aa  ARNC_PSEU2 RecName: Full=Undecaprenyl-phosphate
   10::205     3e-09  29%  326 aa  ARNC_SERP5 RecName: Full=Undecaprenyl-phosphate
    9::247     3e-09  28%  337 aa  ARNC_PSE14 RecName: Full=Undecaprenyl-phosphate
    9::204     3e-09  29%  325 aa  ARNC_ERWT9 RecName: Full=Undecaprenyl-phosphate
   10::205     3e-09  28%  327 aa  ARNC_ENT38 RecName: Full=Undecaprenyl-phosphate
    8::242     4e-09  27%  340 aa  ARNC_PSEPF RecName: Full=Undecaprenyl-phosphate
   10::205     4e-09  27%  322 aa  ARNC_ECO7I RecName: Full=Undecaprenyl-phosphate
    9::242     7e-09  26%  326 aa  ARNC_AERHH RecName: Full=Undecaprenyl-phosphate
   10::205     9e-09  27%  322 aa  ARNC_SHISS RecName: Full=Undecaprenyl-phosphate
   10::205     9e-09  27%  322 aa  ARNC_SHIFL RecName: Full=Undecaprenyl-phosphate
   10::205     9e-09  27%  322 aa  ARNC_SHIDS RecName: Full=Undecaprenyl-phosphate
   10::205     9e-09  27%  322 aa  ARNC_SHIBS RecName: Full=Undecaprenyl-phosphate
   10::205     9e-09  27%  322 aa  ARNC_ECOSE RecName: Full=Undecaprenyl-phosphate
   10::205     9e-09  27%  322 aa  ARNC_ECOLU RecName: Full=Undecaprenyl-phosphate
   10::205     9e-09  27%  322 aa  ARNC_ECOLI RecName: Full=Undecaprenyl-phosphate
   10::205     9e-09  27%  322 aa  ARNC_ECOLC RecName: Full=Undecaprenyl-phosphate
   10::205     9e-09  27%  322 aa  ARNC_ECOHS RecName: Full=Undecaprenyl-phosphate
   10::205     9e-09  27%  322 aa  ARNC_ECODH RecName: Full=Undecaprenyl-phosphate
   10::205     9e-09  27%  322 aa  ARNC_ECOBW RecName: Full=Undecaprenyl-phosphate
   10::205     9e-09  27%  322 aa  ARNC_ECO8A RecName: Full=Undecaprenyl-phosphate
   10::205     9e-09  27%  322 aa  ARNC_ECO5E RecName: Full=Undecaprenyl-phosphate
   10::205     9e-09  27%  322 aa  ARNC_ECO57 RecName: Full=Undecaprenyl-phosphate
   10::205     9e-09  27%  322 aa  ARNC_ECO55 RecName: Full=Undecaprenyl-phosphate
   10::205     9e-09  27%  322 aa  ARNC_ECO24 RecName: Full=Undecaprenyl-phosphate
    9::242     9e-09  26%  325 aa  ARNC_AERS4 RecName: Full=Undecaprenyl-phosphate
    7::116     1e-08  33%  129 aa  RFBJ_SHIFL RecName: Full=Protein rfbJ;
   10::205     2e-08  28%  322 aa  ARNC_SHIF8 RecName: Full=Undecaprenyl-phosphate
    9::204     2e-08  26%  325 aa  ARNC_PHOLL RecName: Full=Undecaprenyl-phosphate
   10::205     3e-08  26%  326 aa  ARNC_PROMH RecName: Full=Undecaprenyl-phosphate
   10::205     3e-07  27%  331 aa  ARNC_SHESH RecName: Full=Undecaprenyl-phosphate
   38::219     4e-07  30%  267 aa  DPM1_YEAST RecName: Full=Dolichol-phosphate mannosyltransferase;   
   34::247     5e-07  29%  266 aa  DPM1_CRIGR RecName: Full=Dolichol-phosphate mannosyltransferase;   
    8::204     5e-07  27%  341 aa  ARNC_PSEFS RecName: Full=Undecaprenyl-phosphate
   31::227     6e-07  32%  398 aa  YAIP_ECOLI RecName: Full=Uncharacterized protein yaiP;
   10::205     6e-07  25%  327 aa  ARNC_SALPK RecName: Full=Undecaprenyl-phosphate
   10::205     6e-07  25%  327 aa  ARNC_SALPA RecName: Full=Undecaprenyl-phosphate
   10::205     6e-07  25%  327 aa  ARNC_SALG2 RecName: Full=Undecaprenyl-phosphate
   10::205     6e-07  25%  327 aa  ARNC_SALEP RecName: Full=Undecaprenyl-phosphate
   10::205     6e-07  25%  327 aa  ARNC_SALDC RecName: Full=Undecaprenyl-phosphate
    9::204     1e-06  28%  339 aa  ARNC_PSEA7 RecName: Full=Undecaprenyl-phosphate
    4::204     2e-06  31%  229 aa  Y544_METJA RecName: Full=Uncharacterized protein MJ0544;
   66::244     2e-06  28%  294 aa  DPM1_USTMA RecName: Full=Dolichol-phosphate mannosyltransferase;   
   10::205     2e-06  25%  327 aa  ARNC_SALTY RecName: Full=Undecaprenyl-phosphate
   10::205     2e-06  25%  327 aa  ARNC_SALTI RecName: Full=Undecaprenyl-phosphate
   10::205     2e-06  25%  327 aa  ARNC_SALSV RecName: Full=Undecaprenyl-phosphate
   10::205     2e-06  25%  327 aa  ARNC_SALPC RecName: Full=Undecaprenyl-phosphate
   10::205     2e-06  25%  327 aa  ARNC_SALPB RecName: Full=Undecaprenyl-phosphate
   10::205     2e-06  25%  327 aa  ARNC_SALNS RecName: Full=Undecaprenyl-phosphate
   10::205     2e-06  25%  327 aa  ARNC_SALHS RecName: Full=Undecaprenyl-phosphate
   10::205     2e-06  25%  327 aa  ARNC_SALCH RecName: Full=Undecaprenyl-phosphate
   10::205     2e-06  25%  327 aa  ARNC_SALA4 RecName: Full=Undecaprenyl-phosphate
    9::204     2e-06  29%  339 aa  ARNC_PSEAE RecName: Full=Undecaprenyl-phosphate
    9::204     2e-06  29%  339 aa  ARNC_PSEAB RecName: Full=Undecaprenyl-phosphate
    9::204     2e-06  29%  339 aa  ARNC_PSEA8 RecName: Full=Undecaprenyl-phosphate
    5::89      2e-06  36%  258 aa  WAAE_KLEPN RecName: Full=Lipopolysaccharide core biosynthesis
    9::204     2e-06  28%  339 aa  ARNC_PSEF5 RecName: Full=Undecaprenyl-phosphate
   10::245     3e-06  26%  326 aa  ARNC_SODGM RecName: Full=Undecaprenyl-phosphate
   75::313     3e-06  28%  334 aa  ALG5_YEAST RecName: Full=Dolichyl-phosphate
   13::113     4e-06  35%  330 aa  EXOA_RHIME RecName: Full=Succinoglycan biosynthesis protein exoA;  
    7::202     2e-05  21%  323 aa  ARNC_WIGBR RecName: Full=Undecaprenyl-phosphate
   76::297     2e-05  26%  327 aa  ALG5_DICDI RecName: Full=Dolichyl-phosphate
   67::294     3e-05  32%  324 aa  ALG5_HUMAN RecName: Full=Dolichyl-phosphate
    4::89      5e-05  34%  254 aa  Y653_HAEIN RecName: Full=Uncharacterized glycosyltransferase
   79::205     5e-05  27%  327 aa  ARNC_KLEP7 RecName: Full=Undecaprenyl-phosphate
   79::205     6e-05  27%  327 aa  ARNC_KLEP3 RecName: Full=Undecaprenyl-phosphate
   49::136     1e-04  32%  412 aa  ICAA_STAAR RecName: Full=Biofilm PIA synthesis
   49::136     1e-04  32%  412 aa  ICAA_STAAN RecName: Full=Biofilm PIA synthesis
   49::136     1e-04  32%  412 aa  ICAA_STAAM RecName: Full=Biofilm PIA synthesis
   49::136     1e-04  32%  412 aa  ICAA_STAAC RecName: Full=Biofilm PIA synthesis
   49::136     1e-04  32%  412 aa  ICAA_STAA8 RecName: Full=Biofilm PIA synthesis
    7::91      1e-04  41%  256 aa  GLTR1_MYCTU RecName: Full=PGL/p-HBAD biosynthesis
    7::91      1e-04  41%  256 aa  GLTR1_MYCTA RecName: Full=PGL/p-HBAD biosynthesis
    7::91      1e-04  41%  256 aa  GLTR1_MYCBP RecName: Full=PGL/p-HBAD biosynthesis
    7::91      1e-04  41%  256 aa  GLTR1_MYCBO RecName: Full=PGL/p-HBAD biosynthesis
    7::120     1e-04  28%  278 aa  EPSE_BACSU RecName: Full=Putative glycosyltransferase epsE;        
   49::136     2e-04  32%  412 aa  ICAA_STAAW RecName: Full=Biofilm PIA synthesis
   49::136     2e-04  32%  412 aa  ICAA_STAAS RecName: Full=Biofilm PIA synthesis
    1::119     2e-04  33%  299 aa  Y075_MYCPN RecName: Full=Uncharacterized glycosyltransferase MG060
    1::49      2e-04  33%  353 aa  TAGX_STAAW RecName: Full=Putative glycosyltransferase tagX;      
    1::49      2e-04  33%  353 aa  TAGX_STAAS RecName: Full=Putative glycosyltransferase tagX;      
    1::49      2e-04  33%  353 aa  TAGX_STAAR RecName: Full=Putative glycosyltransferase tagX;      
    1::49      2e-04  33%  353 aa  TAGX_STAAN RecName: Full=Putative glycosyltransferase tagX;      
    1::49      2e-04  33%  353 aa  TAGX_STAAM RecName: Full=Putative glycosyltransferase tagX;      
   64::307     2e-04  27%  322 aa  ALG5_SCHPO RecName: Full=Dolichyl-phosphate
    8::115     3e-04  27%  344 aa  YIBD_ECOLI RecName: Full=Uncharacterized glycosyltransferase yibD; 
    5::125     3e-04  30%  318 aa  Y501_SYNY3 RecName: Full=Uncharacterized glycosyltransferase
    1::49      4e-04  33%  353 aa  TAGX_STAAC RecName: Full=Putative glycosyltransferase tagX;      
    1::49      4e-04  33%  353 aa  TAGX_STAA8 RecName: Full=Putative glycosyltransferase tagX;      
   23::109     5e-04  35%  235 aa  PUR7_SULAC RecName:
   36::147     5e-04  27%  494 aa  GPPA_SALAR RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
    1::112     9e-04  28%  322 aa  Y2836_ANASP RecName: Full=Uncharacterized glycosyltransferase
   36::147     9e-04  29%  494 aa  GPPA_ERWT9 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
    1::394

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MCITVVLPTLNEAQALPKVVEELRATGYRDILVVDGGSTDGTVEEAKRLGLRVIGQYGRGKGMALRTALM
Y553_MYCBO      --VTVVLPCLNEEESLPAVLAAIPA-GYR-ALVVDNNSTDDTATVAARHGAQVVVEPRPGYGSAVHAGVL
Y539_MYCTU      --VTVVLPCLNEEESLPAVLAAIPA-GYR-ALVVDNNSTDDTATVAARHGAQVVVEPRPGYGSAVHAGVL
Y1222_METJA     --IFVVVPAFNEEKMIGETLKNLKKEGYKNIVVVDDGSMDKTSEIAKKEGVIVCRHLNRGLGGALGTALL
DPM1_DROME      ---SILMPTYNEKDNLPLIVKYMKASGLEEVIVIDDGSPDGTLDVAKDLGEDKIVLRPRGSKLGLGTAIK
DPM1_SCHPO      ---SVLLPTYNERKNLPIITYLIAKTFDQEIVIIDDASPDGTQEVAKELQ-KIYGESGKGLGTAYIHGLK
DPM1_BOVIN      ---SVLLPTYNERENLPFIVKSFSESGFNEIIIIDDGSPDGTRDVAEQLGSDRILLRPREKKLGLGTAMK
DPM1_MOUSE      ---SVLLPTYNERENLPLIVWLLSAINY-EIIIIDDGSPDGTREVAEQLGPDRILLRPREKKLGLGTAIK
DPM1_HUMAN      ---SVLLPTYNERENLPLIVKSFSESGINEIIIIDDGSPDGTRDVAEQLGSDRILLRPREKKLGLGTAMK
DPM1_PIG        ---SVLLPTYNERENLPLIVKSFSESGINEIIIIDDGSPDGTRDIAEQLGSDKILLRPREKKLGLGTAMK
DPM1_DICDI      ------LPTYKERENLPIIIWLISTELEKEVVIVEDNSPDGTLEVAQQLQIKILSRPGKGLGSAYMDGIK
ARNC_YERE8      --VSIVIPVYNEQESLPILIERTSATQPYEIILVDDGSSDNSAEEPESHIIAVLLNRNYGQHSAIMAGFN
ARNC_EDWI9      --VSVVIPVYNEQDSLSELLKRTIAAKQYEIVLVDDGSSDRSAEAAQRPGSRVVANRNYGQHSAIMAGFN
ARNC_YERPY      --VSIVIPVYNEQESLPALIDRTTATQAYEIILVDDGSSDNSTELLTAAAIAILLNRNYGQHSAIMAGFN
ARNC_YERPS      --VSIVIPVYNEQESLPALIDRTTATQAYEIILVDDGSSDNSTELLTAAAIAILLNRNYGQHSAIMAGFN
ARNC_YERPP      --VSIVIPVYNEQESLPALIDRTTATQAYEIILVDDGSSDNSTELLTAAAIAILLNRNYGQHSAIMAGFN
ARNC_YERPB      --VSIVIPVYNEQESLPALIDRTTATQAYEIILVDDGSSDNSTELLTAAAIAILLNRNYGQHSAIMAGFN
ARNC_PECCP      --VSVVIPVYNEEESLPVLIERTLAACRQEIILVDDGSSDRSAEDPEKHIIAVLLNRNYGQHSAIMAGFQ
ARNC_ESCF3      --VSVVIPVYNEQESLPELINRTTAACESEILLIDDGSSDASAQEASQAPVSILLNRNYGQHSAIMAGFS
ARNC_ECOUT      --VSVVIPVYNEQESLPELIRRTTAACESEILLIDDGSSDNSVEASQAEGSHIVSNRNYGQHSAIMAGFS
ARNC_ECOL6      --VSVVIPVYNEQESLPELIRRTTAACESEILLIDDGSSDNSVEASQAEGSHIVSNRNYGQHSAIMAGFS
ARNC_ECOL5      --VSVVIPVYNEQESLPELIRRTTAACESEILLIDDGSSDNSVEASQAEGSHIVSNRNYGQHSAIMAGFS
ARNC_ECOK1      --VSVVIPVYNEQESLPELIRRTTAACESEILLIDDGSSDNSVEASQAEGSHIVSNRNYGQHSAIMAGFS
ARNC_ECO81      --VSVVIPVYNEQESLPELIRRTTAACESEILLIDDGSSDNSVEASQAEGSHIVSNRNYGQHSAIMAGFS
ARNC_ECO45      --VSVVIPVYNEQESLPELIRRTTAACESEILLIDDGSSDNSVEASQAEGSHIVSNRNYGQHSAIMAGFS
ARNC_ECO27      --VSVVIPVYNEQESLPELIRRTTAACESEILLIDDGSSDNSVEASQAEGSHIVSNRNYGQHSAIMAGFS
ARNC_YERPN      --VSIVIPVYNEQESLPALIDRTTATQAYEIILVDDGSSDNSTELLTAAAIAILLNRNYGQHSAIMAGFN
ARNC_YERPG      --VSIVIPVYNEQESLPALIDRTTATQAYEIILVDDGSSDNSTELLTAAAIAILLNRNYGQHSAIMAGFN
ARNC_YERPE      --VSIVIPVYNEQESLPALIDRTTATQAYEIILVDDGSSDNSTELLTAAAIAILLNRNYGQHSAIMAGFN
ARNC_YERPA      --VSIVIPVYNEQESLPALIDRTTATQAYEIILVDDGSSDNSTELLTAAAIAILLNRNYGQHSAIMAGFN
ARNC_ERWCT      --VSVVIPVYNEEESLPVLIERTLAACRKEIILVDDGSNDRSAEDPEKHIIAVLLNRNYGQHSAIMAGFQ
ARNC_ECOSM      --VSVVIPVYNEQESLPELIRRTESLGKEEILLIDDGSSDNSVEASQAEGSHIVSNRNYGQHSAIMAGFS
ARNC_PSEU2      --VSIVIPVYNERQSLPELLRRTEAACEQEIVLVDDGSRDDSTDILQRAAERVILNRNYGQHAAIMAGFE
ARNC_SERP5      --VSVVIPVYNEQESLPALLERTTATQPYEIILVDDGSSDNSADAAEQPGSCVIANRNYGQHSAIMAGFN
ARNC_PSE14      --VSIVIPVYNERQSLPELLRRTEAANHREIVLVDDGSRDDSAEILQQAAERVILNRNYGQHAAIMAGFE
ARNC_ERWT9      --VSVVIPVYNEQQSLPELMRRTDAACAQEILLVDDGSSDDSAEAPDSHIVAVLLNRNYGQHSAIMAGFS
ARNC_ENT38      --VSVVIPVYNEQESLPELIRELLGKDY-EILLVDDGSSDESADAAEEPGSHIVANRNYGQHNAIMAGFS
ARNC_PSEPF      -CVSIVIPVYNEEDSLPELLRRTEAACKQEIVLVDDGSRDASLEEAASVFVAVILNRNYGQHAAIMAGFE
ARNC_ECO7I      --VSVVIPVYNEQESLPELIRRTESLGKEEILLIDDGSSDNSVDASQAEGSHIVSNRNYGQHSAIMAGFS
ARNC_AERHH      --VSVVIPVYNEEASLPALLSRVTAACDQEVILIDDGSHDGSVEGSKLVGVLLNRNYGQHA--AIMAGFE
ARNC_SHISS      --VSVVIPVYNEQESLPELIRRTTTACESEILLIDDGSSDNSVEASQAENSHIVSNRNYGQHSAIMAGFS
ARNC_SHIFL      --VSVVIPVYNEQESLPELIRRTTTACESEILLIDDGSSDNSVEASQAENSHIVSNRNYGQHSAIMAGFS
ARNC_SHIDS      --VSVVIPVYNEQESLPELIRRTTTACESEILLIDDGSSDNSVEASQAENSHIVSNRNYGQHSAIMAGFS
ARNC_SHIBS      --VSVVIPVYNEQESLPELIRRTTTACESEILLIDDGSSDNSVEASQAENSHIVSNRNYGQHSAIMAGFS
ARNC_ECOSE      --VSVVIPVYNEQESLPELIRRTTTACESEILLIDDGSSDNSVEASQAENSHIVSNRNYGQHSAIMAGFS
ARNC_ECOLU      --VSVVIPVYNEQESLPELIRRTESLGKEEILLIDDGSSDNSVEASQAENSHIVSNRNYGQHSAIMAGFS
ARNC_ECOLI      --VSVVIPVYNEQESLPELIRRTTTACESEILLIDDGSSDNSVEASQAENSHIVSNRNYGQHSAIMAGFS
ARNC_ECOLC      --VSVVIPVYNEQESLPELIRRTTTACESEILLIDDGSSDNSVEASQAENSHIVSNRNYGQHSAIMAGFS
ARNC_ECOHS      --VSVVIPVYNEQESLPELIRRTTTACESEILLIDDGSSDNSVEASQAENSHIVSNRNYGQHSAIMAGFS
ARNC_ECODH      --VSVVIPVYNEQESLPELIRRTTTACESEILLIDDGSSDNSVEASQAENSHIVSNRNYGQHSAIMAGFS
ARNC_ECOBW      --VSVVIPVYNEQESLPELIRRTTTACESEILLIDDGSSDNSVEASQAENSHIVSNRNYGQHSAIMAGFS
ARNC_ECO8A      --VSVVIPVYNEQESLPELIRRTTTACESEILLIDDGSSDNSVEASQAENSHIVSNRNYGQHSAIMAGFS
ARNC_ECO5E      --VSVVIPVYNEQESLPELIRRTTTACESEILLIDDGSSDNSVEASQAENSHIVSNRNYGQHSAIMAGFS
ARNC_ECO57      --VSVVIPVYNEQESLPELIRRTTTACESEILLIDDGSSDNSVEASQAENSHIVSNRNYGQHSAIMAGFS
ARNC_ECO55      --VSVVIPVYNEQESLPELIRRTTTACESEILLIDDGSSDNSVEASQAENSHIVSNRNYGQHSAIMAGFS
ARNC_ECO24      --VSVVIPVYNEQESLPELIRRTTTACESEILLIDDGSSDNSVEASQAENSHIVSNRNYGQHSAIMAGFS
ARNC_AERS4      --VSVIIPVYNEEASLPVLLSELLPQDY-EVILIDDGSHDGSTEDSKLVGVLLNRNYGQHA--AIMAGFE
RFBJ_SHIFL      --IAVIIPCYNEQKAIAKVINDFKTNPTASIYVFDNNSTDSTAQVAEDAGATVHSVPLKGKGNVVRRMFS
ARNC_SHIF8      --VSVVIPVYNEQESLPELIRRTTTACESEILLIDDGSSDNSVEASQAENSHIVSNRNYGQHSAIMAGFS
ARNC_PHOLL      --VSVVIPIYNEEESLPLLLERTLATQEYELILVDDGSSDKSAEQPENHIIAILLNRNYGQHSAIMAGFN
ARNC_PROMH      --VSVVIPVYNEEESLPQLLERTIKSCKQELILVDDGSSDNSLEEAANIEIAIILNRNYGQHSAIMAGFN
ARNC_SHESH      --VSIVIPVYNEEASLPELLSRTLAAAHYELVLIDDGSRDXXXXDSHVVGIILNRNYGQHN--AIMAGFE
DPM1_YEAST      -----------------------------ELIFVDDNSQDGSVEEVDALAVRIIVRTNRGLSSAVLKGFY
DPM1_CRIGR      ---SVLLPTYNERENLPLIVWLLXXXXXXXXXXXXXXXPDGTREVAEQLGPDRILLRPREKKLGLGTAIK
ARNC_PSEFS      -CVSIVIPVYNEQESLPELLRRTTAACKQEIILVDDGSRDNSAQEDGSNVVAVILNRNYGQHAAIMAGFE
YAIP_ECOLI      -CIDAIIPAYNEGPCLAQSLDNLLRNPYFRVICVNDGSTDNTAEVKRKWGDRFVAQKNTGKGGALMNGLN
ARNC_SALPK      --VSVVIPVYNEQESLPELIRRTTAACESEILLIXXXXXXXXAEEADSHIISILLNRNYGQHAAIMAGFS
ARNC_SALPA      --VSVVIPVYNEQESLPELIRRTTAACESEILLIXXXXXXXXAEEADSHIISILLNRNYGQHAAIMAGFS
ARNC_SALG2      --VSVVIPVYNEQESLPELIRRTTAACESEILLIXXXXXXXXAEEADSHIISILLNRNYGQHAAIMAGFS
ARNC_SALEP      --VSVVIPVYNEQESLPELIRRTTAACESEILLIXXXXXXXXAEEADSHIISILLNRNYGQHAAIMAGFS
ARNC_SALDC      --VSVVIPVYNEQESLPELIRRTTAACESEILLIXXXXXXXXAEEADSHIISILLNRNYGQHAAIMAGFS
ARNC_PSEA7      --VSVVIPVYNEEASLPELLRRTEAACRSEIVLVDDGSRDRSAEAAERDGCAVVANRNYGQHAAILAGFE
Y544_METJA      -----IIPAFNEEKNILKVLKDLEKLRV-DAVVVDDGSKDNTVEEAKKAKINVYNEKNEGKAKAIKFALS
DPM1_USTMA      -----------------------------EIIIVDDNSRDGSVETVSALNVRIIVRTSRGLSSAVVRGFR
ARNC_SALTY      --VSVVIPVYNEQESLPELIRRTTTACESEILLIXXXXXXXXAEEADSHIISILLNRNYGQHAAIMAGFS
ARNC_SALTI      --VSVVIPVYNEQESLPELIRRTTTACESEILLIXXXXXXXXAEEADSHIISILLNRNYGQHAAIMAGFS
ARNC_SALSV      --VSVVIPVYNEQESLPELIRRTTTACESEILLIXXXXXXXXAEEADSHIISILLNRNYGQHAAIMAGFS
ARNC_SALPC      --VSVVIPVYNEQESLPELIRRTTTACESEILLIXXXXXXXXAEEADSHIISILLNRNYGQHAAIMAGFS
ARNC_SALPB      --VSVVIPVYNEQESLPELIRRTTTACESEILLIXXXXXXXXAEEADSHIISILLNRNYGQHAAIMAGFS
ARNC_SALNS      --VSVVIPVYNEQESLPELIRRTTTACESEILLIXXXXXXXXAEEADSHIISILLNRNYGQHAAIMAGFS
ARNC_SALHS      --VSVVIPVYNEQESLPELIRRTTTACESEILLIXXXXXXXXAEEADSHIISILLNRNYGQHAAIMAGFS
ARNC_SALCH      --VSVVIPVYNEQESLPELIRRTTTACESEILLIXXXXXXXXAEEADSHIISILLNRNYGQHAAIMAGFS
ARNC_SALA4      --VSVVIPVYNEQESLPELIRRTTTACESEILLIXXXXXXXXAEEADSHIISILLNRNYGQHAAIMAGFS
ARNC_PSEAE      --VSVVIPVYNEEASLPELLRRTEAACLEEIVLVDDGSRDRSAEAAERDGVAVILNRNYGQHAAILAGFE
ARNC_PSEAB      --VSVVIPVYNEEASLPELLRRTEAACLEEIVLVDDGSRDRSAEAAERDGVAVILNRNYGQHAAILAGFE
ARNC_PSEA8      --VSVVIPVYNEEASLPELLRRTEAACLEEIVLVDDGSRDRSAEAAERDGVAVILNRNYGQHAAILAGFE
WAAE_KLEPN      --LSVVMIAKNAADLLPDCLGSVSWAD--EIIVLDSGSTDNTVELARRLGAQVYTHTDRGYGIQRQRAQD
ARNC_PSEF5      --VSIVIPVYNEEQSLPELLRRTEAACRQEIVLVDDGSRDAAAEREDSPVVAVILNRNYGQHAAIMAGFE
ARNC_SODGM      --VSIVIPVYNEQESLPELMRRTVAAAYEILLVXXXXXXXXAAAAAEAPGSHIVANRNYGQHSAIMAGFS
ALG5_YEAST      --LSVVIPSYNETGRILLMLTDAEKYGSREIVIVDDGSTDNTTQYCLKIQFRIIKSQNRGKGGAVRQGFL
EXOA_RHIME      ----IVIPCLNEASHIEALIEKLRPSLTARVVIADGGSTDGTREIARRLAVLFLDNPKRIQSAAVNRAVL
ARNC_WIGBR      --LSIIIPVYNEQDSLIELIKRTVNTCSKEIIIIDDGSNDKSIKEALKQNSKIVAIFLKGQHSAIMAGFK
ALG5_DICDI      --LSVIVPAYNEQIRLPSMLDDLNEKSKKDIIIIDDGSKDSTIEKQPSSNIRLLKKQNRGKGGAVKRGIL
ALG5_HUMAN      --LSVVVPSYNEEKRLPVMMDELEKRQKRDVIVVDDGSKDQTSKVAQKYGVRVITLVNRGKGGAIRMGIF
Y653_HAEIN      --ISVAMIIKNEAQDLANCLDTVK-DWVDEIIILDSGSTDNTKEIALSYGAKFYNSDWQGFGKQRQLAQQ
ARNC_KLEP7      -----------------------------------------------------------GQHSAIMAGFS
ARNC_KLEP3      -----------------------------------------------------------GQHSAIMAGFS
ICAA_STAAR      --ITFLLACYNESETIEDTLSNVLALKYKEIIIINDGSSDNTAELIYKIKIFVDLQENRGKANALNQGIK
ICAA_STAAN      --ITFLLACYNESETIEDTLSNVLALKYKEIIIINDGSSDNTAELIYKIKIFVDLQENRGKANALNQGIK
ICAA_STAAM      --ITFLLACYNESETIEDTLSNVLALKYKEIIIINDGSSDNTAELIYKIKIFVDLQENRGKANALNQGIK
ICAA_STAAC      --ITFLLACYNESETIEDTLSNVLALKYKEIIIINDGSSDNTAELIYKIKIFVDLQENRGKANALNQGIK
ICAA_STAA8      --ITFLLACYNESETIEDTLSNVLALKYKEIIIINDGSSDNTAELIYKIKIFVDLQENRGKANALNQGIK
GLTR1_MYCTU     ---SIIIPTLNVAAVLPACLDSIQTCGDFELVLVDGGSTDETLDIANNLGERLIGVYNRGVDLATGTWLL
GLTR1_MYCTA     ---SIIIPTLNVAAVLPACLDSIQTCGDFELVLVDGGSTDETLDIANNLGERLIGVYNRGVDLATGTWLL
GLTR1_MYCBP     ---SIIIPTLNVAAVLPACLDSIQTCGDFELVLVDGGSTDETLDIANNLGERLIGVYNRGVDLATGTWLL
GLTR1_MYCBO     ---SIIIPTLNVAAVLPACLDSIQTCGDFELVLVDGGSTDETLDIANNLGERLIGVYNRGVDLATGTWLL
EPSE_BACSU      --VSVIMGIYNCERTLAESIESILSQSYKELILCDDASTDGTLRIAKQYAAHIQNKTNKRLAASLNHCLS
ICAA_STAAW      --ITFLLACYNESDTIEDTLSNVLALKYKEIIIINDGSSDNTAELIYKIKIFVDLQENRGKANALNQGIK
ICAA_STAAS      --ITFLLACYNESDTIEDTLSNVLALKYKEIIIINDGSSDNTAELIYKIKIFVDLQENRGKANALNQGIK
Y075_MYCPN      MKISVIISTYNIVKALCSLVSNQTPACELEVLVIDDGSIDNTRQIIKKFQAKVSFKYFYKKNGNWGSVIN
TAGX_STAAW      MRLTIIIPTCNNEATIRQLLISIESKEHYRILCIDGGSTDQTIPMIERL---------------------
TAGX_STAAS      MRLTIIIPTCNNEATIRQLLISIESKEHYRILCIDGGSTDQTIPMIERL---------------------
TAGX_STAAR      MRLTIIIPTCNNEATIRQLLISIESKEHYRILCIDGGSTDQTIPMIERL---------------------
TAGX_STAAN      MRLTIIIPTCNNEATIRQLLISIESKEHYRILCIDGGSTDQTIPMIERL---------------------
TAGX_STAAM      MRLTIIIPTCNNEATIRQLLISIESKEHYRILCIDGGSTDQTIPMIERL---------------------
ALG5_SCHPO      --ITVIVPAYNESKRIGNMLQETSSAGQREILIVDDESKDTTVEFSNKLDLRCSLKRNRGKGGAVTWGML
YIBD_ECOLI      --LSVIIPLYNAGDDFRTCMESLITQTWTEIIIINDGSTDNSVEIAKYYAVRLLHQANAGASVARNRGIE
Y501_SYNY3      --LSIVIPMYNEEDNLEEVLTPLKIT--YEIICVNDGSKDKTLKQLSNRQIKIVNSRNFGKEIALSAGID
TAGX_STAAC      MRFTIIIPTCNNEATIRQLLISIESKEHYRILCIDGGSTDQTIPMIERL---------------------
TAGX_STAA8      MRFTIIIPTCNNEATIRQLLISIESKEHYRILCIDGGSTDQTIPMIERL---------------------
PUR7_SULAC      ----------------------------------------------------------------------
GPPA_SALAR      ----------------------------------------------------------------------
Y2836_ANASP     MKISVIISNYNYARYLSRAINSVLAQTHSDIVIVDDGSTDNSRDVITQLQIKPIXXXXXXXXXXXXXXXX
GPPA_ERWT9      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YVETPYVAVLDADYTYPPAELNKLVPLLRHYDVVIGARQGKMPALYKLGNKVLAWLFRVLFGVDLRDPLT
Y553_MYCBO      AATTPIVAVIDADGSMDAGDLPKLVAELKGADLVTGRRRPHWPWVARVGTVVMSWRLRTRHRLPVHD-IA
Y539_MYCTU      AATTPIVAVIDADGSMDAGDLPKLVAELKGADLVTGRRRPHWPWVARVGTVVMSWRLRTRHRLPVHD-IA
Y1222_METJA     Y-KPKIIITFDADGQHHPKDVEKVVKLFEGYDMAIGSRMKNMPLVKRIGNFGLNFITYLMGGYFVTDSQS
DPM1_DROME      HATGDFIVIIDADLSHHPKFIPEFIKLQQNYDIVSGTRYAGNGGVFKLISRGANFLSQVLLRPNASD-LT
DPM1_SCHPO      FATGDFVIIMDADFSHHPKYLPEFIKLQKNYDIVLGTRYAKDGGVYKFISRGANLLASTVLGTGVSDVTG
DPM1_BOVIN      HATGNYIIIMDADLSHHPKFIPEFIRKQKNFDIVSGTRYKGNGGVYKIISRVANFITQILLRPGASD-LT
DPM1_MOUSE      HATGNYVIIMDADLSHHPKFIPEFIRKQKNFDIVSGTRYKGNGGVYDLKRKIISRGANFITQILLRSDLT
DPM1_HUMAN      HATGNYIIIMDADLSHHPKFIPEFIRKQKNFDIVSGTRYKGNGGVYDLKRKIISRGANFLTQILLRSDLT
DPM1_PIG        HATGNYIIIMDADLSHHPKFIPEFIRKQKNFDIVSGTRYKGNGGVYDLKRKIISRGANFITQILLRSDLT
DPM1_DICDI      KSTGNWVILMDADLSHHPKFIPQFIEKQKNCEIVTGTRYQSGGGVFKLTSRVANYIASVLLTPGVSD-LT
ARNC_YERE8      QVSGDLIITLDADLQNPPEEIPRLVSVAEEYDVVGTVRAHRQDSLFKTASRMINMMIQRATGKSMGDYGC
ARNC_EDWI9      HIKGDLVITLDADLQNPPEEIPRLVEAAQGYDVVGTIRQDRQDSWFRRASRLINGLIQRTTGKSMSDYGC
ARNC_YERPY      QVSGDLIITLDADLQNPPEEIPRLVHVAEEYDVVGTVRANRQDSLFKTASRMINMMIQRATGKSMGDYGC
ARNC_YERPS      QVSGDLIITLDADLQNPPEEIPRLVHVAEEYDVVGTVRANRQDSLFKTASRMINMMIQRATGKSMGDYGC
ARNC_YERPP      QVSGDLIITLDADLQNPPEEIPRLVHVAEEYDVVGTVRANRQDSLFKTASRMINMMIQRATGKSMGDYGC
ARNC_YERPB      QVSGDLIITLDADLQNPPEEIPRLVHVAEEYDVVGTVRANRQDSLFKTASRMINMMIQRATGKSMGDYGC
ARNC_PECCP      QAVGDVVITLDADLQNPPEEIPRLVEAAQGYDVVGTVRANRQDSLFKLASKTINMMIRRSTGKSMADYGC
ARNC_ESCF3      YVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_ECOUT      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_ECOL6      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_ECOL5      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_ECOK1      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_ECO81      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_ECO45      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_ECO27      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_YERPN      QVSGDLIITLDADLQNPPEETPRLVHVAEEYDVVGTVRANRQDSLFKTASRMINMMIQRATGKSMGDYGC
ARNC_YERPG      QVSGDLIITLDADLQNPPEETPRLVHVAEEYDVVGTVRANRQDSLFKTASRMINMMIQRATGKSMGDYGC
ARNC_YERPE      QVSGDLIITLDADLQNPPEETPRLVHVAEEYDVVGTVRANRQDSLFKTASRMINMMIQRATGKSMGDYGC
ARNC_YERPA      QVSGDLIITLDADLQNPPEETPRLVHVAEEYDVVGTVRANRQDSLFKTASRMINMMIQRATGKSMGDYGC
ARNC_ERWCT      QAVGDVVITLDADLQNPPEEIPRLVEYAQGYDVVGTVRANRQDSLFKLASKTINMMIRRSTGKSMADYGC
ARNC_ECOSM      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_PSEU2      QCQGDVVITLDADLQNPPEEIPRLVKLAEQYDVVGTVRSNRQDSAWRWPSKLINLAVQRSTGVAMNDYGC
ARNC_SERP5      QVSGDLVITLDADLQNPPEEIPRLVKVAEEYDVVGTVRANRQDSWFKSASRIINMMIQRATGKSMGDYGC
ARNC_PSE14      QCKGDVVITLDADLQNPPEEIPRLVALAEQYDVVGTVRSNRQDSAWRWPSKIINVAVQRSTGVAMSDYGC
ARNC_ERWT9      HVSGDLVITLDADLQNPPEEIPRLVETAQQYDVVGTVRQNRQDSGFKIASRAINHLIQRATGKAMGDYGC
ARNC_ENT38      HVTGDLIVTLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDTWFKRASRLINRLIQSTTGKAMGDYGC
ARNC_PSEPF      QCKGDVVITLDADLQNPPEEIPRLVAEAEKGFDVVGTVRGNRSALRRYPSKLINLAVQRSTGVAMSDYGC
ARNC_ECO7I      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_AERHH      TAKGDLVITLDADLQNPPEEIPRLVAAMQGYDVVGTMRRNRQDSWFKTASKLINKSVQKATGVHMSDYGC
ARNC_SHISS      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_SHIFL      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_SHIDS      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_SHIBS      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_ECOSE      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_ECOLU      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_ECOLI      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_ECOLC      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_ECOHS      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_ECODH      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_ECOBW      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_ECO8A      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_ECO5E      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_ECO57      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_ECO55      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_ECO24      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAMGDYGC
ARNC_AERS4      TAKGDLVITLDADLQNPPEEIPRLVAAMQGYDVVGTVRRNRQDSWFKTASRLINKSMQKATGVHMSDYGC
RFBJ_SHIFL      DVDADIYLMVDGDDTYAPEMINHLIK--NQLDMVVGCRQ-------------------------------
ARNC_SHIF8      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSWFKTASKMINRLIQRTTGKAM-----
ARNC_PHOLL      QVNGDLIITLDADLQNPPEEIPRLVKTAEQYDVVGTRRANRQDSLFKTASKIINAMITKATGRSMGDYGC
ARNC_PROMH      QADGDLVITLDADLQNPPEEIPRLVATAEEYDVVGTRRRNRQDSWFKTASKMINAMITKATGRSMGDYGC
ARNC_SHESH      HVRGDLIITLDADLQNPPEEIPNLVAKAEEYDSVGTVRRHRQSALRRYPSKLINKLVKRSTGVEMNDYGC
DPM1_YEAST      EAKGQYLVCMDADLQHPPETVPKLFESLHDHAFTLGTRYAPGVGIDKMYRRVISSTARMMARTIASDPMS
DPM1_CRIGR      HATGNYVIIMDADLSHHPKFIPEFIRKQKNFDIVSGTRYKGNGGVYDLKRKIISRGANFITQILLRSDLT
ARNC_PSEFS      QCRGDVVITLDADLQNPPEEIPRLVQAALGYDVVATVRNNRQDSAFRWPSRLINLAVQRSTGVAMTD---
YAIP_ECOLI      YATCDQVFLSDADTYVPPDQDGMLAEIERGADAVGGIPSGLLPATVKLPMIVMKRTLQQLLGPFIISGAC
ARNC_SALPK      HVSGDLIITLDADLQNPPEEIPRLVAKAEGFDVVGTVRQNRQDSLFKSASKIINLLIQRTTGKAMGDYGC
ARNC_SALPA      HVSGDLIITLDADLQNPPEEIPRLVAKAEGFDVVGTVRQNRQDSLFKSASKIINLLIQRTTGKAMGDYGC
ARNC_SALG2      HVSGDLIITLDADLQNPPEEIPRLVAKAEGFDVVGTVRQNRQDSLFKSASKIINLLIQRTTGKAMGDYGC
ARNC_SALEP      HVSGDLIITLDADLQNPPEEIPRLVAKAEGFDVVGTVRQNRQDSLFKSASKIINLLIQRTTGKAMGDYGC
ARNC_SALDC      HVSGDLIITLDADLQNPPEEIPRLVAKAEGFDVVGTVRQNRQDSLFKSASKIINLLIQRTTGKAMGDYGC
ARNC_PSEA7      QSRGDLVITLDADLQNPPEEIPRLVEAAQGYDVVGSIRDNRRDSAWRWPSRLVNLAVQRSTGVAMHD---
Y544_METJA      LNXXXXXXXXDGDYQHKPMDIPKLLKKLENADAVFGIRKYKIPLHRQISNAVLIYSKRFYF---FRDVQC
DPM1_USTMA      EARGQRMICMDADLQHPPEAVPSLLLALNQKSFVLGTRYGSMDKDWPLHRRIISSGARMLARTSASDPMS
ARNC_SALTY      HVSGDLIITLDADLQNPPEEIPRLVAKAEGFDVVGTVRQNRQDSLFKSASKIINLLIQRTTGKAMGDYGC
ARNC_SALTI      HVSGDLIITLDADLQNPPEEIPRLVAKAEGFDVVGTVRQNRQDSLFKSASKIINLLIQRTTGKAMGDYGC
ARNC_SALSV      HVSGDLIITLDADLQNPPEEIPRLVAKAEGFDVVGTVRQNRQDSLFKSASKIINLLIQRTTGKAMGDYGC
ARNC_SALPC      HVSGDLIITLDADLQNPPEEIPRLVAKAEGFDVVGTVRQNRQDSLFKSASKIINLLIQRTTGKAMGDYGC
ARNC_SALPB      HVSGDLIITLDADLQNPPEEIPRLVAKAEGFDVVGTVRQNRQDSLFKSASKIINLLIQRTTGKAMGDYGC
ARNC_SALNS      HVSGDLIITLDADLQNPPEEIPRLVAKAEGFDVVGTVRQNRQDSLFKSASKIINLLIQRTTGKAMGDYGC
ARNC_SALHS      HVSGDLIITLDADLQNPPEEIPRLVAKAEGFDVVGTVRQNRQDSLFKSASKIINLLIQRTTGKAMGDYGC
ARNC_SALCH      HVSGDLIITLDADLQNPPEEIPRLVAKAEGFDVVGTVRQNRQDSLFKSASKIINLLIQRTTGKAMGDYGC
ARNC_SALA4      HVSGDLIITLDADLQNPPEEIPRLVAKAEGFDVVGTVRQNRQDSLFKSASKIINLLIQRTTGKAMGDYGC
ARNC_PSEAE      QSRGDLVITLDADLQNPPEEIPRLVEAAQGYDVVGSIRAERQDSAWRWPSRLVNLAVQRSTGVAMHD---
ARNC_PSEAB      QSRGDLVITLDADLQNPPEEIPRLVEAAQGYDVVGSIRAERQDSAWRWPSRLVNLAVQRSTGVAMHD---
ARNC_PSEA8      QSRGDLVITLDADLQNPPEEIPRLVEAAQGYDVVGSIRAERQDSAWRWPSRLVNLAVQRSTGVAMHD---
WAAE_KLEPN      YATGDWVLMIDTDERVTP----------------------------------------------------
ARNC_PSEF5      QCRGDVVITLDADLQNPPEEIPRLVAQAEGYDVVGTVRNNRQDSAFRWPSKLINLAVQRSTGVAMSDYGC
ARNC_SODGM      HVTGDLVVTLDADLQNPPEEIPRLVEVAQDYDVVGTVRQNRQDSWFKRASRMINALIQRTTGKAMGDYGC
ALG5_YEAST      HIRGKYGLFADADGASKFSDVEKLIDAISKIEVAIGSRAHMVEAVIKRSRNCLMYGFHTLFGISIKDTQC
EXOA_RHIME      GAGSDYLIRIDAHGTYPDDYCERLV---------------------------------------------
ARNC_WIGBR      HSSGDLVITMDADLQNPPEEIPKLINAEKGYDVIGTFRQNRKDNWFRKXXXXXXXXXXXXXXXXXMKDYG
ALG5_DICDI      CSRGKYCLMVDADGATEFKDFNRVEDIMHKIEIVCGSRDSDLVAKRSFLRNILMYGFHILCVKGIKDTQC
ALG5_HUMAN      SSRGEKILMADADTKFPDVELNDLQPWPNQMAIACGSRRSYFRTLLMYGFHFLVWFLCV---KGIRDTQC
Y653_HAEIN      YVTSDYVLWLDADERVTP----------------------------------------------------
ARNC_KLEP7      HVTGDLIITLDADLQNPPEEIPRLVAKAEGYDVVGTVRQNRQDSIFKTASKMINRLIQRTTGKAMGDYGC
ARNC_KLEP3      HVTGDLIITLDADLQNPPEEIPRLVEKAEGYDVVGTVRQNRQDSIFKSASKMINRLIQRTTGKAMGDYGC
ICAA_STAAR      QASYDYVMCLDAD---------------------------------------------------------
ICAA_STAAN      QASYDYVMCLDAD---------------------------------------------------------
ICAA_STAAM      QASYDYVMCLDAD---------------------------------------------------------
ICAA_STAAC      QASYDYVMCLDAD---------------------------------------------------------
ICAA_STAA8      QASYDYVMCLDAD---------------------------------------------------------
GLTR1_MYCTU     FL--------------------------------------------------------------------
GLTR1_MYCTA     FL--------------------------------------------------------------------
GLTR1_MYCBP     FL--------------------------------------------------------------------
GLTR1_MYCBO     FL--------------------------------------------------------------------
EPSE_BACSU      HATGDYIARQDGDDLSFPRRLEKQVAFLRHYQVV------------------------------------
ICAA_STAAW      QASYDYVMCLDAD---------------------------------------------------------
ICAA_STAAS      QASYDYVMCLDAD---------------------------------------------------------
Y075_MYCPN      YVKEDWITVLDSDDTLKPNTLNKLANLVEDYDLVV-----------------------------------
TAGX_STAAW      ----------------------------------------------------------------------
TAGX_STAAS      ----------------------------------------------------------------------
TAGX_STAAR      ----------------------------------------------------------------------
TAGX_STAAN      ----------------------------------------------------------------------
TAGX_STAAM      ----------------------------------------------------------------------
ALG5_SCHPO      YARGQYAIFADADGASQFSDLELLFKNMSRAHMVNTAAVVKRSFIRNFLMHCFHKLLQILGIREIGDTQC
YIBD_ECOLI      VATGKYVAFVDADDEVYPTMYETLMTMALEDDL-------------------------------------
Y501_SYNY3      YAQGNAVIPIDADLQDPPELIHELVDKWREYDIVYATRRSR-----------------------------
TAGX_STAAC      ----------------------------------------------------------------------
TAGX_STAA8      ----------------------------------------------------------------------
PUR7_SULAC      --------------------------LLRFKDSITGARKDELPGKGTLNAQTSALFFRLLEKNDIRTHYV
GPPA_SALAR      ----------------------------------------------------------------------
Y2836_ANASP     XXTGEVVAFLDADDVWKPHKLQRIVEVFQTSDVV------------------------------------
GPPA_ERWT9      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GMYVARTDVLREAVTEARGFDLEVEILAKALANGARVAEVPIQYRERIGKKKLRPWHGVGIAVKALELAY
Y553_MYCBO      PMRVARREALLDLGVVDRRSGYPLELLVRAAAAGWRVVELDVSYGPRTGGK-------------------
Y539_MYCTU      PMRVARREALLDLGVVDRRSGYPLELLVRAAAAGWRVVELDVSYGPRTGGK-------------------
Y1222_METJA     GLRAFSYEAAKKIIGDLKSYEVSSEFIILAKKHGLKLKEVPIK---------------------------
DPM1_DROME      GSFLYKKDVLEKCIASSKGYVFQMEMLVRARQHGYTIAEVPITFVDRIGTSKL-----------------
DPM1_SCHPO      SFRLYKKPVLETLMSESKGYVFQMEIIARAREHNYTIGEVPIAFVDRLGESKL-----------------
DPM1_BOVIN      GSFLYRKEVLQKLIGKSKGYVFQMEMIVRARQLNYTIGEVPISFVDRVGESKL-----------------
DPM1_MOUSE      GSFLYRKEVLQKLIEKSKGYVFQMEMIVRARQMNYTIGEVPISFVDRVGESKL-----------------
DPM1_HUMAN      GSFLYRKEVLEKLIEKSKGYVFQMEMIVRARQLNYTIGEVPISFVDRVGESKL-----------------
DPM1_PIG        GSFLYRKEVLQKLIEKSKGYVFQMEMIVRARQLNYTIGEVPISFVDRVGESKL-----------------
DPM1_DICDI      GSFLYRKDVLEKLITQSKGYVFQVEMMVRANQLGYQVGEVPITFVDRIGVSNLDSGEIVGFLKSVLNL--
ARNC_YERE8      MLRAYRRHIV-EAMLHCHERSTFIPILANTFAR--RTTEITVHHAERFGDSKYS-------LMKLINLMY
ARNC_EDWI9      MLRAYRSSVIK-AMLHCHERSTFIPILANSFAR--RTIEIPVKHAERHGESK----YGL---MKLINLMY
ARNC_YERPY      MLRAYRRHIV-EAMLHCHERSTFIPILANTFAR--RTTEITVHHAERFGNSKYS-------LMRLINLMY
ARNC_YERPS      MLRAYRRHIV-EAMLHCHERSTFIPILANTFAR--RTTEITVHHAERFGNSKYS-------LMRLINLMY
ARNC_YERPP      MLRAYRRHIV-EAMLHCHERSTFIPILANTFAR--RTTEITVHHAERFGNSKYS-------LMRLINLMY
ARNC_YERPB      MLRAYRRHIV-EAMLHCHERSTFIPILANTFAR--RTTEITVHHAERFGNSKYS-------LMRLINLMY
ARNC_PECCP      MLRAYRRHIV-SAMLHCHERSTFIPILANTFAR--KTIEIDVMHAERFGTSKYS-------FLKLINLMY
ARNC_ESCF3      MLRAYRRHIV-DAMLHCHERSTFIPILANIFARQA--VEIPVHHAERFGESKYS-------FMRLINLMY
ARNC_ECOUT      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_ECOL6      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_ECOL5      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_ECOK1      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_ECO81      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_ECO45      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_ECO27      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_YERPN      MLRAYRRHIV-EAMLHCHERSTFIPILANTFAR--RTTEITVHHAERFGNSKYS-------LMRLINLMY
ARNC_YERPG      MLRAYRRHIV-EAMLHCHERSTFIPILANTFAR--RTTEITVHHAERFGNSKYS-------LMRLINLMY
ARNC_YERPE      MLRAYRRHIV-EAMLHCHERSTFIPILANTFAR--RTTEITVHHAERFGNSKYS-------LMRLINLMY
ARNC_YERPA      MLRAYRRHIV-EAMLHCHERSTFIPILANTFAR--RTTEITVHHAERFGNSKYS-------LMRLINLMY
ARNC_ERWCT      MLRAYRRHIV-SAMLRCHERSTFIPILANTFAR--KTIEIDVLHAERFGTSKYS-------FLKLINLMY
ARNC_ECOSM      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_PSEU2      MLRAYRRTIV-DAMLACRERSTFIPILANSFAR--HTTEVLVDHAERHGDSKYSPMRLINLMFD-LITCM
ARNC_SERP5      MLRAYRRHII-EAMLNCHERSTFIPILANTFAR--RTTEIEVLHAER-----------------------
ARNC_PSE14      MLRAYRRTIV-DAMLACRERSTFIPILANSFAR--HTTEVLVDHAERHGDSKYSPMRLVNLMFD-LITCM
ARNC_ERWT9      MLRAYRRHIV-DAMLNCHERSTFIPILANTFARQA--TEIPVLHAER-----------------------
ARNC_ENT38      MLRAYRRHII-DAMLHCHERSTFIPILANTFAR--KAIEIPVHHAER-----------------------
ARNC_PSEPF      MLRAYRRTII-DAMLACRERSTFIPILANSFAR--HTTEIPVAHAERHGDSKYSPMRLINLMFD-LITCM
ARNC_ECO7I      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_AERHH      MLRAYRRHII-DAMLCCQERSTFIPILANSFAR--RTIELEVGHAERAGESKYGLMHLINL-MYDLVTCM
ARNC_SHISS      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_SHIFL      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_SHIDS      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_SHIBS      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_ECOSE      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_ECOLU      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_ECOLI      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_ECOLC      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_ECOHS      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_ECODH      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_ECOBW      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_ECO8A      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHSER-----------------------
ARNC_ECO5E      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_ECO57      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_ECO55      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHAER-----------------------
ARNC_ECO24      MLRAYRRHIV-DAMLHCHERSTFIPILANIFAR--RAIEIPVHHSER-----------------------
ARNC_AERS4      MLRAYRRHII-DAMLCCQERSTFIPILANSFAR--RTIELEVGHAERAGESKYGLMHLINL-MYDLVTCM
RFBJ_SHIFL      ----------------------------------------------------------------------
ARNC_SHIF8      GNYGCMLRAYRRHIVDAMLHCHERSTFIPILANARRAIEIPVHHAER-----------------------
ARNC_PHOLL      MLRAYRRHIV-EAMLQCHERSTFIPILANTFAR--KTIEIDVAHAER-----------------------
ARNC_PROMH      MLRAYRRHII-DAMLQCHERSTFIPILANTFAR--RTIEIEVAHAER-----------------------
ARNC_SHESH      MLRAYRRHVVK-AMLECHERSTFIPILANGFAR--HTAEIDVHHSER-----------------------
DPM1_YEAST      GFFGLQKKYLENCDINSQGFKIALELLAKPLPRDPRVAEVPFTFGVRTGESKL-----------------
DPM1_CRIGR      GSFLYRKEVLQKLIEKSKGYVFQMEMIVRARQLNYTIGEVPISFVDRVGESKL-----------------
ARNC_PSEFS      --YGCMLRAYRRTIVDAMLACRERSTFIPILANGRHTTEILVHHAER-----------------------
YAIP_ECOLI      GMF--RTDVLRKFGFSDRTKVEDLDLTWTLVANGYRIRQ-------------------------------
ARNC_SALPK      MLRAYRRPII-DTMLRCHERSTFIPILANIFAR--RATEIPVHHAER-----------------------
ARNC_SALPA      MLRAYRRPII-DTMLRCHERSTFIPILANIFAR--RATEIPVHHAER-----------------------
ARNC_SALG2      MLRAYRRPII-DTMLRCHERSTFIPILANIFAR--RATEIPVHHAER-----------------------
ARNC_SALEP      MLRAYRRPII-DTMLRCHERSTFIPILANIFAR--RATEIPVHHAER-----------------------
ARNC_SALDC      MLRAYRRPII-DTMLRCHERSTFIPILANIFAR--RATEIPVHHAER-----------------------
ARNC_PSEA7      --YGCMLRAYRRSIVEAMLACRERSTFIPILANGRHTCEIRVAHAER-----------------------
Y544_METJA      GFRIIKAEFLKD-MKFGDGYAVEHFIALQLAKKGAKIVEVSVEYHD------------------------
DPM1_USTMA      GFFGITKHSFHTADINAQGFKIALDLLVKSGVHSTDIAEVPFSFGLREGESKL-----------------
ARNC_SALTY      MLRAYRRPII-DTMLRCHERSTFIPILANIFAR--RATEIPVHHAER-----------------------
ARNC_SALTI      MLRAYRRPII-DTMLRCHERSTFIPILANIFAR--RATEIPVHHAER-----------------------
ARNC_SALSV      MLRAYRRPII-DTMLRCHERSTFIPILANIFAR--RATEIPVHHAER-----------------------
ARNC_SALPC      MLRAYRRPII-DTMLRCHERSTFIPILANIFAR--RATEIPVHHAER-----------------------
ARNC_SALPB      MLRAYRRPII-DTMLRCHERSTFIPILANIFAR--RATEIPVHHAER-----------------------
ARNC_SALNS      MLRAYRRPII-DTMLRCHERSTFIPILANIFAR--RATEIPVHHAER-----------------------
ARNC_SALHS      MLRAYRRPII-DTMLRCHERSTFIPILANIFAR--RATEIPVHHAER-----------------------
ARNC_SALCH      MLRAYRRPII-DTMLRCHERSTFIPILANIFAR--RATEIPVHHAER-----------------------
ARNC_SALA4      MLRAYRRPII-DTMLRCHERSTFIPILANIFAR--RATEIPVHHAER-----------------------
ARNC_PSEAE      --YGCMLRAYRRSIVEAMLACRERSTFIPILANGRHTCEIRVAHAER-----------------------
ARNC_PSEAB      --YGCMLRAYRRSIVEAMLACRERSTFIPILANGRHTCEIRVAHAER-----------------------
ARNC_PSEA8      --YGCMLRAYRRSIVEAMLACRERSTFIPILANGRHTCEIRVAHAER-----------------------
WAAE_KLEPN      ----------------------------------------------------------------------
ARNC_PSEF5      MLRAYRRTIIDAACTERSTF---IPILANSFAR--HTTEVLVEHAER-----------------------
ARNC_SODGM      MLRAYRRHII-DAMLHCHERSTFIPILANTFAR--KTIEIPVMHSERFGDSKYS-------LMKLVNLMY
ALG5_YEAST      GFKLFNRAAILKIFPHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDGSK-------MALAIDSIKMA-
EXOA_RHIME      ----------------------------------------------------------------------
ARNC_WIGBR      CMLRAYNRNIINSILEYNKKNIFIPILANTLSK--NIIEIPVLHYER-----------------------
ALG5_DICDI      GFKLFTRETARRIFIERWAFDVEILYLAQKL--NIPIAEVAVNWTEIDGSK-------------------
ALG5_HUMAN      GFKLAASRTFSSLHVERWAFDVELLYIAQFFK--IPIAEIAVNWTEIEGSKLVPFW--------------
Y653_HAEIN      ----------------------------------------------------------------------
ARNC_KLEP7      MLRAYRRHII-DAMLNCHERSTFIPILANTFAR--RAVEIPVMHAER-----------------------
ARNC_KLEP3      MLRAYRRHII-DAMLNCHERSTFIPILANTFAR--RAVEIPVMHAER-----------------------
ICAA_STAAR      ----------------------------------------------------------------------
ICAA_STAAN      ----------------------------------------------------------------------
ICAA_STAAM      ----------------------------------------------------------------------
ICAA_STAAC      ----------------------------------------------------------------------
ICAA_STAA8      ----------------------------------------------------------------------
GLTR1_MYCTU     ----------------------------------------------------------------------
GLTR1_MYCTA     ----------------------------------------------------------------------
GLTR1_MYCBP     ----------------------------------------------------------------------
GLTR1_MYCBO     ----------------------------------------------------------------------
EPSE_BACSU      ----------------------------------------------------------------------
ICAA_STAAW      ----------------------------------------------------------------------
ICAA_STAAS      ----------------------------------------------------------------------
Y075_MYCPN      ----------------------------------------------------------------------
TAGX_STAAW      ----------------------------------------------------------------------
TAGX_STAAS      ----------------------------------------------------------------------
TAGX_STAAR      ----------------------------------------------------------------------
TAGX_STAAN      ----------------------------------------------------------------------
TAGX_STAAM      ----------------------------------------------------------------------
ALG5_SCHPO      GFKLFSREAYQSIFMHVEGWIFDIEVLTLARFFGLPIIEVPITWHEVGGSKMTLLKDSISMAIDLLVI--
YIBD_ECOLI      ----------------------------------------------------------------------
Y501_SYNY3      ----------------------------------------------------------------------
TAGX_STAAC      ----------------------------------------------------------------------
TAGX_STAA8      ----------------------------------------------------------------------
PUR7_SULAC      GMYDEKTMI----VTKLK--MIPVEVVLRNIATGSIVKRLPIKEGE------------------------
GPPA_SALAR      ---------IKRKVRLAAGLSSDNQLSAEAMERGWQCLRLFAERLQDIPQPQIRV-----VATATLRLA-
Y2836_ANASP     ----------------------------------------------------------------------
GPPA_ERWT9      ---------IKRKVRLAAGLDADNNLSAEAMDRGWQCLRLFSEQLQDIPPEQIRV-----VATATLRIA-


                         .         .         .         +         .         .         .:280
query           RLNPALFLTLIGALMLIPAVALGGWVAYRYFYQGVPHYMLGLAALLMLVIGGISTALLxxxxxxxxxxxx
Y553_MYCBO      ----------------------------------------------------------------------
Y539_MYCTU      ----------------------------------------------------------------------
Y1222_METJA     ----------------------------------------------------------------------
DPM1_DROME      ----------------------------------------------------------------------
DPM1_SCHPO      ----------------------------------------------------------------------
DPM1_BOVIN      ----------------------------------------------------------------------
DPM1_MOUSE      ----------------------------------------------------------------------
DPM1_HUMAN      ----------------------------------------------------------------------
DPM1_PIG        ----------------------------------------------------------------------
DPM1_DICDI      ----------------------------------------------------------------------
ARNC_YERE8      DLITCLTTTPLRLLSLVGSVALSGF---------------------------------------------
ARNC_EDWI9      DLVTCLTTTPLRALSI------------------------------------------------------
ARNC_YERPY      DLITCLTTTPLRLLSLVSAIALLGF---------------------------------------------
ARNC_YERPS      DLITCLTTTPLRLLSLVSAIALLGF---------------------------------------------
ARNC_YERPP      DLITCLTTTPLRLLSLVSAIALLGF---------------------------------------------
ARNC_YERPB      DLITCLTTTPLRLLSLVSAIALLGF---------------------------------------------
ARNC_PECCP      DLLTCLTTTPLRILSLIGSV--------------------------------------------------
ARNC_ESCF3      DLVTCLTTTPLRMLSLLGSI--------------------------------------------------
ARNC_ECOUT      ----------------------------------------------------------------------
ARNC_ECOL6      ----------------------------------------------------------------------
ARNC_ECOL5      ----------------------------------------------------------------------
ARNC_ECOK1      ----------------------------------------------------------------------
ARNC_ECO81      ----------------------------------------------------------------------
ARNC_ECO45      ----------------------------------------------------------------------
ARNC_ECO27      ----------------------------------------------------------------------
ARNC_YERPN      DLITCLTTTPLRLLSLVSAIALLGF---------------------------------------------
ARNC_YERPG      DLITCLTTTPLRLLSLVSAIALLGF---------------------------------------------
ARNC_YERPE      DLITCLTTTPLRLLSLVSAIALLGF---------------------------------------------
ARNC_YERPA      DLITCLTTTPLRLLSLVSAIALLGF---------------------------------------------
ARNC_ERWCT      DLLTCLTTTPLRILSLIGSV--------------------------------------------------
ARNC_ECOSM      ----------------------------------------------------------------------
ARNC_PSEU2      TTTPLRLLSIIGFSMALLGV--------------------------------------------------
ARNC_SERP5      ----------------------------------------------------------------------
ARNC_PSE14      TTTPLRLLSIIGFSMALLGV--------------------------------------------------
ARNC_ERWT9      ----------------------------------------------------------------------
ARNC_ENT38      ----------------------------------------------------------------------
ARNC_PSEPF      TTTPLRLLSIVGFAM-------------------------------------------------------
ARNC_ECO7I      ----------------------------------------------------------------------
ARNC_AERHH      TTTPLRLLSIVGSVV-------------------------------------------------------
ARNC_SHISS      ----------------------------------------------------------------------
ARNC_SHIFL      ----------------------------------------------------------------------
ARNC_SHIDS      ----------------------------------------------------------------------
ARNC_SHIBS      ----------------------------------------------------------------------
ARNC_ECOSE      ----------------------------------------------------------------------
ARNC_ECOLU      ----------------------------------------------------------------------
ARNC_ECOLI      ----------------------------------------------------------------------
ARNC_ECOLC      ----------------------------------------------------------------------
ARNC_ECOHS      ----------------------------------------------------------------------
ARNC_ECODH      ----------------------------------------------------------------------
ARNC_ECOBW      ----------------------------------------------------------------------
ARNC_ECO8A      ----------------------------------------------------------------------
ARNC_ECO5E      ----------------------------------------------------------------------
ARNC_ECO57      ----------------------------------------------------------------------
ARNC_ECO55      ----------------------------------------------------------------------
ARNC_ECO24      ----------------------------------------------------------------------
ARNC_AERS4      TTTPLRLLSIVGSLV-------------------------------------------------------
RFBJ_SHIFL      ----------------------------------------------------------------------
ARNC_SHIF8      ----------------------------------------------------------------------
ARNC_PHOLL      ----------------------------------------------------------------------
ARNC_PROMH      ----------------------------------------------------------------------
ARNC_SHESH      ----------------------------------------------------------------------
DPM1_YEAST      ----------------------------------------------------------------------
DPM1_CRIGR      ----------------------------------------------------------------------
ARNC_PSEFS      ----------------------------------------------------------------------
YAIP_ECOLI      ----------------------------------------------------------------------
ARNC_SALPK      ----------------------------------------------------------------------
ARNC_SALPA      ----------------------------------------------------------------------
ARNC_SALG2      ----------------------------------------------------------------------
ARNC_SALEP      ----------------------------------------------------------------------
ARNC_SALDC      ----------------------------------------------------------------------
ARNC_PSEA7      ----------------------------------------------------------------------
Y544_METJA      ----------------------------------------------------------------------
DPM1_USTMA      ----------------------------------------------------------------------
ARNC_SALTY      ----------------------------------------------------------------------
ARNC_SALTI      ----------------------------------------------------------------------
ARNC_SALSV      ----------------------------------------------------------------------
ARNC_SALPC      ----------------------------------------------------------------------
ARNC_SALPB      ----------------------------------------------------------------------
ARNC_SALNS      ----------------------------------------------------------------------
ARNC_SALHS      ----------------------------------------------------------------------
ARNC_SALCH      ----------------------------------------------------------------------
ARNC_SALA4      ----------------------------------------------------------------------
ARNC_PSEAE      ----------------------------------------------------------------------
ARNC_PSEAB      ----------------------------------------------------------------------
ARNC_PSEA8      ----------------------------------------------------------------------
WAAE_KLEPN      ----------------------------------------------------------------------
ARNC_PSEF5      ----------------------------------------------------------------------
ARNC_SODGM      DLTPLRMLSVIGSMIAL-----------------------------------------------------
ALG5_YEAST      ----------------------------------------------------------------------
EXOA_RHIME      ----------------------------------------------------------------------
ARNC_WIGBR      ----------------------------------------------------------------------
ALG5_DICDI      ----------------------------------------------------------------------
ALG5_HUMAN      ----------------------------------------------------------------------
Y653_HAEIN      ----------------------------------------------------------------------
ARNC_KLEP7      ----------------------------------------------------------------------
ARNC_KLEP3      ----------------------------------------------------------------------
ICAA_STAAR      ----------------------------------------------------------------------
ICAA_STAAN      ----------------------------------------------------------------------
ICAA_STAAM      ----------------------------------------------------------------------
ICAA_STAAC      ----------------------------------------------------------------------
ICAA_STAA8      ----------------------------------------------------------------------
GLTR1_MYCTU     ----------------------------------------------------------------------
GLTR1_MYCTA     ----------------------------------------------------------------------
GLTR1_MYCBP     ----------------------------------------------------------------------
GLTR1_MYCBO     ----------------------------------------------------------------------
EPSE_BACSU      ----------------------------------------------------------------------
ICAA_STAAW      ----------------------------------------------------------------------
ICAA_STAAS      ----------------------------------------------------------------------
Y075_MYCPN      ----------------------------------------------------------------------
TAGX_STAAW      ----------------------------------------------------------------------
TAGX_STAAS      ----------------------------------------------------------------------
TAGX_STAAR      ----------------------------------------------------------------------
TAGX_STAAN      ----------------------------------------------------------------------
TAGX_STAAM      ----------------------------------------------------------------------
ALG5_SCHPO      RLN-------------------------------------------------------------------
YIBD_ECOLI      ----------------------------------------------------------------------
Y501_SYNY3      ----------------------------------------------------------------------
TAGX_STAAC      ----------------------------------------------------------------------
TAGX_STAA8      ----------------------------------------------------------------------
PUR7_SULAC      ----------------------------------------------------------------------
GPPA_SALAR      -VNAGEFIAKAQTILGCPVQVISGEEEARLIYQGVAHTTGGAEQRLVVDIGGASTELV------------
Y2836_ANASP     ----------------------------------------------------------------------
GPPA_ERWT9      -ANAGSFLAQAQKLLGCPVNVISGEEEARLIYQGVSHTTGGSDKRLVVDIGGGSTELV------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Y553_MYCBO      ----------------------------------------------------------------------
Y539_MYCTU      ----------------------------------------------------------------------
Y1222_METJA     ----------------------------------------------------------------------
DPM1_DROME      ----------------------------------------------------------------------
DPM1_SCHPO      ----------------------------------------------------------------------
DPM1_BOVIN      ----------------------------------------------------------------------
DPM1_MOUSE      ----------------------------------------------------------------------
DPM1_HUMAN      ----------------------------------------------------------------------
DPM1_PIG        ----------------------------------------------------------------------
DPM1_DICDI      ----------------------------------------------------------------------
ARNC_YERE8      ----------------------------------------------------------------------
ARNC_EDWI9      ----------------------------------------------------------------------
ARNC_YERPY      ----------------------------------------------------------------------
ARNC_YERPS      ----------------------------------------------------------------------
ARNC_YERPP      ----------------------------------------------------------------------
ARNC_YERPB      ----------------------------------------------------------------------
ARNC_PECCP      ----------------------------------------------------------------------
ARNC_ESCF3      ----------------------------------------------------------------------
ARNC_ECOUT      ----------------------------------------------------------------------
ARNC_ECOL6      ----------------------------------------------------------------------
ARNC_ECOL5      ----------------------------------------------------------------------
ARNC_ECOK1      ----------------------------------------------------------------------
ARNC_ECO81      ----------------------------------------------------------------------
ARNC_ECO45      ----------------------------------------------------------------------
ARNC_ECO27      ----------------------------------------------------------------------
ARNC_YERPN      ----------------------------------------------------------------------
ARNC_YERPG      ----------------------------------------------------------------------
ARNC_YERPE      ----------------------------------------------------------------------
ARNC_YERPA      ----------------------------------------------------------------------
ARNC_ERWCT      ----------------------------------------------------------------------
ARNC_ECOSM      ----------------------------------------------------------------------
ARNC_PSEU2      ----------------------------------------------------------------------
ARNC_SERP5      ----------------------------------------------------------------------
ARNC_PSE14      ----------------------------------------------------------------------
ARNC_ERWT9      ----------------------------------------------------------------------
ARNC_ENT38      ----------------------------------------------------------------------
ARNC_PSEPF      ----------------------------------------------------------------------
ARNC_ECO7I      ----------------------------------------------------------------------
ARNC_AERHH      ----------------------------------------------------------------------
ARNC_SHISS      ----------------------------------------------------------------------
ARNC_SHIFL      ----------------------------------------------------------------------
ARNC_SHIDS      ----------------------------------------------------------------------
ARNC_SHIBS      ----------------------------------------------------------------------
ARNC_ECOSE      ----------------------------------------------------------------------
ARNC_ECOLU      ----------------------------------------------------------------------
ARNC_ECOLI      ----------------------------------------------------------------------
ARNC_ECOLC      ----------------------------------------------------------------------
ARNC_ECOHS      ----------------------------------------------------------------------
ARNC_ECODH      ----------------------------------------------------------------------
ARNC_ECOBW      ----------------------------------------------------------------------
ARNC_ECO8A      ----------------------------------------------------------------------
ARNC_ECO5E      ----------------------------------------------------------------------
ARNC_ECO57      ----------------------------------------------------------------------
ARNC_ECO55      ----------------------------------------------------------------------
ARNC_ECO24      ----------------------------------------------------------------------
ARNC_AERS4      ----------------------------------------------------------------------
RFBJ_SHIFL      ----------------------------------------------------------------------
ARNC_SHIF8      ----------------------------------------------------------------------
ARNC_PHOLL      ----------------------------------------------------------------------
ARNC_PROMH      ----------------------------------------------------------------------
ARNC_SHESH      ----------------------------------------------------------------------
DPM1_YEAST      ----------------------------------------------------------------------
DPM1_CRIGR      ----------------------------------------------------------------------
ARNC_PSEFS      ----------------------------------------------------------------------
YAIP_ECOLI      ----------------------------------------------------------------------
ARNC_SALPK      ----------------------------------------------------------------------
ARNC_SALPA      ----------------------------------------------------------------------
ARNC_SALG2      ----------------------------------------------------------------------
ARNC_SALEP      ----------------------------------------------------------------------
ARNC_SALDC      ----------------------------------------------------------------------
ARNC_PSEA7      ----------------------------------------------------------------------
Y544_METJA      ----------------------------------------------------------------------
DPM1_USTMA      ----------------------------------------------------------------------
ARNC_SALTY      ----------------------------------------------------------------------
ARNC_SALTI      ----------------------------------------------------------------------
ARNC_SALSV      ----------------------------------------------------------------------
ARNC_SALPC      ----------------------------------------------------------------------
ARNC_SALPB      ----------------------------------------------------------------------
ARNC_SALNS      ----------------------------------------------------------------------
ARNC_SALHS      ----------------------------------------------------------------------
ARNC_SALCH      ----------------------------------------------------------------------
ARNC_SALA4      ----------------------------------------------------------------------
ARNC_PSEAE      ----------------------------------------------------------------------
ARNC_PSEAB      ----------------------------------------------------------------------
ARNC_PSEA8      ----------------------------------------------------------------------
WAAE_KLEPN      ----------------------------------------------------------------------
ARNC_PSEF5      ----------------------------------------------------------------------
ARNC_SODGM      ----------------------------------------------------------------------
ALG5_YEAST      ----------------------------------------------------------------------
EXOA_RHIME      ----------------------------------------------------------------------
ARNC_WIGBR      ----------------------------------------------------------------------
ALG5_DICDI      ----------------------------------------------------------------------
ALG5_HUMAN      ----------------------------------------------------------------------
Y653_HAEIN      ----------------------------------------------------------------------
ARNC_KLEP7      ----------------------------------------------------------------------
ARNC_KLEP3      ----------------------------------------------------------------------
ICAA_STAAR      ----------------------------------------------------------------------
ICAA_STAAN      ----------------------------------------------------------------------
ICAA_STAAM      ----------------------------------------------------------------------
ICAA_STAAC      ----------------------------------------------------------------------
ICAA_STAA8      ----------------------------------------------------------------------
GLTR1_MYCTU     ----------------------------------------------------------------------
GLTR1_MYCTA     ----------------------------------------------------------------------
GLTR1_MYCBP     ----------------------------------------------------------------------
GLTR1_MYCBO     ----------------------------------------------------------------------
EPSE_BACSU      ----------------------------------------------------------------------
ICAA_STAAW      ----------------------------------------------------------------------
ICAA_STAAS      ----------------------------------------------------------------------
Y075_MYCPN      ----------------------------------------------------------------------
TAGX_STAAW      ----------------------------------------------------------------------
TAGX_STAAS      ----------------------------------------------------------------------
TAGX_STAAR      ----------------------------------------------------------------------
TAGX_STAAN      ----------------------------------------------------------------------
TAGX_STAAM      ----------------------------------------------------------------------
ALG5_SCHPO      ----------------------------------------------------------------------
YIBD_ECOLI      ----------------------------------------------------------------------
Y501_SYNY3      ----------------------------------------------------------------------
TAGX_STAAC      ----------------------------------------------------------------------
TAGX_STAA8      ----------------------------------------------------------------------
PUR7_SULAC      ----------------------------------------------------------------------
GPPA_SALAR      ----------------------------------------------------------------------
Y2836_ANASP     ----------------------------------------------------------------------
GPPA_ERWT9      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Y553_MYCBO      --------------------------------------------
Y539_MYCTU      --------------------------------------------
Y1222_METJA     --------------------------------------------
DPM1_DROME      --------------------------------------------
DPM1_SCHPO      --------------------------------------------
DPM1_BOVIN      --------------------------------------------
DPM1_MOUSE      --------------------------------------------
DPM1_HUMAN      --------------------------------------------
DPM1_PIG        --------------------------------------------
DPM1_DICDI      --------------------------------------------
ARNC_YERE8      --------------------------------------------
ARNC_EDWI9      --------------------------------------------
ARNC_YERPY      --------------------------------------------
ARNC_YERPS      --------------------------------------------
ARNC_YERPP      --------------------------------------------
ARNC_YERPB      --------------------------------------------
ARNC_PECCP      --------------------------------------------
ARNC_ESCF3      --------------------------------------------
ARNC_ECOUT      --------------------------------------------
ARNC_ECOL6      --------------------------------------------
ARNC_ECOL5      --------------------------------------------
ARNC_ECOK1      --------------------------------------------
ARNC_ECO81      --------------------------------------------
ARNC_ECO45      --------------------------------------------
ARNC_ECO27      --------------------------------------------
ARNC_YERPN      --------------------------------------------
ARNC_YERPG      --------------------------------------------
ARNC_YERPE      --------------------------------------------
ARNC_YERPA      --------------------------------------------
ARNC_ERWCT      --------------------------------------------
ARNC_ECOSM      --------------------------------------------
ARNC_PSEU2      --------------------------------------------
ARNC_SERP5      --------------------------------------------
ARNC_PSE14      --------------------------------------------
ARNC_ERWT9      --------------------------------------------
ARNC_ENT38      --------------------------------------------
ARNC_PSEPF      --------------------------------------------
ARNC_ECO7I      --------------------------------------------
ARNC_AERHH      --------------------------------------------
ARNC_SHISS      --------------------------------------------
ARNC_SHIFL      --------------------------------------------
ARNC_SHIDS      --------------------------------------------
ARNC_SHIBS      --------------------------------------------
ARNC_ECOSE      --------------------------------------------
ARNC_ECOLU      --------------------------------------------
ARNC_ECOLI      --------------------------------------------
ARNC_ECOLC      --------------------------------------------
ARNC_ECOHS      --------------------------------------------
ARNC_ECODH      --------------------------------------------
ARNC_ECOBW      --------------------------------------------
ARNC_ECO8A      --------------------------------------------
ARNC_ECO5E      --------------------------------------------
ARNC_ECO57      --------------------------------------------
ARNC_ECO55      --------------------------------------------
ARNC_ECO24      --------------------------------------------
ARNC_AERS4      --------------------------------------------
RFBJ_SHIFL      --------------------------------------------
ARNC_SHIF8      --------------------------------------------
ARNC_PHOLL      --------------------------------------------
ARNC_PROMH      --------------------------------------------
ARNC_SHESH      --------------------------------------------
DPM1_YEAST      --------------------------------------------
DPM1_CRIGR      --------------------------------------------
ARNC_PSEFS      --------------------------------------------
YAIP_ECOLI      --------------------------------------------
ARNC_SALPK      --------------------------------------------
ARNC_SALPA      --------------------------------------------
ARNC_SALG2      --------------------------------------------
ARNC_SALEP      --------------------------------------------
ARNC_SALDC      --------------------------------------------
ARNC_PSEA7      --------------------------------------------
Y544_METJA      --------------------------------------------
DPM1_USTMA      --------------------------------------------
ARNC_SALTY      --------------------------------------------
ARNC_SALTI      --------------------------------------------
ARNC_SALSV      --------------------------------------------
ARNC_SALPC      --------------------------------------------
ARNC_SALPB      --------------------------------------------
ARNC_SALNS      --------------------------------------------
ARNC_SALHS      --------------------------------------------
ARNC_SALCH      --------------------------------------------
ARNC_SALA4      --------------------------------------------
ARNC_PSEAE      --------------------------------------------
ARNC_PSEAB      --------------------------------------------
ARNC_PSEA8      --------------------------------------------
WAAE_KLEPN      --------------------------------------------
ARNC_PSEF5      --------------------------------------------
ARNC_SODGM      --------------------------------------------
ALG5_YEAST      --------------------------------------------
EXOA_RHIME      --------------------------------------------
ARNC_WIGBR      --------------------------------------------
ALG5_DICDI      --------------------------------------------
ALG5_HUMAN      --------------------------------------------
Y653_HAEIN      --------------------------------------------
ARNC_KLEP7      --------------------------------------------
ARNC_KLEP3      --------------------------------------------
ICAA_STAAR      --------------------------------------------
ICAA_STAAN      --------------------------------------------
ICAA_STAAM      --------------------------------------------
ICAA_STAAC      --------------------------------------------
ICAA_STAA8      --------------------------------------------
GLTR1_MYCTU     --------------------------------------------
GLTR1_MYCTA     --------------------------------------------
GLTR1_MYCBP     --------------------------------------------
GLTR1_MYCBO     --------------------------------------------
EPSE_BACSU      --------------------------------------------
ICAA_STAAW      --------------------------------------------
ICAA_STAAS      --------------------------------------------
Y075_MYCPN      --------------------------------------------
TAGX_STAAW      --------------------------------------------
TAGX_STAAS      --------------------------------------------
TAGX_STAAR      --------------------------------------------
TAGX_STAAN      --------------------------------------------
TAGX_STAAM      --------------------------------------------
ALG5_SCHPO      --------------------------------------------
YIBD_ECOLI      --------------------------------------------
Y501_SYNY3      --------------------------------------------
TAGX_STAAC      --------------------------------------------
TAGX_STAA8      --------------------------------------------
PUR7_SULAC      --------------------------------------------
GPPA_SALAR      --------------------------------------------
Y2836_ANASP     --------------------------------------------
GPPA_ERWT9      --------------------------------------------