[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL62997.1

[Show Plain Result]


## Summary of Sequence Search
    1::379
   35::445     8e-26  31%  469 aa  NSUN6_HUMAN RecName: Full=Putative methyltransferase NSUN6;        
   35::381     4e-24  31%  476 aa  NSUN6_MOUSE RecName: Full=Putative methyltransferase NSUN6;        
  359::582     6e-20  37%  812 aa  NOP2_HUMAN RecName: Full=Putative ribosomal RNA methyltransferase
  344::567     1e-19  36%  793 aa  NOP2_MOUSE RecName: Full=Putative ribosomal RNA methyltransferase
  314::542     8e-18  36%  608 aa  NOP2_SCHPO RecName: Full=Putative ribosomal RNA methyltransferase
  219::446     5e-16  38%  446 aa  RSMB_SYNY3 RecName: Full=Ribosomal RNA small subunit
  320::544     8e-15  37%  618 aa  NOP2_YEAST RecName: Full=Putative ribosomal RNA methyltransferase
  236::444     3e-13  32%  447 aa  RSMB_BACSU RecName: Full=Ribosomal RNA small subunit
   69::305     4e-13  37%  486 aa  RSMF_SHELP RecName: Full=Ribosomal RNA small subunit
  154::384     1e-12  24%  430 aa  RSMB_COXBU RecName: Full=Ribosomal RNA small subunit
  251::424     3e-12  36%  433 aa  RSMB_SODGM RecName: Full=Ribosomal RNA small subunit
   69::305     8e-12  34%  474 aa  RSMF_SHEPW RecName: Full=Ribosomal RNA small subunit
  220::426     1e-11  31%  431 aa  RSMB_KLEP7 RecName: Full=Ribosomal RNA small subunit
   82::308     1e-11  30%  473 aa  RSMF_ALISL RecName: Full=Ribosomal RNA small subunit
   73::302     2e-11  33%  478 aa  RSMF_SHESH RecName: Full=Ribosomal RNA small subunit
  220::426     2e-11  32%  431 aa  RSMB_KLEP3 RecName: Full=Ribosomal RNA small subunit
   82::308     3e-11  29%  473 aa  RSMF_VIBF1 RecName: Full=Ribosomal RNA small subunit
   85::315     4e-11  29%  478 aa  RSMF_SERP5 RecName: Full=Ribosomal RNA small subunit
  251::426     4e-11  33%  429 aa  RSMB_YERE8 RecName: Full=Ribosomal RNA small subunit
  220::419     4e-11  29%  422 aa  RSMB_PROMH RecName: Full=Ribosomal RNA small subunit
   84::316     5e-11  33%  478 aa  RSMF_ERWT9 RecName: Full=Ribosomal RNA small subunit
   86::316     5e-11  32%  484 aa  RSMF_ERWCT RecName: Full=Ribosomal RNA small subunit
   86::309     7e-11  32%  477 aa  RSMF_KLEP7 RecName: Full=Ribosomal RNA small subunit
  220::426     7e-11  31%  429 aa  RSMB_SALAR RecName: Full=Ribosomal RNA small subunit
   72::313     9e-11  29%  473 aa  RSMF_VIBCM RecName: Full=Ribosomal RNA small subunit
   72::313     9e-11  29%  473 aa  RSMF_VIBCH RecName: Full=Ribosomal RNA small subunit
   46::224     1e-10  31%  274 aa  Y026_METJA RecName: Full=Putative methyltransferase MJ0026;        
   68::312     1e-10  37%  479 aa  RSMF_SHEHH RecName: Full=Ribosomal RNA small subunit
  214::404     1e-10  35%  436 aa  RSMB_PSEPK RecName: Full=Ribosomal RNA small subunit
   82::308     2e-10  29%  473 aa  RSMF_VIBFM RecName: Full=Ribosomal RNA small subunit
   86::309     2e-10  33%  479 aa  RSMF_SALTY RecName: Full=Ribosomal RNA small subunit
   86::309     2e-10  33%  479 aa  RSMF_SALTI RecName: Full=Ribosomal RNA small subunit
   86::309     2e-10  33%  479 aa  RSMF_SALSV RecName: Full=Ribosomal RNA small subunit
   86::309     2e-10  33%  479 aa  RSMF_SALPC RecName: Full=Ribosomal RNA small subunit
   86::309     2e-10  33%  479 aa  RSMF_SALPB RecName: Full=Ribosomal RNA small subunit
   86::309     2e-10  33%  479 aa  RSMF_SALNS RecName: Full=Ribosomal RNA small subunit
   86::309     2e-10  33%  479 aa  RSMF_SALCH RecName: Full=Ribosomal RNA small subunit
   86::316     2e-10  32%  484 aa  RSMF_PECCP RecName: Full=Ribosomal RNA small subunit
  222::430     2e-10  30%  434 aa  RSMB_VIBCH RecName: Full=Ribosomal RNA small subunit
  204::423     2e-10  30%  428 aa  RSMB_SHEON RecName: Full=Ribosomal RNA small subunit
   79::309     2e-10  33%  481 aa  RSMF_SHESM RecName: Full=Ribosomal RNA small subunit
   86::309     2e-10  33%  479 aa  RSMF_SALPK RecName: Full=Ribosomal RNA small subunit
   86::309     2e-10  33%  479 aa  RSMF_SALPA RecName: Full=Ribosomal RNA small subunit
   86::309     2e-10  33%  479 aa  RSMF_SALHS RecName: Full=Ribosomal RNA small subunit
   86::309     2e-10  33%  479 aa  RSMF_SALG2 RecName: Full=Ribosomal RNA small subunit
   86::309     2e-10  33%  479 aa  RSMF_SALEP RecName: Full=Ribosomal RNA small subunit
   86::309     2e-10  33%  479 aa  RSMF_SALDC RecName: Full=Ribosomal RNA small subunit
   72::309     2e-10  31%  481 aa  RSMF_PSYIN RecName: Full=Ribosomal RNA small subunit
   86::315     2e-10  30%  479 aa  RSMF_ECOUT RecName: Full=Ribosomal RNA small subunit
   86::315     2e-10  30%  479 aa  RSMF_ECOK1 RecName: Full=Ribosomal RNA small subunit
   86::315     2e-10  30%  479 aa  RSMF_ECO45 RecName: Full=Ribosomal RNA small subunit
   76::309     2e-10  30%  479 aa  RSMF_CITK8 RecName: Full=Ribosomal RNA small subunit
  251::424     2e-10  34%  429 aa  RSMB_YERPY RecName: Full=Ribosomal RNA small subunit
  251::424     2e-10  34%  429 aa  RSMB_YERPS RecName: Full=Ribosomal RNA small subunit
  251::424     2e-10  34%  429 aa  RSMB_YERPP RecName: Full=Ribosomal RNA small subunit
  251::424     2e-10  34%  429 aa  RSMB_YERPN RecName: Full=Ribosomal RNA small subunit
  251::424     2e-10  34%  429 aa  RSMB_YERPG RecName: Full=Ribosomal RNA small subunit
  251::424     2e-10  34%  429 aa  RSMB_YERPE RecName: Full=Ribosomal RNA small subunit
  251::424     2e-10  34%  429 aa  RSMB_YERPB RecName: Full=Ribosomal RNA small subunit
  251::424     2e-10  34%  429 aa  RSMB_YERPA RecName: Full=Ribosomal RNA small subunit
  251::424     2e-10  34%  429 aa  RSMB_YERP3 RecName: Full=Ribosomal RNA small subunit
  251::426     2e-10  32%  429 aa  RSMB_SHIB3 RecName: Full=Ribosomal RNA small subunit
  220::426     2e-10  31%  429 aa  RSMB_SALPK RecName: Full=Ribosomal RNA small subunit
  220::426     2e-10  31%  429 aa  RSMB_SALPA RecName: Full=Ribosomal RNA small subunit
  251::426     2e-10  32%  429 aa  RSMB_ECO27 RecName: Full=Ribosomal RNA small subunit
   86::315     3e-10  30%  479 aa  RSMF_SHIDS RecName: Full=Ribosomal RNA small subunit
   79::309     3e-10  31%  474 aa  RSMF_SHEON RecName: Full=Ribosomal RNA small subunit
   73::313     3e-10  29%  505 aa  RSMF_SHEDO RecName: Full=Ribosomal RNA small subunit
   82::303     3e-10  32%  467 aa  RSMF_SHEAM RecName: Full=Ribosomal RNA small subunit
   86::309     3e-10  30%  477 aa  RSMF_KLEP3 RecName: Full=Ribosomal RNA small subunit
  197::429     3e-10  30%  465 aa  NSUN5_MOUSE RecName: Full=Putative methyltransferase NSUN5;        
   86::309     3e-10  31%  479 aa  RSMF_SALA4 RecName: Full=Ribosomal RNA small subunit
  251::426     3e-10  32%  429 aa  RSMB_SHISS RecName: Full=Ribosomal RNA small subunit
  251::426     3e-10  32%  429 aa  RSMB_ESCF3 RecName: Full=Ribosomal RNA small subunit
   79::309     5e-10  32%  482 aa  RSMF_SHESR RecName: Full=Ribosomal RNA small subunit
   79::309     5e-10  32%  482 aa  RSMF_SHESA RecName: Full=Ribosomal RNA small subunit
  220::426     5e-10  30%  429 aa  RSMB_SALTY RecName: Full=Ribosomal RNA small subunit
  220::426     5e-10  30%  429 aa  RSMB_SALNS RecName: Full=Ribosomal RNA small subunit
  220::426     5e-10  31%  429 aa  RSMB_SALDC RecName: Full=Ribosomal RNA small subunit
  251::426     5e-10  32%  429 aa  RSMB_ECOLU RecName: Full=Ribosomal RNA small subunit
  251::426     5e-10  32%  429 aa  RSMB_ECOLI RecName: Full=Ribosomal RNA small subunit
  251::426     5e-10  32%  429 aa  RSMB_ECOLC RecName: Full=Ribosomal RNA small subunit
  251::426     5e-10  32%  429 aa  RSMB_ECOHS RecName: Full=Ribosomal RNA small subunit
  251::426     5e-10  32%  429 aa  RSMB_ECODH RecName: Full=Ribosomal RNA small subunit
  251::426     5e-10  32%  429 aa  RSMB_ECOBW RecName: Full=Ribosomal RNA small subunit
   79::314     6e-10  33%  486 aa  RSMF_SHEB9 RecName: Full=Ribosomal RNA small subunit
   86::315     6e-10  30%  479 aa  RSMF_ECO5E RecName: Full=Ribosomal RNA small subunit
   86::315     6e-10  30%  479 aa  RSMF_ECO57 RecName: Full=Ribosomal RNA small subunit
  248::426     6e-10  29%  427 aa  RSMB_VIBPA RecName: Full=Ribosomal RNA small subunit
  251::426     6e-10  32%  429 aa  RSMB_SHIDS RecName: Full=Ribosomal RNA small subunit
  251::426     6e-10  32%  429 aa  RSMB_SHIBS RecName: Full=Ribosomal RNA small subunit
  251::426     6e-10  32%  429 aa  RSMB_ECOUT RecName: Full=Ribosomal RNA small subunit
  251::426     6e-10  32%  429 aa  RSMB_ECOSM RecName: Full=Ribosomal RNA small subunit
  251::426     6e-10  32%  429 aa  RSMB_ECOSE RecName: Full=Ribosomal RNA small subunit
  251::426     6e-10  32%  429 aa  RSMB_ECOK1 RecName: Full=Ribosomal RNA small subunit
  251::426     6e-10  32%  429 aa  RSMB_ECO8A RecName: Full=Ribosomal RNA small subunit
  251::426     6e-10  32%  429 aa  RSMB_ECO5E RecName: Full=Ribosomal RNA small subunit
  251::426     6e-10  32%  429 aa  RSMB_ECO57 RecName: Full=Ribosomal RNA small subunit
  251::426     6e-10  32%  429 aa  RSMB_ECO55 RecName: Full=Ribosomal RNA small subunit
  251::426     6e-10  32%  429 aa  RSMB_ECO45 RecName: Full=Ribosomal RNA small subunit
  251::426     6e-10  32%  429 aa  RSMB_ECO24 RecName: Full=Ribosomal RNA small subunit
   86::315     8e-10  30%  479 aa  RSMF_SHISS RecName: Full=Ribosomal RNA small subunit
   86::315     8e-10  30%  479 aa  RSMF_SHIBS RecName: Full=Ribosomal RNA small subunit
   86::315     8e-10  30%  479 aa  RSMF_SHIB3 RecName: Full=Ribosomal RNA small subunit
   79::305     8e-10  33%  478 aa  RSMF_SHEWM RecName: Full=Ribosomal RNA small subunit
   79::314     8e-10  34%  486 aa  RSMF_SHEB2 RecName: Full=Ribosomal RNA small subunit
   86::315     8e-10  29%  479 aa  RSMF_ECOSE RecName: Full=Ribosomal RNA small subunit
   86::315     8e-10  30%  479 aa  RSMF_ECOLI RecName: Full=Ribosomal RNA small subunit
   86::315     8e-10  28%  479 aa  RSMF_ECOL5 RecName: Full=Ribosomal RNA small subunit
   86::315     8e-10  30%  479 aa  RSMF_ECODH RecName: Full=Ribosomal RNA small subunit
   86::315     8e-10  30%  479 aa  RSMF_ECOBW RecName: Full=Ribosomal RNA small subunit
   86::315     8e-10  29%  479 aa  RSMF_ECO8A RecName: Full=Ribosomal RNA small subunit
   86::315     8e-10  30%  479 aa  RSMF_ECO7I RecName: Full=Ribosomal RNA small subunit
   86::315     8e-10  29%  479 aa  RSMF_ECO55 RecName: Full=Ribosomal RNA small subunit
   86::315     8e-10  29%  479 aa  RSMF_ECO24 RecName: Full=Ribosomal RNA small subunit
  220::426     8e-10  30%  429 aa  RSMB_SALTI RecName: Full=Ribosomal RNA small subunit
  220::426     8e-10  30%  429 aa  RSMB_SALPC RecName: Full=Ribosomal RNA small subunit
  220::426     8e-10  30%  429 aa  RSMB_SALHS RecName: Full=Ribosomal RNA small subunit
  220::426     8e-10  30%  429 aa  RSMB_SALG2 RecName: Full=Ribosomal RNA small subunit
  220::426     8e-10  30%  429 aa  RSMB_SALEP RecName: Full=Ribosomal RNA small subunit
  220::426     8e-10  30%  429 aa  RSMB_SALCH RecName: Full=Ribosomal RNA small subunit
  251::426     8e-10  32%  429 aa  RSMB_ECOL6 RecName: Full=Ribosomal RNA small subunit
  251::426     8e-10  32%  429 aa  RSMB_ECO81 RecName: Full=Ribosomal RNA small subunit
  251::426     8e-10  32%  429 aa  RSMB_ECO7I RecName: Full=Ribosomal RNA small subunit
   75::308     1e-09  30%  476 aa  RSMF_PHOPR RecName: Full=Ribosomal RNA small subunit
   86::315     1e-09  30%  479 aa  RSMF_ECOSM RecName: Full=Ribosomal RNA small subunit
   86::315     1e-09  30%  479 aa  RSMF_ECO81 RecName: Full=Ribosomal RNA small subunit
   86::315     1e-09  30%  479 aa  RSMF_ECO27 RecName: Full=Ribosomal RNA small subunit
  214::422     1e-09  29%  426 aa  RSMB_VIBVY RecName: Full=Ribosomal RNA small subunit
   79::314     1e-09  32%  486 aa  RSMF_SHEB8 RecName: Full=Ribosomal RNA small subunit
   86::309     1e-09  33%  479 aa  RSMF_SALAR RecName: Full=Ribosomal RNA small subunit
   87::310     1e-09  28%  480 aa  RSMF_ENTS8 RecName: Full=Ribosomal RNA small subunit
   86::257     1e-09  32%  480 aa  RSMF_ENT38 RecName: Full=Ribosomal RNA small subunit
   86::315     1e-09  30%  479 aa  RSMF_ECOLU RecName: Full=Ribosomal RNA small subunit
   86::315     1e-09  30%  479 aa  RSMF_ECOLC RecName: Full=Ribosomal RNA small subunit
   86::315     1e-09  30%  479 aa  RSMF_ECOL6 RecName: Full=Ribosomal RNA small subunit
   86::315     1e-09  30%  479 aa  RSMF_ECOHS RecName: Full=Ribosomal RNA small subunit
  214::422     1e-09  29%  426 aa  RSMB_VIBVU RecName: Full=Ribosomal RNA small subunit
  220::426     1e-09  28%  429 aa  RSMB_PHOLL RecName: Full=Ribosomal RNA small subunit
  168::422     1e-09  29%  429 aa  NSUN5_HUMAN RecName: Full=Putative methyltransferase NSUN5;        
   86::315     2e-09  28%  479 aa  RSMF_ESCF3 RecName: Full=Ribosomal RNA small subunit
   84::309     2e-09  30%  475 aa  RSMF_AERHH RecName: Full=Ribosomal RNA small subunit
  251::426     2e-09  31%  429 aa  RSMB_SHIFL RecName: Full=Ribosomal RNA small subunit
  220::426     2e-09  30%  429 aa  RSMB_SALSV RecName: Full=Ribosomal RNA small subunit
  190::428     2e-09  28%  434 aa  RSMB_PSEAE RecName: Full=Ribosomal RNA small subunit
  252::431     2e-09  35%  435 aa  RSMB_HAEDU RecName: Full=Ribosomal RNA small subunit
  251::426     2e-09  31%  429 aa  RSMB_ECOL5 RecName: Full=Ribosomal RNA small subunit
  180::377     3e-09  33%  455 aa  YEY6_SCHPO RecName: Full=Putative methyltransferase C2C4.06c;      
   79::316     3e-09  36%  488 aa  RSMF_SHEPA RecName: Full=Ribosomal RNA small subunit
   79::303     3e-09  33%  484 aa  RSMF_SHEFN RecName: Full=Ribosomal RNA small subunit
   79::314     3e-09  32%  486 aa  RSMF_SHEB5 RecName: Full=Ribosomal RNA small subunit
   84::315     3e-09  29%  476 aa  RSMF_AERS4 RecName: Full=Ribosomal RNA small subunit
  251::426     3e-09  31%  429 aa  RSMB_SHIF8 RecName: Full=Ribosomal RNA small subunit
  220::426     3e-09  30%  429 aa  RSMB_SALA4 RecName: Full=Ribosomal RNA small subunit
   79::314     4e-09  33%  486 aa  RSMF_SHESW RecName: Full=Ribosomal RNA small subunit
   79::314     4e-09  33%  486 aa  RSMF_SHEPC RecName: Full=Ribosomal RNA small subunit
  251::426     4e-09  35%  429 aa  RSMB_ERWCT RecName: Full=Ribosomal RNA small subunit
   72::307     5e-09  31%  478 aa  RSMF_VIBPA RecName: Full=Ribosomal RNA small subunit
  211::432     5e-09  25%  436 aa  RSMB_XANAC RecName: Full=Ribosomal RNA small subunit
  251::426     5e-09  34%  429 aa  RSMB_PECCP RecName: Full=Ribosomal RNA small subunit
  251::414     6e-09  32%  429 aa  RSMB_ENTS8 RecName: Full=Ribosomal RNA small subunit
  227::442     8e-09  29%  446 aa  RSMB_PASMU RecName: Full=Ribosomal RNA small subunit
  250::425     1e-08  31%  428 aa  RSMB_CITK8 RecName: Full=Ribosomal RNA small subunit
   72::307     2e-08  29%  478 aa  RSMF_VIBHB RecName: Full=Ribosomal RNA small subunit
  136::434     2e-08  33%  746 aa  NSUN2_DROME RecName: Full=tRNA (cytosine-5-)-methyltransferase
   86::315     4e-08  29%  479 aa  RSMF_SHIFL RecName: Full=Putative ribosomal RNA small subunit
   86::315     4e-08  29%  479 aa  RSMF_SHIF8 RecName: Full=Ribosomal RNA small subunit
   72::307     7e-08  31%  472 aa  RSMF_VIBVY RecName: Full=Ribosomal RNA small subunit
   72::307     7e-08  31%  472 aa  RSMF_VIBVU RecName: Full=Ribosomal RNA small subunit
   72::307     7e-08  29%  473 aa  RSMF_VIBSL RecName: Full=Ribosomal RNA small subunit
  250::425     9e-08  33%  428 aa  RSMB_ENT38 RecName: Full=Ribosomal RNA small subunit
  219::426     1e-07  30%  429 aa  RSMB_SERP5 RecName: Full=Ribosomal RNA small subunit
  214::433     1e-07  27%  448 aa  RSMB_PSESM RecName: Full=Ribosomal RNA small subunit
  229::446     2e-07  26%  451 aa  RSMB_HAEIN RecName: Full=Ribosomal RNA small subunit
  251::426     2e-07  34%  429 aa  RSMB_ERWT9 RecName: Full=Ribosomal RNA small subunit
   87::268     3e-07  32%  482 aa  RSMF_PSEHT RecName: Full=Ribosomal RNA small subunit
  207::417     4e-07  27%  421 aa  RSMB_XYLFA RecName: Full=Ribosomal RNA small subunit
  148::398     6e-07  36%  654 aa  NCL1_SCHPO RecName: Full=tRNA (cytosine-5-)-methyltransferase ncl1;
  272::332     8e-07  37%  348 aa  TRUB_NANEQ RecName: Full=Probable tRNA pseudouridine synthase B;   
  215::425     2e-06  26%  431 aa  RSMB_XYLFT RecName: Full=Ribosomal RNA small subunit
  220::426     2e-06  28%  429 aa  RSMB_SALPB RecName: Full=Ribosomal RNA small subunit
  666::795     5e-06  30%  853 aa  TGS1_MOUSE RecName: Full=Trimethylguanosine synthase;       
  668::797     7e-06  30%  850 aa  TGS1_RAT RecName: Full=Trimethylguanosine synthase;       
  170::407     7e-06  34%  684 aa  NCL1_YEAST RecName: Full=tRNA (cytosine-5-)-methyltransferase NCL1;
  259::433     1e-05  26%  437 aa  RSMB_XANCP RecName: Full=Ribosomal RNA small subunit
  161::223     1e-05  30%  237 aa  TRUB_SULTO RecName: Full=Probable tRNA pseudouridine synthase B;   
  275::404     1e-05  37%  406 aa  NSUN4_XENTR RecName: Full=Putative methyltransferase NSUN4;        
  262::322     2e-05  38%  334 aa  TRUB_THEGJ RecName: Full=Probable tRNA pseudouridine synthase B;   
  674::803     3e-05  29%  853 aa  TGS1_HUMAN RecName: Full=Trimethylguanosine synthase;       
  262::322     3e-05  38%  338 aa  TRUB_PYRKO RecName: Full=Probable tRNA pseudouridine synthase B;   
  181::427     3e-05  37%  796 aa  NSUN2_CHICK RecName: Full=tRNA (cytosine-5-)-methyltransferase
  262::322     4e-05  40%  340 aa  TRUB_PYRFU RecName: Full=Probable tRNA pseudouridine synthase B;   
  262::322     7e-05  37%  334 aa  TRUB_PYRHO RecName: Full=Probable tRNA pseudouridine synthase B;   
  258::321     7e-05  35%  338 aa  TRUB_METKA RecName: Full=Probable tRNA pseudouridine synthase B;   
  275::346     7e-05  36%  406 aa  NSUN4_XENLA RecName: Full=Putative methyltransferase NSUN4;        
  179::234     1e-04  32%  251 aa  TRUB_SULSO RecName: Full=Probable tRNA pseudouridine synthase B;   
  262::322     1e-04  35%  334 aa  TRUB_PYRAB RecName: Full=Probable tRNA pseudouridine synthase B;   
  175::321     1e-04  28%  381 aa  NSUN4_MOUSE RecName: Full=Putative methyltransferase NSUN4;        
  259::320     2e-04  31%  336 aa  TRUB_METJA RecName: Full=Probable tRNA pseudouridine synthase B;   
  225::250     2e-04  69%  364 aa  RRMT_AZOSB RecName: Full=Putative RNA 2'-O-ribose methyltransferase
  136::278     2e-04  34%  340 aa  NSUN3_HUMAN RecName: Full=Putative methyltransferase NSUN3;        
  249::314     3e-04  32%  331 aa  TRUB_PYRAR RecName: Full=Probable tRNA pseudouridine synthase B;   
  119::278     3e-04  33%  348 aa  NSUN3_MOUSE RecName: Full=Putative methyltransferase NSUN3;        
  165::319     4e-04  30%  367 aa  NSUN3_DANRE RecName: Full=Putative methyltransferase NSUN3;        
  137::279     4e-04  34%  338 aa  NSUN3_BOVIN RecName: Full=Putative methyltransferase NSUN3;        
  253::313     6e-04  43%  314 aa  TRUB_HALMA RecName: Full=Probable tRNA pseudouridine synthase B;   
  280::342     6e-04  27%  481 aa  CBF5_EMENI RecName: Full=Centromere/microtubule-binding protein
   33::121     8e-04  28%  241 aa  CMOA_PASMU RecName: Full=tRNA (cmo5U34)-methyltransferase;       
   25::75      6e-04  35%  486 aa  RSMF_SHELP RecName: Full=Ribosomal RNA small subunit(query 29->79)
   28::78      8e-04  35%  478 aa  RSMF_VIBPA RecName: Full=Ribosomal RNA small subunit(query 29->79)
    1::379

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxSDAEIDSLFRSITTPPPRYYIRVNTLKISPRELVKRLNSRGLAVYRDEYI
NSUN6_HUMAN     --------------------AERKFETLLKHLSHPPSFTTVRVNTHLASVQELQKQFNGLSVPILQHPDL
NSUN6_MOUSE     --------------------AERKFETLLLRLSHPPSMTTVRVNTHLGSVQELQKQFGESSIPVVQHPAL
NOP2_HUMAN      ----------------------------------------------------------------------
NOP2_MOUSE      ----------------------------------------------------------------------
NOP2_SCHPO      ----------------------------------------------------------------------
RSMB_SYNY3      ----------------------------------------------------------------------
NOP2_YEAST      ----------------------------------------------------------------------
RSMB_BACSU      ----------------------------------------------------------------------
RSMF_SHELP      ----------------------------------------------------------------------
RSMB_COXBU      ----------------------------------------------------------------------
RSMB_SODGM      ----------------------------------------------------------------------
RSMF_SHEPW      ----------------------------------------------------------------------
RSMB_KLEP7      ----------------------------------------------------------------------
RSMF_ALISL      ----------------------------------------------------------------------
RSMF_SHESH      ----------------------------------------------------------------------
RSMB_KLEP3      ----------------------------------------------------------------------
RSMF_VIBF1      ----------------------------------------------------------------------
RSMF_SERP5      ----------------------------------------------------------------------
RSMB_YERE8      ----------------------------------------------------------------------
RSMB_PROMH      ----------------------------------------------------------------------
RSMF_ERWT9      ----------------------------------------------------------------------
RSMF_ERWCT      ----------------------------------------------------------------------
RSMF_KLEP7      ----------------------------------------------------------------------
RSMB_SALAR      ----------------------------------------------------------------------
RSMF_VIBCM      ----------------------------------------------------------------------
RSMF_VIBCH      ----------------------------------------------------------------------
Y026_METJA      ----------------------------------------------------------------------
RSMF_SHEHH      ----------------------------------------------------------------------
RSMB_PSEPK      ----------------------------------------------------------------------
RSMF_VIBFM      ----------------------------------------------------------------------
RSMF_SALTY      ----------------------------------------------------------------------
RSMF_SALTI      ----------------------------------------------------------------------
RSMF_SALSV      ----------------------------------------------------------------------
RSMF_SALPC      ----------------------------------------------------------------------
RSMF_SALPB      ----------------------------------------------------------------------
RSMF_SALNS      ----------------------------------------------------------------------
RSMF_SALCH      ----------------------------------------------------------------------
RSMF_PECCP      ----------------------------------------------------------------------
RSMB_VIBCH      ----------------------------------------------------------------------
RSMB_SHEON      ----------------------------------------------------------------------
RSMF_SHESM      ----------------------------------------------------------------------
RSMF_SALPK      ----------------------------------------------------------------------
RSMF_SALPA      ----------------------------------------------------------------------
RSMF_SALHS      ----------------------------------------------------------------------
RSMF_SALG2      ----------------------------------------------------------------------
RSMF_SALEP      ----------------------------------------------------------------------
RSMF_SALDC      ----------------------------------------------------------------------
RSMF_PSYIN      ----------------------------------------------------------------------
RSMF_ECOUT      ----------------------------------------------------------------------
RSMF_ECOK1      ----------------------------------------------------------------------
RSMF_ECO45      ----------------------------------------------------------------------
RSMF_CITK8      ----------------------------------------------------------------------
RSMB_YERPY      ----------------------------------------------------------------------
RSMB_YERPS      ----------------------------------------------------------------------
RSMB_YERPP      ----------------------------------------------------------------------
RSMB_YERPN      ----------------------------------------------------------------------
RSMB_YERPG      ----------------------------------------------------------------------
RSMB_YERPE      ----------------------------------------------------------------------
RSMB_YERPB      ----------------------------------------------------------------------
RSMB_YERPA      ----------------------------------------------------------------------
RSMB_YERP3      ----------------------------------------------------------------------
RSMB_SHIB3      ----------------------------------------------------------------------
RSMB_SALPK      ----------------------------------------------------------------------
RSMB_SALPA      ----------------------------------------------------------------------
RSMB_ECO27      ----------------------------------------------------------------------
RSMF_SHIDS      ----------------------------------------------------------------------
RSMF_SHEON      ----------------------------------------------------------------------
RSMF_SHEDO      ----------------------------------------------------------------------
RSMF_SHEAM      ----------------------------------------------------------------------
RSMF_KLEP3      ----------------------------------------------------------------------
NSUN5_MOUSE     ----------------------------------------------------------------------
RSMF_SALA4      ----------------------------------------------------------------------
RSMB_SHISS      ----------------------------------------------------------------------
RSMB_ESCF3      ----------------------------------------------------------------------
RSMF_SHESR      ----------------------------------------------------------------------
RSMF_SHESA      ----------------------------------------------------------------------
RSMB_SALTY      ----------------------------------------------------------------------
RSMB_SALNS      ----------------------------------------------------------------------
RSMB_SALDC      ----------------------------------------------------------------------
RSMB_ECOLU      ----------------------------------------------------------------------
RSMB_ECOLI      ----------------------------------------------------------------------
RSMB_ECOLC      ----------------------------------------------------------------------
RSMB_ECOHS      ----------------------------------------------------------------------
RSMB_ECODH      ----------------------------------------------------------------------
RSMB_ECOBW      ----------------------------------------------------------------------
RSMF_SHEB9      ----------------------------------------------------------------------
RSMF_ECO5E      ----------------------------------------------------------------------
RSMF_ECO57      ----------------------------------------------------------------------
RSMB_VIBPA      ----------------------------------------------------------------------
RSMB_SHIDS      ----------------------------------------------------------------------
RSMB_SHIBS      ----------------------------------------------------------------------
RSMB_ECOUT      ----------------------------------------------------------------------
RSMB_ECOSM      ----------------------------------------------------------------------
RSMB_ECOSE      ----------------------------------------------------------------------
RSMB_ECOK1      ----------------------------------------------------------------------
RSMB_ECO8A      ----------------------------------------------------------------------
RSMB_ECO5E      ----------------------------------------------------------------------
RSMB_ECO57      ----------------------------------------------------------------------
RSMB_ECO55      ----------------------------------------------------------------------
RSMB_ECO45      ----------------------------------------------------------------------
RSMB_ECO24      ----------------------------------------------------------------------
RSMF_SHISS      ----------------------------------------------------------------------
RSMF_SHIBS      ----------------------------------------------------------------------
RSMF_SHIB3      ----------------------------------------------------------------------
RSMF_SHEWM      ----------------------------------------------------------------------
RSMF_SHEB2      ----------------------------------------------------------------------
RSMF_ECOSE      ----------------------------------------------------------------------
RSMF_ECOLI      ----------------------------------------------------------------------
RSMF_ECOL5      ----------------------------------------------------------------------
RSMF_ECODH      ----------------------------------------------------------------------
RSMF_ECOBW      ----------------------------------------------------------------------
RSMF_ECO8A      ----------------------------------------------------------------------
RSMF_ECO7I      ----------------------------------------------------------------------
RSMF_ECO55      ----------------------------------------------------------------------
RSMF_ECO24      ----------------------------------------------------------------------
RSMB_SALTI      ----------------------------------------------------------------------
RSMB_SALPC      ----------------------------------------------------------------------
RSMB_SALHS      ----------------------------------------------------------------------
RSMB_SALG2      ----------------------------------------------------------------------
RSMB_SALEP      ----------------------------------------------------------------------
RSMB_SALCH      ----------------------------------------------------------------------
RSMB_ECOL6      ----------------------------------------------------------------------
RSMB_ECO81      ----------------------------------------------------------------------
RSMB_ECO7I      ----------------------------------------------------------------------
RSMF_PHOPR      ----------------------------------------------------------------------
RSMF_ECOSM      ----------------------------------------------------------------------
RSMF_ECO81      ----------------------------------------------------------------------
RSMF_ECO27      ----------------------------------------------------------------------
RSMB_VIBVY      ----------------------------------------------------------------------
RSMF_SHEB8      ----------------------------------------------------------------------
RSMF_SALAR      ----------------------------------------------------------------------
RSMF_ENTS8      ----------------------------------------------------------------------
RSMF_ENT38      ----------------------------------------------------------------------
RSMF_ECOLU      ----------------------------------------------------------------------
RSMF_ECOLC      ----------------------------------------------------------------------
RSMF_ECOL6      ----------------------------------------------------------------------
RSMF_ECOHS      ----------------------------------------------------------------------
RSMB_VIBVU      ----------------------------------------------------------------------
RSMB_PHOLL      ----------------------------------------------------------------------
NSUN5_HUMAN     ----------------------------------------------------------------------
RSMF_ESCF3      ----------------------------------------------------------------------
RSMF_AERHH      ----------------------------------------------------------------------
RSMB_SHIFL      ----------------------------------------------------------------------
RSMB_SALSV      ----------------------------------------------------------------------
RSMB_PSEAE      ----------------------------------------------------------------------
RSMB_HAEDU      ----------------------------------------------------------------------
RSMB_ECOL5      ----------------------------------------------------------------------
YEY6_SCHPO      ----------------------------------------------------------------------
RSMF_SHEPA      ----------------------------------------------------------------------
RSMF_SHEFN      ----------------------------------------------------------------------
RSMF_SHEB5      ----------------------------------------------------------------------
RSMF_AERS4      ----------------------------------------------------------------------
RSMB_SHIF8      ----------------------------------------------------------------------
RSMB_SALA4      ----------------------------------------------------------------------
RSMF_SHESW      ----------------------------------------------------------------------
RSMF_SHEPC      ----------------------------------------------------------------------
RSMB_ERWCT      ----------------------------------------------------------------------
RSMF_VIBPA      ----------------------------------------------------------------------
RSMB_XANAC      ----------------------------------------------------------------------
RSMB_PECCP      ----------------------------------------------------------------------
RSMB_ENTS8      ----------------------------------------------------------------------
RSMB_PASMU      ----------------------------------------------------------------------
RSMB_CITK8      ----------------------------------------------------------------------
RSMF_VIBHB      ----------------------------------------------------------------------
NSUN2_DROME     ----------------------------------------------------------------------
RSMF_SHIFL      ----------------------------------------------------------------------
RSMF_SHIF8      ----------------------------------------------------------------------
RSMF_VIBVY      ----------------------------------------------------------------------
RSMF_VIBVU      ----------------------------------------------------------------------
RSMF_VIBSL      ----------------------------------------------------------------------
RSMB_ENT38      ----------------------------------------------------------------------
RSMB_SERP5      ----------------------------------------------------------------------
RSMB_PSESM      ----------------------------------------------------------------------
RSMB_HAEIN      ----------------------------------------------------------------------
RSMB_ERWT9      ----------------------------------------------------------------------
RSMF_PSEHT      ----------------------------------------------------------------------
RSMB_XYLFA      ----------------------------------------------------------------------
NCL1_SCHPO      ----------------------------------------------------------------------
TRUB_NANEQ      ----------------------------------------------------------------------
RSMB_XYLFT      ----------------------------------------------------------------------
RSMB_SALPB      ----------------------------------------------------------------------
TGS1_MOUSE      ----------------------------------------------------------------------
TGS1_RAT        ----------------------------------------------------------------------
NCL1_YEAST      ----------------------------------------------------------------------
RSMB_XANCP      ----------------------------------------------------------------------
TRUB_SULTO      ----------------------------------------------------------------------
NSUN4_XENTR     ----------------------------------------------------------------------
TRUB_THEGJ      ----------------------------------------------------------------------
TGS1_HUMAN      ----------------------------------------------------------------------
TRUB_PYRKO      ----------------------------------------------------------------------
NSUN2_CHICK     ----------------------------------------------------------------------
TRUB_PYRFU      ----------------------------------------------------------------------
TRUB_PYRHO      ----------------------------------------------------------------------
TRUB_METKA      ----------------------------------------------------------------------
NSUN4_XENLA     ----------------------------------------------------------------------
TRUB_SULSO      ----------------------------------------------------------------------
TRUB_PYRAB      ----------------------------------------------------------------------
NSUN4_MOUSE     ----------------------------------------------------------------------
TRUB_METJA      ----------------------------------------------------------------------
RRMT_AZOSB      ----------------------------------------------------------------------
NSUN3_HUMAN     ----------------------------------------------------------------------
TRUB_PYRAR      ----------------------------------------------------------------------
NSUN3_MOUSE     ----------------------------------------------------------------------
NSUN3_DANRE     ----------------------------------------------------------------------
NSUN3_BOVIN     ----------------------------------------------------------------------
TRUB_HALMA      ----------------------------------------------------------------------
CBF5_EMENI      ----------------------------------------------------------------------
CMOA_PASMU      ----------------------------------------------------------------------
RSMF_SHELP      ----------------------------FISYCAKPLRPSIRVNTLKITTADFITMMNAKGWQFEPVPWC
RSMF_VIBPA      ----------------------------FISACQRPLRKSIRVNTLKMSVEDFVKRAEDKGWTLSPVPWC


                         .         .         *         .         .         .         .:140
query           DDALWVPVEGPFKIPTXXXXXXXXXXXXESVMLGADLYAPAVIKTDRVNIGDEVNIVSDNGRVVALGVAV
NSUN6_HUMAN     QDVLLIPVIGPRKIKKQQCEAIVGAQCGNAVLRGAHVYAPGIVSASQMKAGDVISVYSDDGTKVFLGNGI
NSUN6_MOUSE     PDVLLIPMTGPRKIERQQGEVIVGAQCGNAVLRGAHVYVPGIVSASKMKAGDVISVYSDDGTKVFLGNGI
NOP2_HUMAN      ----------------------------------------------------------------------
NOP2_MOUSE      ----------------------------------------------------------------------
NOP2_SCHPO      ----------------------------------------------------------------------
RSMB_SYNY3      ----------------------------------------------------------------------
NOP2_YEAST      ----------------------------------------------------------------------
RSMB_BACSU      ----------------------------------------------------------------------
RSMF_SHELP      ----------------------------------------------------------------------
RSMB_COXBU      ----------------------------ESILIANNARPPMTLRVNLTKISREIYLE-------------
RSMB_SODGM      ----------------------------------------------------------------------
RSMF_SHEPW      ----------------------------------------------------------------------
RSMB_KLEP7      ----------------------------------------------------------------------
RSMF_ALISL      ----------------------------------------------------------------------
RSMF_SHESH      ----------------------------------------------------------------------
RSMB_KLEP3      ----------------------------------------------------------------------
RSMF_VIBF1      ----------------------------------------------------------------------
RSMF_SERP5      ----------------------------------------------------------------------
RSMB_YERE8      ----------------------------------------------------------------------
RSMB_PROMH      ----------------------------------------------------------------------
RSMF_ERWT9      ----------------------------------------------------------------------
RSMF_ERWCT      ----------------------------------------------------------------------
RSMF_KLEP7      ----------------------------------------------------------------------
RSMB_SALAR      ----------------------------------------------------------------------
RSMF_VIBCM      ----------------------------------------------------------------------
RSMF_VIBCH      ----------------------------------------------------------------------
Y026_METJA      ----------------------------------------------------------------------
RSMF_SHEHH      ----------------------------------------------------------------------
RSMB_PSEPK      ----------------------------------------------------------------------
RSMF_VIBFM      ----------------------------------------------------------------------
RSMF_SALTY      ----------------------------------------------------------------------
RSMF_SALTI      ----------------------------------------------------------------------
RSMF_SALSV      ----------------------------------------------------------------------
RSMF_SALPC      ----------------------------------------------------------------------
RSMF_SALPB      ----------------------------------------------------------------------
RSMF_SALNS      ----------------------------------------------------------------------
RSMF_SALCH      ----------------------------------------------------------------------
RSMF_PECCP      ----------------------------------------------------------------------
RSMB_VIBCH      ----------------------------------------------------------------------
RSMB_SHEON      ----------------------------------------------------------------------
RSMF_SHESM      ----------------------------------------------------------------------
RSMF_SALPK      ----------------------------------------------------------------------
RSMF_SALPA      ----------------------------------------------------------------------
RSMF_SALHS      ----------------------------------------------------------------------
RSMF_SALG2      ----------------------------------------------------------------------
RSMF_SALEP      ----------------------------------------------------------------------
RSMF_SALDC      ----------------------------------------------------------------------
RSMF_PSYIN      ----------------------------------------------------------------------
RSMF_ECOUT      ----------------------------------------------------------------------
RSMF_ECOK1      ----------------------------------------------------------------------
RSMF_ECO45      ----------------------------------------------------------------------
RSMF_CITK8      ----------------------------------------------------------------------
RSMB_YERPY      ----------------------------------------------------------------------
RSMB_YERPS      ----------------------------------------------------------------------
RSMB_YERPP      ----------------------------------------------------------------------
RSMB_YERPN      ----------------------------------------------------------------------
RSMB_YERPG      ----------------------------------------------------------------------
RSMB_YERPE      ----------------------------------------------------------------------
RSMB_YERPB      ----------------------------------------------------------------------
RSMB_YERPA      ----------------------------------------------------------------------
RSMB_YERP3      ----------------------------------------------------------------------
RSMB_SHIB3      ----------------------------------------------------------------------
RSMB_SALPK      ----------------------------------------------------------------------
RSMB_SALPA      ----------------------------------------------------------------------
RSMB_ECO27      ----------------------------------------------------------------------
RSMF_SHIDS      ----------------------------------------------------------------------
RSMF_SHEON      ----------------------------------------------------------------------
RSMF_SHEDO      ----------------------------------------------------------------------
RSMF_SHEAM      ----------------------------------------------------------------------
RSMF_KLEP3      ----------------------------------------------------------------------
NSUN5_MOUSE     ----------------------------------------------------------------------
RSMF_SALA4      ----------------------------------------------------------------------
RSMB_SHISS      ----------------------------------------------------------------------
RSMB_ESCF3      ----------------------------------------------------------------------
RSMF_SHESR      ----------------------------------------------------------------------
RSMF_SHESA      ----------------------------------------------------------------------
RSMB_SALTY      ----------------------------------------------------------------------
RSMB_SALNS      ----------------------------------------------------------------------
RSMB_SALDC      ----------------------------------------------------------------------
RSMB_ECOLU      ----------------------------------------------------------------------
RSMB_ECOLI      ----------------------------------------------------------------------
RSMB_ECOLC      ----------------------------------------------------------------------
RSMB_ECOHS      ----------------------------------------------------------------------
RSMB_ECODH      ----------------------------------------------------------------------
RSMB_ECOBW      ----------------------------------------------------------------------
RSMF_SHEB9      ----------------------------------------------------------------------
RSMF_ECO5E      ----------------------------------------------------------------------
RSMF_ECO57      ----------------------------------------------------------------------
RSMB_VIBPA      ----------------------------------------------------------------------
RSMB_SHIDS      ----------------------------------------------------------------------
RSMB_SHIBS      ----------------------------------------------------------------------
RSMB_ECOUT      ----------------------------------------------------------------------
RSMB_ECOSM      ----------------------------------------------------------------------
RSMB_ECOSE      ----------------------------------------------------------------------
RSMB_ECOK1      ----------------------------------------------------------------------
RSMB_ECO8A      ----------------------------------------------------------------------
RSMB_ECO5E      ----------------------------------------------------------------------
RSMB_ECO57      ----------------------------------------------------------------------
RSMB_ECO55      ----------------------------------------------------------------------
RSMB_ECO45      ----------------------------------------------------------------------
RSMB_ECO24      ----------------------------------------------------------------------
RSMF_SHISS      ----------------------------------------------------------------------
RSMF_SHIBS      ----------------------------------------------------------------------
RSMF_SHIB3      ----------------------------------------------------------------------
RSMF_SHEWM      ----------------------------------------------------------------------
RSMF_SHEB2      ----------------------------------------------------------------------
RSMF_ECOSE      ----------------------------------------------------------------------
RSMF_ECOLI      ----------------------------------------------------------------------
RSMF_ECOL5      ----------------------------------------------------------------------
RSMF_ECODH      ----------------------------------------------------------------------
RSMF_ECOBW      ----------------------------------------------------------------------
RSMF_ECO8A      ----------------------------------------------------------------------
RSMF_ECO7I      ----------------------------------------------------------------------
RSMF_ECO55      ----------------------------------------------------------------------
RSMF_ECO24      ----------------------------------------------------------------------
RSMB_SALTI      ----------------------------------------------------------------------
RSMB_SALPC      ----------------------------------------------------------------------
RSMB_SALHS      ----------------------------------------------------------------------
RSMB_SALG2      ----------------------------------------------------------------------
RSMB_SALEP      ----------------------------------------------------------------------
RSMB_SALCH      ----------------------------------------------------------------------
RSMB_ECOL6      ----------------------------------------------------------------------
RSMB_ECO81      ----------------------------------------------------------------------
RSMB_ECO7I      ----------------------------------------------------------------------
RSMF_PHOPR      ----------------------------------------------------------------------
RSMF_ECOSM      ----------------------------------------------------------------------
RSMF_ECO81      ----------------------------------------------------------------------
RSMF_ECO27      ----------------------------------------------------------------------
RSMB_VIBVY      ----------------------------------------------------------------------
RSMF_SHEB8      ----------------------------------------------------------------------
RSMF_SALAR      ----------------------------------------------------------------------
RSMF_ENTS8      ----------------------------------------------------------------------
RSMF_ENT38      ----------------------------------------------------------------------
RSMF_ECOLU      ----------------------------------------------------------------------
RSMF_ECOLC      ----------------------------------------------------------------------
RSMF_ECOL6      ----------------------------------------------------------------------
RSMF_ECOHS      ----------------------------------------------------------------------
RSMB_VIBVU      ----------------------------------------------------------------------
RSMB_PHOLL      ----------------------------------------------------------------------
NSUN5_HUMAN     ----------------------------------------------------------------------
RSMF_ESCF3      ----------------------------------------------------------------------
RSMF_AERHH      ----------------------------------------------------------------------
RSMB_SHIFL      ----------------------------------------------------------------------
RSMB_SALSV      ----------------------------------------------------------------------
RSMB_PSEAE      ----------------------------------------------------------------------
RSMB_HAEDU      ----------------------------------------------------------------------
RSMB_ECOL5      ----------------------------------------------------------------------
YEY6_SCHPO      ----------------------------------------------------------------------
RSMF_SHEPA      ----------------------------------------------------------------------
RSMF_SHEFN      ----------------------------------------------------------------------
RSMF_SHEB5      ----------------------------------------------------------------------
RSMF_AERS4      ----------------------------------------------------------------------
RSMB_SHIF8      ----------------------------------------------------------------------
RSMB_SALA4      ----------------------------------------------------------------------
RSMF_SHESW      ----------------------------------------------------------------------
RSMF_SHEPC      ----------------------------------------------------------------------
RSMB_ERWCT      ----------------------------------------------------------------------
RSMF_VIBPA      ----------------------------------------------------------------------
RSMB_XANAC      ----------------------------------------------------------------------
RSMB_PECCP      ----------------------------------------------------------------------
RSMB_ENTS8      ----------------------------------------------------------------------
RSMB_PASMU      ----------------------------------------------------------------------
RSMB_CITK8      ----------------------------------------------------------------------
RSMF_VIBHB      ----------------------------------------------------------------------
NSUN2_DROME     ----------------------------------------------------------------------
RSMF_SHIFL      ----------------------------------------------------------------------
RSMF_SHIF8      ----------------------------------------------------------------------
RSMF_VIBVY      ----------------------------------------------------------------------
RSMF_VIBVU      ----------------------------------------------------------------------
RSMF_VIBSL      ----------------------------------------------------------------------
RSMB_ENT38      ----------------------------------------------------------------------
RSMB_SERP5      ----------------------------------------------------------------------
RSMB_PSESM      ----------------------------------------------------------------------
RSMB_HAEIN      ----------------------------------------------------------------------
RSMB_ERWT9      ----------------------------------------------------------------------
RSMF_PSEHT      ----------------------------------------------------------------------
RSMB_XYLFA      ----------------------------------------------------------------------
NCL1_SCHPO      ----------------------------------------------------------------------
TRUB_NANEQ      -----------------------------AIVHGANLAVPGIAKLSNIKKGDLVSIHTLKGELVAIGIAL
RSMB_XYLFT      ----------------------------------------------------------------------
RSMB_SALPB      ----------------------------------------------------------------------
TGS1_MOUSE      ----------------------------------------------------------------------
TGS1_RAT        ----------------------------------------------------------------------
NCL1_YEAST      ----------------------------------------------------------------------
RSMB_XANCP      ----------------------------------------------------------------------
TRUB_SULTO      ----------------------------DAISYGAMLTAPGIVAYQRFRVKDTVAILTLKGELVAIGEAD
NSUN4_XENTR     ----------------------------------------------------------------------
TRUB_THEGJ      -----------------------------AVTHGADLAVPGIVKLHKIKKGDLVAIMTLKDELVALGKAM
TGS1_HUMAN      ----------------------------------------------------------------------
TRUB_PYRKO      -----------------------------AVTHGADLAVPGVVKLHKIKKGDLVAIMTLKDELVALGKAM
NSUN2_CHICK     ----------------------------------------------------------------------
TRUB_PYRFU      -----------------------------AVTHGADLAVPGIAKLHAIKRGDLVAIMTLKDELVALGKAM
TRUB_PYRHO      -----------------------------AVAHGANLTVPGIVKLNGIKRGDLVAIMTLKDELVALGKAM
TRUB_METKA      ----------------------------DAICHGANLAAPGIVRVEKIQPGDLVAIFTLKGEAVALGVAK
NSUN4_XENLA     ----------------------------------------------------------------------
TRUB_SULSO      ---------------------------------GAQLAVPGVVAYQNFKKNDTVAVLTLKGELVATGNAL
TRUB_PYRAB      -----------------------------AVAHGANLTVPGIVKLNAIKKGDLVAIMTLKDELVALGKAM
NSUN4_MOUSE     ----------------------------------------------------------------------
TRUB_METJA      ----------------------------DAICHGADVYVRGIAKLSKIGKGETVLVETLKGEAVAVGKAL
RRMT_AZOSB      ----------------------------------------------------------------------
NSUN3_HUMAN     ----------------------------------------------------------------------
TRUB_PYRAR      ----------------------------DAVCHGAPLAAPGISKFEPFSKGDIVAMFTLKGELVGIGRAL
NSUN3_MOUSE     ----------------------------------------------------------------------
NSUN3_DANRE     ----------------------------------------------------------------------
NSUN3_BOVIN     ----------------------------------------------------------------------
TRUB_HALMA      ---------------------------------GAPVYAPGVIETGPAEVGDQVVSVTPDGAAVCLGTLV
CBF5_EMENI      -----------------------------AVCYGAKLMIPGLLRFEAIELGEEVVLMTTKGEAIAIGIAQ
CMOA_PASMU      ----------------------------------------------------------------------
RSMF_SHELP      EDGFWVKVD-------------------------------------------------------------
RSMF_VIBPA      DNGFWIEAD-------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           MDSDEALKARRGLYIKVEKSLYRTPKLRNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGK
NSUN6_HUMAN     SELSRGLPELKGMGIRMTEPVYLSPSFDSLPRY----LFLQNLPSALVSHVLNPQPGEKILDLCAAPGGK
NSUN6_MOUSE     SDIFNGLPDLKGIGIRMTEPIYLSPSFDNLPSY----IFLQNLPSTVVAHVLDPQPGEKILDMCAAPGGK
NOP2_HUMAN      ------------------------------PEYLAGHYMLQGASSMLPVMALAPQEHERILDMCCAPGGK
NOP2_MOUSE      ------------------------------PEYLAGHYMLQGASSMLPVMALAPQEHERILDMCCAPGGK
NOP2_SCHPO      ------------------------------PEYLAGHYILQAASSFLPVMALAPQPNERILDMSSAPGGK
RSMB_SYNY3      ----------------------KTGAITQLPGFAEGWWTVQDASAQWVAQILNPQPEETIFDVCAAPGGK
NOP2_YEAST      ------------------------------PEYLAGHYILQALPVIALDHENERI-----LDMAAAPGGK
RSMB_BACSU      ----------------------------------------QDESSMLVARALDPKSDETVLDACAAPGGK
RSMF_SHELP      -----------GFWVKVDDSV----QLGNTVEHIQGLFYIQEAPKALFPEPIEDATSLTLLDMASAPGSK
RSMB_COXBU      MLDQKNISAKPLDFLPAAIQLEKPCSVHQLPGFNEGYCYIQDAAGQFAAYLLKLENNQTVLDACAAPGSK
RSMB_SODGM      ------------------------------------------------------------LDLCAAPGGK
RSMF_SHEPW      -----------GYWIKLDQEV----QLGNTIEHLQGLFYIQEASSMLPPTALLSVEQHDALDMASAPGSK
RSMB_KLEP7      -----------------------------LPGFAEGWVTVQDASAQGCMRYLQPENGERILDLCAAPGGK
RSMF_ALISL      -----------------------TVKLGSTAEHMAGLFYIQEASSMMP--VTALLKDNDALDMASAPGSK
RSMF_SHESH      -------------------SLDSDVQLGNTVEHLQGLFYIQEASSMLPP-IALFSTKTDKLDMASAPGSK
RSMB_KLEP3      -----------------------------LPGFAEGWVTVQDASAYLLPENGERI-----LDLCAAPGGK
RSMF_VIBF1      -----------------------TVKLGSTAEHMAGLFYIQEASSMMP--VTALLKDNDALDMASAPGSK
RSMF_SERP5      -------------------------RLGSAAEHLSGLFYIQEASSMLPALFAGAEAPSRVLDVAAAPGSK
RSMB_YERE8      ------------------------------------------------------------LDLCAAPGGK
RSMB_PROMH      -----------------------------LPGFNEGWVTVQDRSAQRCAELLAPQNNEQILDLCAAPGGK
RSMF_ERWT9      -----------------------TLPLGSTAEHLAGLFYIQEASSMLPGDMPQRV-----MDMAAAPGSK
RSMF_ERWCT      -------------------------RLGNTLEHLSGLFYIQELPASALFH--HNDAPGTILDVAAAPGSK
RSMF_KLEP7      --------------------------LGSTAEHLSGLFYIQEASSMLVAALFADNRQPERVDVAAAPGSK
RSMB_SALAR      -----------------------------LPGFAEGWVTVQDASAQKCVAFLAPQNGEHILDLCAAPGGK
RSMF_VIBCM      -----------GFWIDADESLV---PLGNTAEHMAGLFYIQEASSMMVSALFMGNAHYDSVDMAAAPGSK
RSMF_VIBCH      -----------GFWIDADESLV---PLGNTAEHMAGLFYIQEASSMMVSALFMGNAHYDSVDMAAAPGSK
Y026_METJA      ---------------EVKKSPF---SIGSTPEYLFGYYMPQSISSMIPPIVLNPREDDFILDMCAAPGGK
RSMF_SHEHH      ----------QGFWVTISSDL----QLGNTIEHLQGLFYIQELPALFDSHADNQFAQTRVLDMASAPGSK
RSMB_PSEPK      --------------------------VRGLPGFAEGWVSVQDEAAQLSADLLELAPGQRVLDACCAPGGK
RSMF_VIBFM      -----------------------TVKLGSTAEHMAGLFYIQEASSMMP--VTALLKDNDALDMASAPGSK
RSMF_SALTY      --------------------------LGSTAEHLSGLFYIQEASSMLAALFADDNHPQRVMDMAAAPGSK
RSMF_SALTI      --------------------------LGSTAEHLSGLFYIQEASSMLAALFADDNHPQRVMDMAAAPGSK
RSMF_SALSV      --------------------------LGSTAEHLSGLFYIQEASSMLAALFADDNHPQRVMDMAAAPGSK
RSMF_SALPC      --------------------------LGSTAEHLSGLFYIQEASSMLAALFADDNHPQRVMDMAAAPGSK
RSMF_SALPB      --------------------------LGSTAEHLSGLFYIQEASSMLAALFADDNHPQRVMDMAAAPGSK
RSMF_SALNS      --------------------------LGSTAEHLSGLFYIQEASSMLAALFADDNHPQRVMDMAAAPGSK
RSMF_SALCH      --------------------------LGSTAEHLSGLFYIQEASSMLAALFADDNHPQRVMDMAAAPGSK
RSMF_PECCP      -------------------------RLGNTLEHLSGLFYIQEASSMLVSALFHRNEALETVDVAAAPGSK
RSMB_VIBCH      --------------------------VHQLPGFAEGWVSVQDAAAQLLTYLAPQAGEL-ILDCCAAPGGK
RSMB_SHEON      --------------------LLAAPKVATLPLFLEGAASVQDGAAQWAATLLAPQANELILDACAAPGGK
RSMF_SHESM      -------------------------QLGNALEHIQGLFYIQEASSMLTALFTPNADWQCVLDLASAPGSK
RSMF_SALPK      --------------------------LGSTAEHLSGLFYIQEASSMLAALFADDNHPQRVMDMAAAPGSK
RSMF_SALPA      --------------------------LGSTAEHLSGLFYIQEASSMLAALFADDNHPQRVMDMAAAPGSK
RSMF_SALHS      --------------------------LGSTAEHLSGLFYIQEASSMLAALFADDNHPQRVMDMAAAPGSK
RSMF_SALG2      --------------------------LGSTAEHLSGLFYIQEASSMLAALFADDNHPQRVMDMAAAPGSK
RSMF_SALEP      --------------------------LGSTAEHLSGLFYIQEASSMLAALFADDNHPQRVMDMAAAPGSK
RSMF_SALDC      --------------------------LGSTAEHLSGLFYIQEASSMLAALFADDNHPQRVMDMAAAPGSK
RSMF_PSYIN      -----------GFWIELQEE--PTP-LGNSAEHLGGLCYIQELPVAALFHFFTPTTQSIVLDAAAAPGSK
RSMF_ECOUT      --------------------------LGSTAEHLSGLFYIQEASSMLPGNAPQRV-----MDVAAAPGSK
RSMF_ECOK1      --------------------------LGSTAEHLSGLFYIQEASSMLPGNAPQRV-----MDVAAAPGSK
RSMF_ECO45      --------------------------LGSTAEHLSGLFYIQEASSMLPGNAPQRV-----MDVAAAPGSK
RSMF_CITK8      ----------------IERDDEESLPLGSTAEHLSGLFYIQEASSMLAALFAEGNTPERIMDVAAAPGSK
RSMB_YERPY      ------------------------------------------------------------LDLCAAPGGK
RSMB_YERPS      ------------------------------------------------------------LDLCAAPGGK
RSMB_YERPP      ------------------------------------------------------------LDLCAAPGGK
RSMB_YERPN      ------------------------------------------------------------LDLCAAPGGK
RSMB_YERPG      ------------------------------------------------------------LDLCAAPGGK
RSMB_YERPE      ------------------------------------------------------------LDLCAAPGGK
RSMB_YERPB      ------------------------------------------------------------LDLCAAPGGK
RSMB_YERPA      ------------------------------------------------------------LDLCAAPGGK
RSMB_YERP3      ------------------------------------------------------------LDLCAAPGGK
RSMB_SHIB3      ------------------------------------------------------------LDLCAAPGGK
RSMB_SALPK      -----------------------------LPGFAEGWVTVQDASAQGCAVFLAPQNGEHILDLCAAPGGK
RSMB_SALPA      -----------------------------LPGFAEGWVTVQDASAQGCAVFLAPQNGEHILDLCAAPGGK
RSMB_ECO27      ------------------------------------------------------------LDLCAAPGGK
RSMF_SHIDS      --------------------------LGSTAEHLSGLFYIQEASSMLPGNAPQRV-----MDIAAAPGSK
RSMF_SHEON      -------------------------QLGNALEHIQGLFYIQEASSMLTALFTPNADWQCVLDLAAAPGSK
RSMF_SHEDO      -------------------TLTHDEQLGNCLEHIQGLFYIQELPALFTNDDADERAPLRVLDMASAPGSK
RSMF_SHEAM      ----------------------------NLTEHYQGLFYIQEASSMMCALFMDKEPRQLLLDVASAPGSK
RSMF_KLEP3      --------------------------LGSTAEHLSGLFYIQEASSMLVAALFADNPQPERVDVAAAPGSK
NSUN5_MOUSE     --------------------------LHEHPLYRAGHLILQDKASCLPAMLLSPPPGSHVIDACAAPGNK
RSMF_SALA4      --------------------------LGSTAEHLSGLFYIQEASSMLAALFADDNHPQRVMDMAAAPGSK
RSMB_SHISS      ------------------------------------------------------------LDLCAAPGGK
RSMB_ESCF3      ------------------------------------------------------------LDLCAAPGGK
RSMF_SHESR      -------------------------QLGNALEHIQGLFYIQEASSMLTALFTPNADWQCVLDLASAPGSK
RSMF_SHESA      -------------------------QLGNALEHIQGLFYIQEASSMLTALFTPNADWQCVLDLASAPGSK
RSMB_SALTY      -----------------------------LPGFAEGWVTVQDASAQGCAVFLAPQNGEHILDLCAAPGGK
RSMB_SALNS      -----------------------------LPGFAEGWVTVQDASAQGCAVFLAPQNGEHILDLCAAPGGK
RSMB_SALDC      -----------------------------LPGFAEGWVTVQDASAQGCAVFLAPQNGEHILDLCSAPGGK
RSMB_ECOLU      ------------------------------------------------------------LDLCAAPGGK
RSMB_ECOLI      ------------------------------------------------------------LDLCAAPGGK
RSMB_ECOLC      ------------------------------------------------------------LDLCAAPGGK
RSMB_ECOHS      ------------------------------------------------------------LDLCAAPGGK
RSMB_ECODH      ------------------------------------------------------------LDLCAAPGGK
RSMB_ECOBW      ------------------------------------------------------------LDLCAAPGGK
RSMF_SHEB9      -------------------------QLGNALEHIQGLFYIQELPPTALFTPSAFTTSTKVLDLASAPGSK
RSMF_ECO5E      --------------------------LGSTAEHLSGLFYIQEASSMLPGNAPQRV-----MDVAAAPGSK
RSMF_ECO57      --------------------------LGSTAEHLSGLFYIQEASSMLPGNAPQRV-----MDVAAAPGSK
RSMB_VIBPA      ------------------------------------------------------------LDCCAAPGGK
RSMB_SHIDS      ------------------------------------------------------------LDLCAAPGGK
RSMB_SHIBS      ------------------------------------------------------------LDLCAAPGGK
RSMB_ECOUT      ------------------------------------------------------------LDLCAAPGGK
RSMB_ECOSM      ------------------------------------------------------------LDLCAAPGGK
RSMB_ECOSE      ------------------------------------------------------------LDLCAAPGGK
RSMB_ECOK1      ------------------------------------------------------------LDLCAAPGGK
RSMB_ECO8A      ------------------------------------------------------------LDLCAAPGGK
RSMB_ECO5E      ------------------------------------------------------------LDLCAAPGGK
RSMB_ECO57      ------------------------------------------------------------LDLCAAPGGK
RSMB_ECO55      ------------------------------------------------------------LDLCAAPGGK
RSMB_ECO45      ------------------------------------------------------------LDLCAAPGGK
RSMB_ECO24      ------------------------------------------------------------LDLCAAPGGK
RSMF_SHISS      --------------------------LGSTAEHLSGLFYIQEASSMLPGNAPQRV-----MDVAAAPGSK
RSMF_SHIBS      --------------------------LGSTAEHLSGLFYIQEASSMLPGNAPQRV-----MDVAAAPGSK
RSMF_SHIB3      --------------------------LGSTAEHLSGLFYIQEASSMLPGNAPQRV-----MDVAAAPGSK
RSMF_SHEWM      -------------------------QLGNTIEHIQGLFYIQELPPTALFDGLDNSSEYTILDMASAPGSK
RSMF_SHEB2      -------------------------QLGNALEHIQGLFYIQEASSMLTALFTPSAFTTSALDLASAPGSK
RSMF_ECOSE      --------------------------LGSTAEHLSGLFYIQEASSMLP--VAALFADDNAMDVAAAPGSK
RSMF_ECOLI      --------------------------LGSTAEHLSGLFYIQEASSMLPGNAPQRV-----MDVAAAPGSK
RSMF_ECOL5      --------------------------LGSTAEHLSGLFYIQEASSMLAALFANGNAPQRVMDVAAAPGSK
RSMF_ECODH      --------------------------LGSTAEHLSGLFYIQEASSMLPGNAPQRV-----MDVAAAPGSK
RSMF_ECOBW      --------------------------LGSTAEHLSGLFYIQEASSMLPGNAPQRV-----MDVAAAPGSK
RSMF_ECO8A      --------------------------LGSTAEHLSGLFYIQEASSMLP--VAALFADDNAMDVAAAPGSK
RSMF_ECO7I      --------------------------LGSTAEHLSGLFYIQEASSMLPGNAPQRV-----MDVAAAPGSK
RSMF_ECO55      --------------------------LGSTAEHLSGLFYIQEASSMLP--VAALFADDNAMDVAAAPGSK
RSMF_ECO24      --------------------------LGSTAEHLSGLFYIQEASSMLP--VAALFADDNAMDVAAAPGSK
RSMB_SALTI      -----------------------------LPGFAEGWVTVQDASAQGCAVFLAPQNGEHILDLCAAPGGK
RSMB_SALPC      -----------------------------LPGFAEGWVTVQDASAQGCAVFLAPQNGEHILDLCAAPGGK
RSMB_SALHS      -----------------------------LPGFAEGWVTVQDASAQGCAVFLAPQNGEHILDLCAAPGGK
RSMB_SALG2      -----------------------------LPGFAEGWVTVQDASAQGCAVFLAPQNGEHILDLCAAPGGK
RSMB_SALEP      -----------------------------LPGFAEGWVTVQDASAQGCAVFLAPQNGEHILDLCAAPGGK
RSMB_SALCH      -----------------------------LPGFAEGWVTVQDASAQGCAVFLAPQNGEHILDLCAAPGGK
RSMB_ECOL6      ------------------------------------------------------------LDLCAAPGGK
RSMB_ECO81      ------------------------------------------------------------LDLCAAPGGK
RSMB_ECO7I      ------------------------------------------------------------LDLCAAPGGK
RSMF_PHOPR      ----------------IEREDEKSVSLGNTAEHMAGLFYIQEASSMMVTALLKNNDALDCVDMASAPGSK
RSMF_ECOSM      --------------------------LGSTAEHLSGLFYIQEASSMLPGNAPQRV-----MDVAAAPGSK
RSMF_ECO81      --------------------------LGSTAEHLSGLFYIQEASSMLPGNAPQRV-----MDVAAAPGSK
RSMF_ECO27      --------------------------LGSTAEHLSGLFYIQEASSMLPGNAPQRV-----MDVAAAPGSK
RSMB_VIBVY      --------------------------VHSLPGFEQGWVSVQDAAAQLSFNYLQPKDGELILDCCAAPGGK
RSMF_SHEB8      -------------------------QLGNALEHIQGLFYIQEASSMLTALFTPSAFTTSALDLASAPGSK
RSMF_SALAR      --------------------------LGSTAEHLSGLFYIQEASSMLAALFADDNHPQRVMDMAAAPGSK
RSMF_ENTS8      --------------------------LGSTAEHLSGQFYIQEASSMLAALFADGNTPARVMDVAAAPGSK
RSMF_ENT38      --------------------------LGSTAEHLSGLFYIQEASSMLVTALFAEDNQPERVDVAAAPGSK
RSMF_ECOLU      --------------------------LGSTAEHLSGLFYIQEASSMLPGNAPQRV-----MDVAAAPGSK
RSMF_ECOLC      --------------------------LGSTAEHLSGLFYIQEASSMLPGNAPQRV-----MDVAAAPGSK
RSMF_ECOL6      --------------------------LGSTAEHLSGLFYIQEASSMLPGNAPQRV-----MDVAAAPGSK
RSMF_ECOHS      --------------------------LGSTAEHLSGLFYIQEASSMLPGNAPQRV-----MDVAAAPGSK
RSMB_VIBVU      --------------------------VHSLPGFEQGWVSVQDAAAQLSFNYLQPKDGELILDCCAAPGGK
RSMB_PHOLL      -----------------------------LPGFDKGWVTVQDLSAQECVELLKPINGEKILDLCAAPGGK
NSUN5_HUMAN     LDDLRALKGKHFLLDPLMPELLVFPAQTDLPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNK
RSMF_ESCF3      --------------------------LGSTAEHLSGLFYIQEASSMLAALFADGNSPQRVMDVAAAPGSK
RSMF_AERHH      --------------------------LGNTAEHLSGLFYIQEASSMLTALFACEQTRRDGMDAAAAPGSK
RSMB_SHIFL      ------------------------------------------------------------LDLCAAPGGK
RSMB_SALSV      -----------------------------LPGFAEGWVTVQDASAQGCAVFLAPQNGEHILDLCAAPGGK
RSMB_PSEAE      --AEAGIKARACDYSRDGIQLAAPRDVRELPGFAEGRVSVQDXXXXXXXXXXXSAPGQRVLDACCAPGGK
RSMB_HAEDU      ------------------------------------------------------------LDACAAPGGK
RSMB_ECOL5      ------------------------------------------------------------LDLCAGPGGK
YEY6_SCHPO      ----------------VENSLYKEGKVIIQDKAS---CFPAAVLAGLTGHVG------DIIDGCAAPGNK
RSMF_SHEPA      -------------------------QLGNTIEHLQGLFYIQEASSMLPPTVAAENTEDDGLDMASAPGSK
RSMF_SHEFN      -------------------------QLGNAIEHIQGLFYIQEASSMLTALFSNDNTAEIVLDVASAPGSK
RSMF_SHEB5      -------------------------QLGNALEHIQGLFYIQEASSMLTALFTPSAFTTSALDLASAPGSK
RSMF_AERS4      --------------------------LGNTAEHLSGLFYIQEASSMLTALFASDQVKRDGMDAAAAPGSK
RSMB_SHIF8      ------------------------------------------------------------LDLCAAPGGK
RSMB_SALA4      -----------------------------LPGFAEGWVTVQDASAQGCAVFLAPQNGEHILDLCAAPGGK
RSMF_SHESW      -------------------------QLGNALEHIQGLFYIQEASSMLPSAFTPSAKWQCVLDLASAPGSK
RSMF_SHEPC      -------------------------QLGNALEHIQGLFYIQEASSMLPSAFTPSAKWQCVLDLASAPGSK
RSMB_ERWCT      ------------------------------------------------------------LDLCAAPGGK
RSMF_VIBPA      -----------GFWIEADESVV---PLGNTAEHMSGLFYIQEASSMMVSALFMNDESYDAVDTAAAPGSK
RSMB_XANAC      --------------------LHNAVPVSQLPGFAEGDVSVQDGSAQQVADALTLAPSARVLDACAAPGGK
RSMB_PECCP      ------------------------------------------------------------LDLCAAPGGK
RSMB_ENTS8      ------------------------------------------------------------LDLCAAPGGK
RSMB_PASMU      -----------------------------LPAFHEGAVSVQDVNAQWSALLLAPENGELILDACAAPGGK
RSMB_CITK8      ------------------------------------------------------------LDLCAAPGGK
RSMF_VIBHB      -----------GFWIEADESVV---PLGNTAEHMSGLFYIQEASSMMVSALFMNDESYDAVDTAAAPGSK
NSUN2_DROME     --------------IRRSEPLYRLHNFLIVETTAGGISRQEAVS--MIPPIVLDVRPTDKVDMCAAPGSK
RSMF_SHIFL      --------------------------LGSTTEHLSGLFYIQEASSMLPGNAPQRV-----MDVAAAPGSK
RSMF_SHIF8      --------------------------LGSTTEHLSGLFYIQEASSMLPGNAPQRV-----MDVAAAPGSK
RSMF_VIBVY      -----------GFWIEADES--KVP-LGNTAEHMCGLFYIQEASSMMVSALFLGENQFESVDTAAAPGSK
RSMF_VIBVU      -----------GFWIEADES--KVP-LGNTAEHMCGLFYIQEASSMMVSALFLGENQFESVDTAAAPGSK
RSMF_VIBSL      -----------GFWITADES---EAPLGNTAEHMSGLFYIQEASSMMP---PSALFQGEALDTAAAPGSK
RSMB_ENT38      ------------------------------------------------------------LDLCAAPGGK
RSMB_SERP5      ----------------------------DLPGFADGWVTVQDASAQGCVDLLDPQDGEQILDLCAAPGGK
RSMB_PSESM      --------------------------VRSLPGFAEGWISVXXXXXXXXXXXXXXXPGQRVLDACCAPGGK
RSMB_HAEIN      --------------------------VQKLPHFEEGAVTVQDLSAQWAATLLEPKNEEWILDACAAPGGK
RSMB_ERWT9      ------------------------------------------------------------LDLCAAPGGK
RSMF_PSEHT      --------------------------LGNTDLHLSGAMYVQEASSMLPPALKQSIEHTNYVDMASAPGSK
RSMB_XYLFA      -----------------------------LPGFQAGEVSVQDLSAQQVAALLSPAPHARVLDACAAPGGK
NCL1_SCHPO      ------------------------------------------------------------LDMCAAPGSK
TRUB_NANEQ      MDSKEMLEKKRGIAVDIER---------------------------------------------------
RSMB_XYLFT      -----------------------------LPGFQGGEVSVQDLSAQQVAALLSPAPHARLLDACAAPGGK
RSMB_SALPB      -----------------------------LPGFAEGWVTVQDASAQGCAVFLAPQNGEHILDLCAAPGGK
TGS1_MOUSE      -------------------------------------------PEKIAEHIAGRVSQAFVVDAFCGVGGN
TGS1_RAT        -------------------------------------------PEKIAEHIAGRVSQSFIVDAFCGVGGN
NCL1_YEAST      ------------------------------------------------------------LDMCAAPGSK
RSMB_XANCP      -------------------------------------------------------------------GGK
TRUB_SULTO      VDSQKLVDMKKGIVVKPKRVL-------------------------------------------------
NSUN4_XENTR     ----------------------------------------------------------------------
TRUB_THEGJ      MTSGEMLQRSKGIAVDVDK---------------------------------------------------
TGS1_HUMAN      -------------------------------------------PEKIAEHIAGRVSQSFVVDAFCGVGGN
TRUB_PYRKO      MTTGEMLQKSKGIAVDVDK---------------------------------------------------
NSUN2_CHICK     ------------------------------------------------------------LDMCAAPGSK
TRUB_PYRFU      MTSQEMLEKTKGIAVDVEK---------------------------------------------------
TRUB_PYRHO      MTSQEMMQRSKGIAVDVEK---------------------------------------------------
TRUB_METKA      ATWKEMLHADRGIMVDTKRVL-------------------------------------------------
NSUN4_XENLA     ----------------------------------------------------------------------
TRUB_SULSO      MDSEELENAKKGIVVNLSR---------------------------------------------------
TRUB_PYRAB      MSTQEMIERSKGIAVDVEK---------------------------------------------------
NSUN4_MOUSE     ------------------------------------------------------------LDLCAAPGGK
TRUB_METJA      MNTKEILNADKGVAVDVER---------------------------------------------------
RRMT_AZOSB      -----------------------------------------------------------AVDLGAAPGGW
NSUN3_HUMAN     ------------------------------------------------------------LDLCAAPGGK
TRUB_PYRAR      VDSEEVKKMERGAVVRTDRVVMR-----------------------------------------------
NSUN3_MOUSE     --------------------------------------------ASLLPVLALELRDGEAVDLCAAPGGK
NSUN3_DANRE     ----------------------------------------------------------NVLDLCAAPGGK
NSUN3_BOVIN     ------------------------------------------------------------LDLCAAPGGK
TRUB_HALMA      SDPD----ADSGLVVELDRML-------------------------------------------------
CBF5_EMENI      MSTVELSTCDHGVVAKVKRCI-------------------------------------------------
CMOA_PASMU      ---------------------------RSIPGYANII--------TAIGMLASRFVNSNVYDLGCSRGAA
RSMF_SHELP      ----------------------------------------------------------------------
RSMF_VIBPA      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TTHLAQMGIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDRDFPKIKAGVALVDPPCTDIGV
NSUN6_HUMAN     TTHIAALQGEVIALDKIFNKVEKIKQNALLLGLNSIRAFCFDGTKAVKLDMVEDTEGEILLDAPCSGMGQ
NSUN6_MOUSE     TTHLMQDKGEVIALDKILTKVNKLKQNASLLGLHSIRAFCFDATKALKLDTTDIEGGPIILDAPCSGMGQ
NOP2_HUMAN      TSYMAQLGV-ILANDANAERLKSVVGNLHRLGVTNTII-----SHYDGRQFPKVVGGFVLLDAPCSGTGV
NOP2_MOUSE      TSYIAQLGV-ILANDANADRLKSVVGNLHRLGVTNTII-----SHYDGRQFPKVVGGFVLLDAPCSGTGV
NOP2_SCHPO      VTYVAALGI-IFANDSNKARTKALSANIHRLGVRNAIVC-----NYDGRKFPNEVIGGVLLDAPCSGTGV
RSMB_SYNY3      TTHIAEMGDQIYAGDRHGWRLQKLAVTQQRLGL---TSIKIWEG---DLTQPGVKPPVALLDVPCSGLGT
NOP2_YEAST      TTYISAMMKNVFANDANKSRTKSLIANIHRLGCTNTIVC-----NYDAREFPKVIGGFILLDAPCSGTGV
RSMB_BACSU      SAHIAELMKNVTSLDLHKHKVKLIKEAADRLGLTI-IHAETMDARKAGETFENEQFDRILVDAPCSGFGV
RSMF_SHELP      TTQLAAMGL-LVANEYSSSRVKVLHANVQRMGASNLA--LTHDARYLFESFDAI-----LLDAPCGGEGV
RSMB_COXBU      TSHILEVNPHLVAIDNNKQRLNRIKENITRLGLQEHLQCLLADVSQIDQWSSGELFDRILLDAPCSATGV
RSMB_SODGM      TTHILEIAARVMAVDVDGQRAARIHDNLQRLGMQA--EVVIGDGRTPDAWRSGMLFDRILLDAPCSATGV
RSMF_SHEPW      TTQIAAMGNKLVANEYSASRVKVLHANIARMG--VANCALTHDARVFGEYMFEIFDSV-LLDAPCSGEGT
RSMB_KLEP7      TTHILEVAAQVMAVDIDEQRLSRVYDNLKRLG--VKAEVKQGDGRFPEQWCGNEQFDRILLDAPCSATGV
RSMF_ALISL      TTQLAA-GMKLVANEYSSSRVKILCSNVQRCGVSN-VALTHFDGRVFGGWLPETFDSI-LLDAPCSGEGT
RSMF_SHESH      TTQIAAMGL-LIANEYSSSRVKVLHANVLRMG--VSNTALTHFDARVFGEYLYDQFDAILLDAPCSGEGT
RSMB_KLEP3      TTHILEVAAQVMAVDIDEQRLSRVYDNLKRLGMKA--EVKQGDGRFPEQWCGNEQFDRILLDAPCSATGV
RSMF_VIBF1      TTQLAA-GMKLVANEFSSSRVKVLCSNIQRCGVSN-VALTHFDGRVFGGWLPETFDSI-LLDAPCSGEGT
RSMF_SERP5      TTQIAALMNNIVANEYSASRVKVLHANISRCGVKN-VALTHFDGRVFGAALPESFDAI-LLDAPCSGEGV
RSMB_YERE8      TTHILEAAVHVLAVDIDEQRLSRVKENLQRLRLHA--DVRVGDGRTPDEWCGDQQFDRILLDAPCSATGV
RSMB_PROMH      TTHILEIAAHVLAIDIDEQRLARVKENLNRLKLHA--TVKSGDGRYPEQWCANMQFDRILLDAPCSATGV
RSMF_ERWT9      TTQIAHMGNRILANEYSASRVKVLHANLSRCG--VSNTAMTHDGRVFGPALPECFDAV-LLDAPCSGEGV
RSMF_ERWCT      TTQIAARLNNIVANEYSASRVKVLHANISRCGVSNTA-ITHFDGRVFGAALPEYFDAI-LLDAPCSGEGV
RSMF_KLEP7      TTQIARMGNAILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAALPETFDAI-LLDAPCSGEGV
RSMB_SALAR      TTHILEAAADVLAVDVDEQRLSRIYDNLKRLGMKA--TVKQGDGRYPAQWCDEQQFDRILLDAPCSATGV
RSMF_VIBCM      TTQMAALGV-LVANEFSASRVKVLHANIERCGIRNTA-LSNFDGCVFGGWLPE-RFDAVLIDAPCSGEGT
RSMF_VIBCH      TTQMAALGV-LVANEFSASRVKVLHANIERCGIRNTA-LSNFDGCVFGGWLPE-RFDAVLIDAPCSGEGT
Y026_METJA      TTHLAQLMKNIVAVEISKTRTKALKSNINRMGVLNTIIINADMRKYKDYLLKEIFFDKILLDAPCSGNII
RSMF_SHEHH      TTQIAALGL-LVANEYSASRVKVLHANVARMG--VSNCALTHDARYLFETFDSV-----LLDAPCSGEGT
RSMB_PSEPK      TCHLAEAGLNMVAIDLEAKRLTRVRENLDRLQLDA--ELIACDARWDGKPFQRI-----LLDAPCSATGV
RSMF_VIBFM      TTQLAA-GMKLVANEFSSSRVKVLCSNIQRCGVSN-VALTHFDGRVFGGWLPETFDSI-LLDAPCSGEGT
RSMF_SALTY      TTQIARMGNRILANEFSASRVKVLHANISRCG--IANTALTHDGRVFGAALPEMFDAI-LLDAPCSGEGV
RSMF_SALTI      TTQIARMGNRILANEFSASRVKVLHANISRCG--IANTALTHDGRVFGAALPEMFDAI-LLDAPCSGEGV
RSMF_SALSV      TTQIARMGNRILANEFSASRVKVLHANISRCG--IANTALTHDGRVFGAALPEMFDAI-LLDAPCSGEGV
RSMF_SALPC      TTQIARMGNRILANEFSASRVKVLHANISRCG--IANTALTHDGRVFGAALPEMFDAI-LLDAPCSGEGV
RSMF_SALPB      TTQIARMGNRILANEFSASRVKVLHANISRCG--IANTALTHDGRVFGAALPEMFDAI-LLDAPCSGEGV
RSMF_SALNS      TTQIARMGNRILANEFSASRVKVLHANISRCG--IANTALTHDGRVFGAALPEMFDAI-LLDAPCSGEGV
RSMF_SALCH      TTQIARMGNRILANEFSASRVKVLHANISRCG--IANTALTHDGRVFGAALPEMFDAI-LLDAPCSGEGV
RSMF_PECCP      TTQIAARLDNIVANEYSASRVKVLHANISRCG--VSNTAMTHDGRVFGAALPEYFDAI-LLDAPCSGEGV
RSMB_VIBCH      TAHILERESQVVAIDCDETRLKRVRENLQRLELTA--QVICGDARYPQQWWQGEQFDRILLDAPCSATGV
RSMB_SHEON      SCHLLELSIKLIAVDFDAKRLERVQQNLDRLSLKA--EVIHGDAANIDSWWQGEQFDRILLDAPCSATGV
RSMF_SHESM      TTQMAALGL-LVANEYSASRVKVLHANVLRMGAS-HCALTHFDGRYLYESFDAV-----LIDAPCGGEGI
RSMF_SALPK      TTQIARMGNRILANEFSASRVKVLHANISRCG--IANTALTHDGRVFGAALPEMFDAI-LLDAPCSGEGV
RSMF_SALPA      TTQIARMGNRILANEFSASRVKVLHANISRCG--IANTALTHDGRVFGAALPEMFDAI-LLDAPCSGEGV
RSMF_SALHS      TTQIARMGNRILANEFSASRVKVLHANISRCG--IANTALTHDGRVFGAALPEMFDAI-LLDAPCSGEGV
RSMF_SALG2      TTQIARMGNRILANEFSASRVKVLHANISRCG--IANTALTHDGRVFGAALPEMFDAI-LLDAPCSGEGV
RSMF_SALEP      TTQIARMGNRILANEFSASRVKVLHANISRCG--IANTALTHDGRVFGAALPEMFDAI-LLDAPCSGEGV
RSMF_SALDC      TTQIARMGNRILANEFSASRVKVLHANISRCG--IANTALTHDGRVFGAALPEMFDAI-LLDAPCSGEGV
RSMF_PSYIN      TTQIANSGL-IIGNEFSSSRIKMLHANIQRCGIK-NVALTHFDARVFGKWLPGTFDAI-LLDAPCSGEGV
RSMF_ECOUT      TTQIARMNNKILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAAVPEMFDAI-LLDAPCSGEGV
RSMF_ECOK1      TTQIARMNNKILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAAVPEMFDAI-LLDAPCSGEGV
RSMF_ECO45      TTQIARMNNKILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAAVPEMFDAI-LLDAPCSGEGV
RSMF_CITK8      TTQIARMNNQILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAALPETFDAI-LLDAPCSGEGV
RSMB_YERPY      TTHILEAAAHVLAVDIDEQRLSRVKENLQRLQLQAVVDGRAPDTWCGDQQFDRI-----LLDAPCSATGV
RSMB_YERPS      TTHILEAAAHVLAVDIDEQRLSRVKENLQRLQLQAVVDGRAPDTWCGDQQFDRI-----LLDAPCSATGV
RSMB_YERPP      TTHILEAAAHVLAVDIDEQRLSRVKENLQRLQLQAVVDGRAPDTWCGDQQFDRI-----LLDAPCSATGV
RSMB_YERPN      TTHILEAAAHVLAVDIDEQRLSRVKENLQRLQLQAVVDGRAPDTWCGDQQFDRI-----LLDAPCSATGV
RSMB_YERPG      TTHILEAAAHVLAVDIDEQRLSRVKENLQRLQLQAVVDGRAPDTWCGDQQFDRI-----LLDAPCSATGV
RSMB_YERPE      TTHILEAAAHVLAVDIDEQRLSRVKENLQRLQLQAVVDGRAPDTWCGDQQFDRI-----LLDAPCSATGV
RSMB_YERPB      TTHILEAAAHVLAVDIDEQRLSRVKENLQRLQLQAVVDGRAPDTWCGDQQFDRI-----LLDAPCSATGV
RSMB_YERPA      TTHILEAAAHVLAVDIDEQRLSRVKENLQRLQLQAVVDGRAPDTWCGDQQFDRI-----LLDAPCSATGV
RSMB_YERP3      TTHILEAAAHVLAVDIDEQRLSRVKENLQRLQLQAVVDGRAPDTWCGDQQFDRI-----LLDAPCSATGV
RSMB_SHIB3      TTHILEVAAQVVAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_SALPK      TTHILEVAADVLAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPAQWCGEQQFDRILLDAPCSATGV
RSMB_SALPA      TTHILEVAADVLAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPAQWCGEQQFDRILLDAPCSATGV
RSMB_ECO27      TTHILEVAAQVVAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGKQQFDRILLDAPCSATGV
RSMF_SHIDS      TTQIAARMNNILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAAVPEMFDAI-LLDAPCSGEGV
RSMF_SHEON      TTQMAALGL-LVANEYSASRVKVLHANVLRMGAS-HCALTHFDGRYLYESFDAV-----LIDAPCGGEGV
RSMF_SHEDO      TTQMAALGL-LIANEYSASRVKVLHANVLRMGVSNCA--LTHFDGRVFGEYQYEAFDAVLLDAPCGGEGT
RSMF_SHEAM      TTQLAALGL-IIANEYSASRTKALHANLQRMGV-ANVAITQFDGRVFGAHLYETLDAIQL-DAPCSGEGL
RSMF_KLEP3      TTQIARMGNAILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAALPEAFDAI-LLDAPCSGEGV
NSUN5_MOUSE     TSYIAALQGKIFAFDQDAKRLAAMATLVARAGVSCFLTVSPSDQRYSQVQY-------ILLDPSCSGSGM
RSMF_SALA4      TTQIARMGNRILANEFSASRVKVLHANISRCG--IANTALTHDGRVFGAALPEMFDAI-LLDAPCSGEGV
RSMB_SHISS      TTHILEVAAQVVAVDIDEQRLSRVHDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_ESCF3      TTHILEVAAQVVAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMF_SHESR      TTQMAALGL-LVANEYSASRVKVLHANVLRMGAS-HCALTHFDGRYLYESFDAV-----LIDAPCGGEGT
RSMF_SHESA      TTQMAALGL-LVANEYSASRVKVLHANVLRMGAS-HCALTHFDGRYLYESFDAV-----LIDAPCGGEGT
RSMB_SALTY      TTHILEVAADVLAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_SALNS      TTHILEVAADVLAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_SALDC      TTHILEVAADVLAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPAQWCGEQQFDRILLDAPCSATGV
RSMB_ECOLU      TTHILEVAAQVVAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_ECOLI      TTHILEVAAQVVAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_ECOLC      TTHILEVAAQVVAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_ECOHS      TTHILEVAAQVVAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_ECODH      TTHILEVAAQVVAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_ECOBW      TTHILEVAAQVVAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMF_SHEB9      TTQMAALGL-LVANEYSASRVKVLHANVLRMGAS-HCALTHFDGRYLYESFDAV-----LIDAPCGGEGT
RSMF_ECO5E      TTQIAARMNNILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAALPEMFDAI-LLDAPCSGEGV
RSMF_ECO57      TTQIAARMNNILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAALPEMFDAI-LLDAPCSGEGV
RSMB_VIBPA      TAHILERGSEVVAIDCDDTRLKRVHENLKRLNLQA--KVVCGDARNPQEWWQGEQFDRILLDAPCSATGV
RSMB_SHIDS      TTHILEVAAQVVAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_SHIBS      TTHILEVAAQVVAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_ECOUT      TTHILEVAAQVLAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_ECOSM      TTHILEVAAQVVAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_ECOSE      TTHILEVAAQVVAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_ECOK1      TTHILEVAAQVLAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_ECO8A      TTHILEVAAQVVAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_ECO5E      TTHILEVAAQVVAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_ECO57      TTHILEVAAQVVAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_ECO55      TTHILEVAAQVVAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_ECO45      TTHILEVAAQVLAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_ECO24      TTHILEVAAQVVAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMF_SHISS      TTQIARMNNEILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAAVPEMFDAI-LLDAPCSGEGV
RSMF_SHIBS      TTQIAARMNNILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAAVPEMFDAI-LLDAPCSGEGV
RSMF_SHIB3      TTQIAARMNNILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAAVPEMFDAI-LLDAPCSGEGV
RSMF_SHEWM      TTQMASLGL-LVANEYSSSRVKVLHANVQRMG--VYNTALTHDARYLYHQFDAI-----LLDAPCSGEGT
RSMF_SHEB2      TTQMAALGL-LVANEYSASRVKVLHANVLRMGAS-HCALTHFDGRYLYESFDAV-----LIDAPCGGEGV
RSMF_ECOSE      TTQIAARMNNILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAAVPEMFDAI-LLDAPCSGEGV
RSMF_ECOLI      TTQIARMNNEILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAAVPEMFDAI-LLDAPCSGEGV
RSMF_ECOL5      TTQIAARMNNILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAAVPEMFDAI-LLDAPCSGEGV
RSMF_ECODH      TTQIARMNNEILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAAVPEMFDAI-LLDAPCSGEGV
RSMF_ECOBW      TTQIARMNNEILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAAVPEMFDAI-LLDAPCSGEGV
RSMF_ECO8A      TTQIAARMNNILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAAVPEMFDAI-LLDAPCSGEGV
RSMF_ECO7I      TTQIAARMNNILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAALPEMFDAI-LLDAPCSGEGV
RSMF_ECO55      TTQIAARMNNILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAAVPEMFDAI-LLDAPCSGEGV
RSMF_ECO24      TTQIAARMNNILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAAVPEMFDAI-LLDAPCSGEGV
RSMB_SALTI      TTHILEVAADVLAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPAQWCGEQQFDRILLDAPCSATGV
RSMB_SALPC      TTHILEVAADVLAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPAQWCGEQQFDRILLDAPCSATGV
RSMB_SALHS      TTHILEVAADVLAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPAQWCGEQQFDRILLDAPCSATGV
RSMB_SALG2      TTHILEVAADVLAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPAQWCGEQQFDRILLDAPCSATGV
RSMB_SALEP      TTHILEVAADVLAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPAQWCGEQQFDRILLDAPCSATGV
RSMB_SALCH      TTHILEVAADVLAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPAQWCGEQQFDRILLDAPCSATGV
RSMB_ECOL6      TTHILEVAAQVLAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_ECO81      TTHILEVAAQVLAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_ECO7I      TTHILEVAAQVLAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMF_PHOPR      TTQIANRGV-LVANELAASRIKVLHANLQRCG--VYNAALTHFDGCVFGGWAPESFDTILLDAPCSGEGA
RSMF_ECOSM      TTQIAARMNNILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAAVPEMFDAI-LLDAPCSGEGV
RSMF_ECO81      TTQIAARMNNILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAAVPEMFDAI-LLDAPCSGEGV
RSMF_ECO27      TTQIAARMNNILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAAVPEMFDAI-LLDAPCSGEGV
RSMB_VIBVY      TAHILESAREVVALDCDEQRLKRVTENLKRLNLQA--KVICGDARNPEQWWQGEQFDRILLDAPCSATGV
RSMF_SHEB8      TTQMAALGL-LVANEYSASRVKVLHANVLRMGAS-HCALTHFDGRYLYESFDAV-----LIDAPCGGEGT
RSMF_SALAR      TTQIARMGNHILANEFSASRVKILHANLCRCG--VANTALTHDGRVFGAALPEMFDAI-LLDAPCSGEGV
RSMF_ENTS8      TTQIAALMQNILANEYSASRVKVLHANISRCGIH-NVGLTHFDGRVFGAALPE-QFDAILLDAPCSGEGV
RSMF_ENT38      TTQIARMGNRILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAALPESFDAI-LLDAPCSGEGV
RSMF_ECOLU      TTQIAARMNNILANEFSASRVKVLHANISRCGIRN-VALTHFDGRVFGAALPEMFDAI-LLDAPCSGEGV
RSMF_ECOLC      TTQIAARMNNILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGVAVPEMFDAI-LLDAPCSGEGV
RSMF_ECOL6      TTQIAARMNNILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGAAVPEMFDAI-LLDAPCSGEGV
RSMF_ECOHS      TTQIAARMNNILANEFSASRVKVLHANISRCGISN-VALTHFDGRVFGVAVPEMFDAI-LLDAPCSGEGV
RSMB_VIBVU      TAHILESAREVVALDCDEQRLKRVTENLKRLNLQA--KVICGDARNPEQWWQGEQFDRILLDAPCSATGV
RSMB_PHOLL      TTYILEIASQVVAVDIDEQRIKRVKENLKR--LNCHATVKTGDGRHPEHWAENQQFDRILLDAPCSATGV
NSUN5_HUMAN     TSHLAALQGKIFAFDLDAKRLASMATLLARAGVEDFLAVSPSDPRYHEVHY-------ILLDPSCSGSGM
RSMF_ESCF3      TTQIAARMNNILANEFSASRVKVLHANISRCGIRN-VALTHFDGRVFGAALPEMFDAI-LLDAPCSGEGV
RSMF_AERHH      TTQIAALMNNLVANEYSSSRLKVLSANLQRCGV-TNVGMTHFDAKVFGQWLPETFDAI-LLDAPCSGEGS
RSMB_SHIFL      TTHILEVAAQVVAVDIDEQRLSRIYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_SALSV      TSHILEVAADVLAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPAQWCGEQQFDRILLDAPCSATGV
RSMB_PSEAE      TCHLLEXXXXXXXXXXXXSRLVRVRENLQRLGLQA--SLVAADARATGEWWDGKPFQRILLDAPCSATGV
RSMB_HAEDU      TTHILEQAAKVIALDIEESRLVRVRENLARLGLDVRCGDATTPTKWLADDFDRI-----LLDAPCSATGV
RSMB_ECOL5      TTHILEVAAQVLAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
YEY6_SCHPO      TTHLAACKSHIFAFERDAKRVQTLRKMVGISGANNVTDFTLTDPKSLYRNVTHI-----LLDPSCSGSGI
RSMF_SHEPA      TTQIAALGL-LIANEYSASRVKVLHANVARMG--VANCALTHDARYMFETFDSI-----LLDAPCSGEGT
RSMF_SHEFN      ATQIAALGL-LVANEYSASRVKVLHANVLRMGASH--TALTHDGRYLYESFDAI-----LLDAPCGGEGT
RSMF_SHEB5      TTQMAALGL-LVANEYSASRVKVLHANVLRMGAS-HCALTHFDGRYLYESFDAV-----LIDAPCGGEGT
RSMF_AERS4      TTQIAALMNNLVANEYSSSRLKVLSANIQRCGV-TNVGMTHFDAKVFGQWLPETFDAI-LLDAPCSGEGT
RSMB_SHIF8      TTHILEVAAQVVAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
RSMB_SALA4      TTHILEVAADVLAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPAQWCGEQQFDRILLDAPCSATGV
RSMF_SHESW      TTQIAALGL-LIANEYSASRVKVLHANVLRMGAS-HCALTHFDGRYLYESFDAV-----LIDAPCGGEGT
RSMF_SHEPC      TTQIAALGL-LIANEYSASRVKVLHANVLRMGAS-HCALTHFDGRYLYESFDAV-----LIDAPCGGEGT
RSMB_ERWCT      TTHILEAAPKVLAVDVDETRLGRVKENLLR--LQMHAEVKQGDGRYPDRVFDRI-----LLDAPCSATGV
RSMF_VIBPA      TTQIAALGV-LVANEYAASRVKVLHANIERCGVRNAA-LSNFDGRVFGGWLPE-QFDAVLLDAPCSGEGT
RSMB_XANAC      AAHLLERGLQLVALDVDARRLERVQQTLQRTVPNXXXXXXXXXXXXXXXXXXGRPFDAVLLDAPCSATGV
RSMB_PECCP      TTHILEAASHVLAVDIDETRLGRVKENLLR--LQMHAEVKQGDGRYPDRMFDRI-----LLDAPCSATGV
RSMB_ENTS8      TTHILEAAASVMAVDVDAQRISRVYENLKRLKMKA--DVKVGDGRFPSTWCGETQFDRILLDAPCSATGV
RSMB_PASMU      TTHILEQAAHVVALDVEATRLKRVHENLARMQQQVICGDATQPAQWLKQSESAVQFDRILLDAPCSATGV
RSMB_CITK8      TTHILEAAAQVLAVDVDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPAQWCGEQKFDRILLDAPCSATGV
RSMF_VIBHB      TTQIAALGV-LVANEYAASRVKVLHANIERCGVRNAA-LSNFDGRVFGGWLPE-QFDAVLLDAPCSGEGT
NSUN2_DROME     TAQLIEAGF-VLANDVDNNRCYMLVHQAKRLNSPCLL-VTNHDSSVFDGSKAILKFDKILCDVPCSGDGT
RSMF_SHIFL      TTQIAARMNNILANEFSASWVKVLHANISRCGISN-VALTHFGGRVFGAAVPEMFDAI-LLDAPCSGEGV
RSMF_SHIF8      TTQIAARMNNILANEFSASWVKVLHANISRCGISN-VALTHFGGRVFGAAVPEMFDAI-LLDAPCSGEGV
RSMF_VIBVY      TTQIAALGI-LVANEYAASRVKVLHANIERCGVRNAA-LSNFDGRVFGGWLPESFDAV-LLDAPCSGEGT
RSMF_VIBVU      TTQIAALGI-LVANEYAASRVKVLHANIERCGVRNAA-LSNFDGRVFGGWLPESFDAV-LLDAPCSGEGT
RSMF_VIBSL      TTQIAALGV-LVANEYAASRVKVLHANIERCGVRNAA-LSNFDGRVFGGWLPE-QFDAVLLDAPCSGEGT
RSMB_ENT38      TTHILEIAPKVMAVDVDEQRLSRVYDNLKRLGMKA--EVKQGDGRTPDEQFDRI-----LVDAPCSATGV
RSMB_SERP5      TTHILEAAAHVMAVDIDEQRLKRVKENLQRLRLHA--EVKQGDGRTPDKQFDRI-----LLDAPCSATGV
RSMB_PSESM      TCHLLEVQPQVVAVDLEAKXXXXXXXXXXXXXXDA--ELIAADARETAQWWDGKPFQRILLDAPCSATGV
RSMB_HAEIN      TTHILELAANVIALDVESHRLKRVEENLERLNQQAI--VVCGDASKPDEWLAEIGKSAALLDAPCSATGV
RSMB_ERWT9      TTHILEAAAKVMAVDVDAQRLARVSENLQRLTMQA--EVKQGDGRTPDTQFDRI-----LLDAPCSATGV
RSMF_PSEHT      TSQLAALGV-LVANELSSSRLKVLSATLKRMGLSHFDGVIF--GNYMFECFDSI-----LLDAPCSGEGT
RSMB_XYLFA      AAHLLERALCLTALDVDMQRLRRVAETCDR--IHVKARLCVADATDLAAWWDGEAFDAVLLDAPCSATGV
NCL1_SCHPO      TAQLLEAGI-VIANDSDNKRAHMLVHQIKRLNSPNVL-IVNHDASFLPNDGKKLKFDRILADVPCSGDGT
TRUB_NANEQ      ----------------------------------------------------------------------
RSMB_XYLFT      AAHLLERALCLTALDVDMQRLRRVAETCDR--IHVKARLCVADATDLAAWWDGEPFDAVLLDAPCSATGV
RSMB_SALPB      TTHIXXXXXXXXXXXXXXQRLSRVYDNLKRLGMKA--TVKQGDGRYPAQWCGEQQFDRILLDAPCSATGV
TGS1_MOUSE      TIQFALTGKRVIAIDIDPVKIDLARNNAEVYGIADKIEFICGDFLLL---APCLKADVVFLSPPWGG---
TGS1_RAT        TIQFALTGKRVIAIDIDPVKIDLARNNAEVYGVADKIEFICGDFLLL---APCLKADVVFLSPPWGG---
NCL1_YEAST      TAQLIEALHKVVANDADARRSHMLVHQLKRLN-SANLMVVNHDAQF----FPRIKFDRILCDVPCSGDGT
RSMB_XANCP      AAHLLERHLQLTALDVDARRLERVRQTVQRTAPDRTVRLHPXXXXXXXXXXXGQPFDAVLLDAPCSATGV
TRUB_SULTO      ----------------------------------------------------------------------
NSUN4_XENTR     -----------------------------------------------------------LVDVPCTTLEE
TRUB_THEGJ      ----------------------------------------------------------------------
TGS1_HUMAN      TIQFALTGMRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLL---ASFLKADVVFLSPPWGG---
TRUB_PYRKO      ----------------------------------------------------------------------
NSUN2_CHICK     TAQLIEMGF-VIANDVDNKRCYLLVHQAKRLNSPCIM-VVNHDASSI----PNLQVDVILCDVPCSGDGT
TRUB_PYRFU      ----------------------------------------------------------------------
TRUB_PYRHO      ----------------------------------------------------------------------
TRUB_METKA      ----------------------------------------------------------------------
NSUN4_XENLA     -----------------------------------------------------------LVDVPCTTLEE
TRUB_SULSO      ----------------------------------------------------------------------
TRUB_PYRAB      ----------------------------------------------------------------------
NSUN4_MOUSE     TLALLQTGCNLAANDLSTSRTGRLQKVLSYVPQDIREGNQVRVTSWDGRKWGELEGDTVLVDVPCTTDRH
TRUB_METJA      ----------------------------------------------------------------------
RRMT_AZOSB      TWQLAQRGIRVTAID-------------------------------------------------------
NSUN3_HUMAN     SIALLQCACPGYL---HCNEYDSLRLRWLRQTLESFIPQPLIDGRKMGDAQPEMFDKV-LVDAPCSND--
TRUB_PYRAR      ----------------------------------------------------------------------
NSUN3_MOUSE     SVALLQCAYPGYLL---CNEYDRPRGRWLRQTLESFIPQPLIDGREMGDAQPATFDKV-LVDAPCSND--
NSUN3_DANRE     SLAILQTALHCNEVDQHRHDLLKTLESYVPPSLRHLLSVTLQDGRSIGTMQPGAYDKV-LVDAPCSND--
NSUN3_BOVIN     SLALLQCAYPGYL---HCNEYDSLRLRWLRQTLESFIPQPLVDGREMGDAQPETFDKV-LVDAPCSND--
TRUB_HALMA      ----------------------------------------------------------------------
CBF5_EMENI      ----------------------------------------------------------------------
CMOA_PASMU      TLHINQPGVKIIGVDNSQPMVDRCRQHVSAYQSTIPVDIICDDIRHIE----------------------
RSMF_SHELP      ----------------------------------------------------------------------
RSMF_VIBPA      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RPKIYHKVTFEAAKTLARYQIQFLKTALKIAPYVIYSTCTLTYIENEGVIEKAGAEIVDAGIEIGAPGWG
NSUN6_HUMAN     RPNM---ACTWSVKEVASYQQRKLFTALKPEGVLVYSTCTITLAENEEQVAWALTKFPCLQLQPQEPGLS
NSUN6_MOUSE     RPNMACTWTLKEVTSYQPLQRKLLHVALKPGGVLVYSTCTITLAENE-----------------------
NOP2_HUMAN      ISKDPAVKTNKDEKDILRLQKELLLSAIKTGGYLVYCTCSITVEENEWVVDKRNVRLVPTGLDFGQEGFS
NOP2_MOUSE      ISKDPAVKTNKDEKDIQRCAIDSVNAASKTGGYLVYCTCSITVEENEWVVDKRNVRLVPTGLDFGQEGFT
NOP2_SCHPO      IYKDQSVKTNKSERTLSHLQRQLLLSAIKTGGFIVYSTCSITVDEDEAVIQYANVKLVSTGLEFGREGFS
RSMB_SYNY3      NPDLRWRQTPATIATLLPLQQALLKA---IAPLVVYSTCTLNPAENEAQIERFLQDHEDWRSEQGQTNSV
NOP2_YEAST      IGKDQSVKVSRTEKDIPHLQKQLLLSAIKHGGVIVYSTCSVAVEEDEAVIDYANVKLVDTGLAIGKEAFS
RSMB_BACSU      KPDMKYTKKPDDSARLAEIQLSILR---EIAPLVVYSTCTMDRTENDEVIHAFIQEHPDFEPDLSLEKRL
RSMF_SHELP      RKKHWDESEIEAIASVQRDLIESAFLALKPGGSLVYSTCTLNRRENQDVCLHLKATYGDAGLFPGAEKAS
RSMB_COXBU      IRRHPDIKLLRQPGDISQYHLNALWTVLKAGGFLLYSTCSVLPDENEKVIEE------------------
RSMB_SODGM      HPDIKWLRRDGDIAELAELQRQILCAALKLGGTLLYATCSILPEENRGQIAAFLADHPDALLDAAAPGLQ
RSMF_SHEPW      DPDALKNWDNNDVKGIVDTQKALIDSALKAGGELVYSTCALSRQENQNVCDYLKQRYPDANLSSLFPGKS
RSMB_KLEP7      HPDIKWLRRDRDIAELAQLQAEILNAILKPGGTLVYATCSILPEENSQQIAAFLARTPDA--ELHATGTP
RSMF_ALISL      DPDAMHNWSPESVIEIGDTQRDLIKSALKPGGVMVYSTCTLNHEENQNICHHLVTEFGDAVFENAEKALT
RSMF_SHESH      DPLALNNWGLAENSAIAETQKALLESALKTGGSLVYSTCALSKLENQDVCEHLRSTFPEA-VEFESADKA
RSMB_KLEP3      HPDIKWLRRDRDIAELAQLQAEILNSTLKPGGTLVYATCSILPEENSQQISAFLARTPDA--ELHATGTP
RSMF_VIBF1      DPDAMHNWSPESVIEIGDTQRDLIESALKLGGVMVYSTCTLNHEENQNICHHLVEQFGDAVFESAEKALT
RSMF_SERP5      DPDAMSNWSPESVTAIADTQRELIDSAFHLAPVMVYSTCTLNAQENQQIVNGLLATYGDASIELGDLFPG
RSMB_YERE8      HPDIKWLRRDSDIAELAQLQSEIIEAKLKKGGVMVYATCSILPEENQQQIRHSEADLVETG-TVSALG--
RSMB_PROMH      HPDIKWLRRNEDIAQLAQIQKEILHAILKSGGTLVYATCSILPEENSQQIAAFLSSMQDA---------Q
RSMF_ERWT9      VRKALRNWSQSSTEEIAATQQALINSALRPGGTLVYSTCTLNTRENQQVVNGLLEQYPDAGAERATTAEG
RSMF_ERWCT      DPAAMSHWSQESITDIAATQRDLILSALKPGGVMIYSTCTLNRQENQQVCRWLQAQFPDADLFAGAERAT
RSMF_KLEP7      VRKDADALSPESNLDIAATQRELIDSALRPGGTLVYSTCTLNREENQSVIEPQAVEILPLG-ELFPGAAD
RSMB_SALAR      HPDIKWLRRDRDIAELAKLQAEILDTVLKPGGTLVYATCSVLPEENSAQINAFLQRTPDAALETGTPD--
RSMF_VIBCM      DPDAMKNWSLESIQSIANTQKALIESALKVGGTLVYSTCTLSREENQQVFESLGNLFEHASLALTEEGF-
RSMF_VIBCH      DPDAMKNWSLESIQSIANTQKALIESALKVGGTLVYSTCTLSREENQQVFESLGNLFEHASLALTEEGF-
Y026_METJA      KDK-NRNVSEEDIKYCSLRQKELIDIGLKKDGELVYSTCSMEVEENEEVIK-------------------
RSMF_SHEHH      IRKNDNKGIVDTQKAL----IESAFLALKVGGCLVYSTCALSRQENQDVCHHLKTAFGEA-VEFAAADKA
RSMB_PSEPK      HPDI--KMTIPALATLQGELLDALWPTLEVGGMLLYATCSTLPTENTEVIKTPGARELDLATEAG-----
RSMF_VIBFM      DPDAMHNWSPESVIEIGDTQRDLIESALKPGGVMVYSTCTLNHEENQNICHHLVEQFGDAVFENAEKALT
RSMF_SALTY      DPDALKNWSPESNLDIAATQRELLDSALRPGGTLVYSTCTLNRQENEAVLKETYADAVDADRALTPEGF-
RSMF_SALTI      DPDALKNWSPESNLDIAATQRELLDSALRPGGTLVYSTCTLNRQENEAVLKETYADAVDADRALTPEGF-
RSMF_SALSV      DPDALKNWSPESNLDIAATQRELLDSALRPGGTLVYSTCTLNRQENEAVLKETYADAVDADRALTPEGF-
RSMF_SALPC      DPDALKNWSPESNLDIAATQRELLDSALRPGGTLVYSTCTLNRQENEAVLKETYADAVDADRALTPEGF-
RSMF_SALPB      DPDALKNWSPESNLDIAATQRELLDSALRPGGTLVYSTCTLNRQENEAVLKETYADAVDADRALTPEGF-
RSMF_SALNS      DPDALKNWSPESNLDIAATQRELLDSALRPGGTLVYSTCTLNRQENEAVLKETYADAVDADRALTPEGF-
RSMF_SALCH      DPDALKNWSPESNLDIAATQRELLDSALRPGGTLVYSTCTLNRQENEAVLKETYADAVDADRALTPEGF-
RSMF_PECCP      DPAAMSHWSPESITEIAATQRDLILSALKPGGVMIYSTCTLNKQENQQVCHWLQAQFPDA-CEFESLRDL
RSMB_VIBCH      HPDIKWLRRADDIAALAELQREILDAQLKPGGSLVYATCSITPQENRLQVKAFLERTPDAGSDPAQPG--
RSMB_SHEON      HPDIKWLRKNHDIEELAELQRQILDHCLKPGGTLLYATCSILPQENRDQISAFLARTADAKLDTLVQGW-
RSMF_SHESM      VRKDADALVLEISET-QKALIESAFLALKPGGSLVYSTCTLNRHENQGVCEYLQQTYGDAGAEKATTPEG
RSMF_SALPK      DPDALKNWSPESNLDIAATQRELLDSALRPGGTLVYSTCTLNRQENEDVLKETYADAVDADRALTPEGF-
RSMF_SALPA      DPDALKNWSPESNLDIAATQRELLDSALRPGGTLVYSTCTLNRQENEDVLKETYADAVDADRALTPEGF-
RSMF_SALHS      DPDALKNWSPESNLDIAATQRELLNSALRPGGTLVYSTCTLNRQENEEVLKETYADAVDADRALTPEGF-
RSMF_SALG2      DPDALKNWSPESNLDIAATQRELLNSALRPGGTLVYSTCTLNRQENEEVLKETYADAVDADRALTPEGF-
RSMF_SALEP      DPDALKNWSPESNLDIAATQRELLNSALRPGGTLVYSTCTLNRQENEEVLKETYADAVDADRALTPEGF-
RSMF_SALDC      DPDALKNWSPESNLDIAATQRELLNSALRPGGTLVYSTCTLNRQENEEVLKETYADAVDADRALTPEGF-
RSMF_PSYIN      RKDKYNNWSQSSINEIASTQQELILSALKEDGILIYSTCTLSHEENQDICDKFPEHIEFLDLELFTDAKK
RSMF_ECOUT      DPDALKNWSPESNQEIAATQRELIDSALRLGGTLVYSTCTLNREENEAVCLWLKETYHDAFLPLGDLFPG
RSMF_ECOK1      DPDALKNWSPESNQEIAATQRELIDSALRLGGTLVYSTCTLNREENEAVCLWLKETYHDAFLPLGDLFPG
RSMF_ECO45      DPDALKNWSPESNQEIAATQRELIDSALRLGGTLVYSTCTLNREENEAVCLWLKETYHDAFLPLGDLFPG
RSMF_CITK8      DPDALKNWSVESNLDIAATQRELIDSALRPGGTLVYSTCTLNREENESVLKETYPEAVEPGAERALTAEG
RSMB_YERPY      HPDIKWLRRDRDISELAQLQSEIIEAKLKHGGVLVYATCSILPEENQQQIRHPEAQLTETG-TTAAPG--
RSMB_YERPS      HPDIKWLRRDRDISELAQLQSEIIEAKLKHGGVLVYATCSILPEENQQQIRHPEAQLTETG-TTAAPG--
RSMB_YERPP      HPDIKWLRRDRDISELAQLQSEIIEAKLKHGGVLVYATCSILPEENQQQIRHPEAQLTETG-TTAAPG--
RSMB_YERPN      HPDIKWLRRDRDISELAQLQSEIIEAKLKHGGVLVYATCSILPEENQQQIRHPEAQLTETG-TTAAPG--
RSMB_YERPG      HPDIKWLRRDRDISELAQLQSEIIEAKLKHGGVLVYATCSILPEENQQQIRHPEAQLTETG-TTAAPG--
RSMB_YERPE      HPDIKWLRRDRDISELAQLQSEIIEAKLKHGGVLVYATCSILPEENQQQIRHPEAQLTETG-TTAAPG--
RSMB_YERPB      HPDIKWLRRDRDISELAQLQSEIIEAKLKHGGVLVYATCSILPEENQQQIRHPEAQLTETG-TTAAPG--
RSMB_YERPA      HPDIKWLRRDRDISELAQLQSEIIEAKLKHGGVLVYATCSILPEENQQQIRHPEAQLTETG-TTAAPG--
RSMB_YERP3      HPDIKWLRRDRDISELAQLQSEIIEAKLKHGGVLVYATCSILPEENQQQIRHPEAQLTETG-TTAAPG--
RSMB_SHIB3      HPDIKWLRRDRDIPELAQLQSEILDAILKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGAPE--
RSMB_SALPK      HPDIKWLRRDRDIAELAQLQAEILDTVLKPGGTLVYATCSVLPEENRDQIKTFLQRTPDAALETGTPD--
RSMB_SALPA      HPDIKWLRRDRDIAELAQLQAEILDTVLKPGGTLVYATCSVLPEENRDQIKTFLQRTPDAALETGTPD--
RSMB_ECO27      HPDIKWLRRDRDIPELAQLQSEILDAILKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMF_SHIDS      DPDALKNWSPESNQEIAATQRELIDSALRLGGTLVYSTCTLNREENEAVCLWLKETYPDAFLPLGDLFPG
RSMF_SHEON      RKDVDALKSWSLDEVIAKALIESAFLALKPGGSLVYSTCTLNRHENQGVCEESLSQLFDGADKATTP---
RSMF_SHEDO      VRKDQNALKLDDVIAIADTQKDLIEAALKPGGALVYSTCTLSQLENQAICQHLLSRYPEAATLFDGAAKA
RSMF_SHEAM      SLKNWCPDEIEAIAELQRDLIDSAFQALKPGGVLVYSTCTLNRRENEDVCERYGDAVVFESLNKGADKAL
RSMF_KLEP3      VRKDADALSPESNLDIAATQRELIDSALRPGGTLVYSTCTLNREENQSVVQPQAVEILPLGFSGAADALT
NSUN5_MOUSE     LSRQLEEPSKERLQALAGFQQRALCHALRFPSLLVYSTCSLCQEENEDVVQEALQH--NSGLAPVLPTWG
RSMF_SALA4      DPDALKNWSPESNLDIAATQRELLDSALRPGGTLVYSTCTLNRQENEEVLKETYADAVEXXXXXXXXXXX
RSMB_SHISS      HPDIKWLRRDRDIPELAQLQSEILDAILKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMB_ESCF3      HPDIKWLRRDRDIPELAQLQSEILDAILKSGGILIYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMF_SHESR      VRKDADALVLEISET-QKALIESAFLALKPGGSLVYSTCTLNRHENQGVCEESLSQLFDGAEKATTP---
RSMF_SHESA      VRKDADALVIEISET-QKALIESAFLALKPGGSLVYSTCTLNRHENQGVCEESLSQLFDGAEKATTP---
RSMB_SALTY      HPDIKWLRRDRDIAELAQLQAEILDAVLKPGGTLVYATCSVLPEENRDQIKTFLQRTPDAALETGTPD--
RSMB_SALNS      HPDIKWLRRDRDIAELAQLQAEILDAVLKPGGTLVYATCSVLPEENRDQIKAFLQRTPDAALETGTPD--
RSMB_SALDC      HPDIKWLRRDRDIVELAQLQAEILDAVLKPGGTLVYATCSVLPEENRDQIKTFLQRTPDAALETGTPD--
RSMB_ECOLU      HPDIKWLRRDRDIPELAQLQSEILDAILKSGGTLIYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMB_ECOLI      HPDIKWLRRDRDIPELAQLQSEILDAILKTGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMB_ECOLC      HPDIKWLRRDRDIPELAQLQSEILDAILKTGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMB_ECOHS      HPDIKWLRRDRDIPELAQLQSEILDAILKTGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMB_ECODH      HPDIKWLRRDRDIPELAQLQSEILDAILKTGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMB_ECOBW      HPDIKWLRRDRDIPELAQLQSEILDAILKTGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMF_SHEB9      VRKDADALSLDDVLAISETQKALIESALKPGGSLVYSTCTLNRLENQGVCEYLKQVYGDAGAERATTAEG
RSMF_ECO5E      DPDALKNWSPESNQEIAATQRELIDSALRSGGTLVYSTCTLNREENESVCLWLKETYPDAFLPLGDLFPG
RSMF_ECO57      DPDALKNWSPESNQEIAATQRELIDSALRSGGTLVYSTCTLNREENESVCLWLKETYPDAFLPLGDLFPG
RSMB_VIBPA      HPDIKWLRRADDIAALAELQSEIFDTQLKPGGTMVYATCSITPQENVEQVKAFLARTADAQLLDSDPD--
RSMB_SHIDS      HPDIKWLRRDRDIPELAQLQSEILDAILKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMB_SHIBS      HPDIKWLRRDRDIPELAQLQSEILDAILKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMB_ECOUT      HPDIKWLRRDRDIPELAQLQSEILDSHLKSGGTLVYATCSMLPEENSLQIKAFLQRTADAELETGTPE--
RSMB_ECOSM      HPDIKWLRRDRDIPELAQLQSEILDAILKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMB_ECOSE      HPDIKWLRRDRDIPELAQLQSEILDAILKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMB_ECOK1      HPDIKWLRRDRDIPELAQLQSEILDSHLKSGGTLVYATCSMLPEENSLQIKAFLQRTADAELETGTPE--
RSMB_ECO8A      HPDIKWLRRDRDIPELAQLQSEILDAILKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMB_ECO5E      HPDIKWLRRDRDIPELAQLQSEILDAILKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMB_ECO57      HPDIKWLRRDRDIPELAQLQSEILDAILKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMB_ECO55      HPDIKWLRRDRDIPELAQLQSEILDAILKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMB_ECO45      HPDIKWLRRDRDIPELAQLQSEILDSHLKSGGTLVYATCSMLPEENSLQIKAFLQRTADAELETGTPE--
RSMB_ECO24      HPDIKWLRRDRDIPELAQLQSEILDAILKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMF_SHISS      DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNQEENEAVCLWLKETYPDAFLPLGDLFPG
RSMF_SHIBS      DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNQEENEAVCLWLKETYPDAFLPLGDLFPG
RSMF_SHIB3      DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNQEENEAVCLWLKETYPDAFLPLGDLFPG
RSMF_SHEWM      DPLALRNWSLEENASIIETQKALIESALKTGGSLVYSTCALSRSENQEVCEQSLSELFDADKSCTSEGF-
RSMF_SHEB2      RKDVDALKHWSLDDVLAKALIESAFLALKPGGSLVYSTCTLNRLENQGVCEYLKQVYGDAGAERATTAEG
RSMF_ECOSE      DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNQEENEAVCLWLKETYPDAFLPLGDLFPG
RSMF_ECOLI      DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNQEENEAVCLWLKETYPDAFLPLGDLFPG
RSMF_ECOL5      DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNREENEAVCLWLKETYPDAFLPLGDLFPG
RSMF_ECODH      DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNQEENEAVCLWLKETYPDAFLPLGDLFPG
RSMF_ECOBW      DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNQEENEAVCLWLKETYPDAFLPLGDLFPG
RSMF_ECO8A      DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNQEENEAVCLWLKETYPDAFLPLGDLFPG
RSMF_ECO7I      DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNREENEAVCLWLKETYPDAFLPLGDLFPG
RSMF_ECO55      DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNQEENEAVCLWLKETYPDAFLPLGDLFPG
RSMF_ECO24      DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNQEENEAVCLWLKETYPDAFLPLGDLFPG
RSMB_SALTI      HPDIKWLRRDRDIAELAQLQAEILDAVLKPGGTLVYATCSVLPEENRDQIKAFLQRTPDAALETGTPD--
RSMB_SALPC      HPDIKWLRRDRDIAELAQLQAEILDAVLKPGGTLVYATCSVLPEENRDQIKTFLQRTPDAALETGTPD--
RSMB_SALHS      HPDIKWLRRDRDIAELAQLQAEILDAVLKPGGTLVYATCSVLPEENRDQIKTFLQRTPDAALETGTPD--
RSMB_SALG2      HPDIKWLRRDRDIAELAQLQAEILDAVLKPGGTLVYATCSVLPEENRDQIKTFLQRTPDAALETGTPD--
RSMB_SALEP      HPDIKWLRRDRDIAELAQLQAEILDAVLKPGGTLVYATCSVLPEENRDQIKTFLQRTPDAALETGTPD--
RSMB_SALCH      HPDIKWLRRDRDIAELAQLQAEILDAVLKPGGTLVYATCSVLPEENRDQIKTFLQRTPDAALETGTPD--
RSMB_ECOL6      HPDIKWLRRDRDIPELAQLQSEILDSHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMB_ECO81      HPDIKWLRRDRDIPELAQLQSEILDSHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMB_ECO7I      HPDIKWLRRDRDIPELAQLQSEILDAILKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMF_PHOPR      IRKDWSLSSIEDIAAIQRNLIISAFQALKTGGMMVYSTCTLNLSENQHVCHFLKETFGDA-VEFEPLGDL
RSMF_ECOSM      DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNREENEAVCLWLKETYPDAFLPLGDLFPG
RSMF_ECO81      DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNREENEAVCLWLKETYPDAFLPLGDLFPG
RSMF_ECO27      DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNREENEAVCLWLKETYPDAFLPLGDLFPG
RSMB_VIBVY      HPDIKWLRRAEDITALAQLQSEIMWAQLKPGGTLVYATCSITPMENVEQVKAFLARTPAAGSERENPG--
RSMF_SHEB8      VRKDADALSLDDVLAISETQKALIESALKPGGSLVYSTCTLNRLENQGVCEYLKQVYGDAGAERATTAEG
RSMF_SALAR      DPDALKNWSPESNLDIAATQRELLESALRPGGTLVYSTCTLNRQENEAVLKETYTDAVDADRALTPEGF-
RSMF_ENTS8      DPDALRNWSPQSDQEIAATQRELIDSAFALAPTLVYSTCTLNREENQETVRWLLARYPQASLEALFPGAD
RSMF_ENT38      DPDALKNWSVASNLEIAATQRELIDSALRPGGMLVYSTCTLNRDENESV---------------------
RSMF_ECOLU      DPDALKNWSPESNQEIAATQRELIDSAFHLCPTLVYSTCTLNQEENEAVCRWLKETYPDAFLPLGDLFPG
RSMF_ECOLC      DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNREENEAVTYPDAVEFLPLGELFPAANKA
RSMF_ECOL6      DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNREENEAVCLWLKETYHDAFLPLGDLFPG
RSMF_ECOHS      DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNREENEAVTYPDAVEFLPLGELFPAANKA
RSMB_VIBVU      HPDIKWLRRAEDITALAQLQSEIMWAQLKPGGTLVYATCSITPMENVEQVKTSAAQLV--GSERENPG--
RSMB_PHOLL      HPDIKWLRREEDIAQLVQLQSEILDAILKKSGTLVYATCSILPDENCQQISSFLKRHSDAKL----AGTE
NSUN5_HUMAN     PSRQLEEPGAGTPSALAGFQQRALCHALTFPSLLVYSTCSLCQEENEDVVRDALQQNPGARLAPALPAWG
RSMF_ESCF3      DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNREENEAVCLWLKETYPDAFLPLGDLFPG
RSMF_AERHH      VRKALRNWSIESIDEIAAVQQGLLESALKPGGVLVYSTCTLSLQENQAVLDKFGAAFFDSLADLFPAAEQ
RSMB_SHIFL      HPDIKWLRRDRDIPELAQLQSEILDAILKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMB_SALSV      HPDIKWLRRDRDIAELAQLQAEILDAVLKPGGTLVYATCSVLPEENRDQIKTFLQRTPDAALETGTPD--
RSMB_PSEAE      HPDIKLARKPEDIAALAHLQGELLDATLEVGGVLLYATCSVMPAENSDSIAAFLARTPGAR-ELDLPGWG
RSMB_HAEDU      HPDIKWLRQAGDISELVELQAKILSARLKPNGTLVYATCSILPAENEQIIQFITANPDAELIEMDFNGEK
RSMB_ECOL5      HPDIKWLRRDRDIPELAQLQSEILDSHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
YEY6_SCHPO      VSRQDYLLDTERLENLCSFQSTILKHALQFCRHVTYSTCSVHRLENEQVV----CEVLSQ-----EPDWK
RSMF_SHEPA      DPDALKNWDNNDDKGIVETQKALIESALKVGGSLVYSTCALSRQENQDVCHHLKSLYGDA-VEFGSADKA
RSMF_SHEFN      DPLALKHWDIDDVTAIGETQKDLIESALKPGGILVYSTCTLSQLENQHILQQTYPDAVEAELFDGADK-A
RSMF_SHEB5      VRKDADALSLDDVLAISETQKALIESALKPGGSLVYSTCTLNRLENQGVCEYLKQVYGDAGADRATTAEG
RSMF_AERS4      VRKALRNWSIESIDEIAAVQQGLLESALKPGGVLVYSTCTLSQQENQAVLEKFGALTLDSLADLFPNAEQ
RSMB_SHIF8      HPDIKWLRRDRDIPELAQLQSEILDAILKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
RSMB_SALA4      HPDIKWLRRDRDIAELAQLQAEILDAVLNPGGTLVYATCSVLPEENRDQIKAFLQRTPDAALETGTPD--
RSMF_SHESW      VRKLKHWSLNDAISETQKALIESAFLALKPGGSLVYSTCTLNRLENQGVCEYLKQTYGDAGAERATTPEG
RSMF_SHEPC      VRKLKHWSLNDAISETQKALIESAFLALKPGGSLVYSTCTLNRLENQGVCEYLKQTYGDAGAERATTPEG
RSMB_ERWCT      HPDIKWLRRDRDIEELVALQKEILDAILKTGGTMVYATCSILPQENTQQVRHADAALVDTGTS-EIPG--
RSMF_VIBPA      VRKDEDAMTQASVLEIADTQKDLIESALKPGGVLVYSTCTLSTEENDGLFENANAALTEEGF--------
RSMB_XANAC      QPDVLLHRRADDIEALCALQARLLDATLRPGGQLLYTTCSLLARENQAQVEAFLQRTPDARAQLGAQGHA
RSMB_PECCP      IRRLRRDRDIEELVALQKEIFDAIWPHLKVGGTMVYATCSILPQENDFLTRHADATLVDTGTR-ELPG--
RSMB_ENTS8      HPDIKWLRRDSDINELAQLQSEILDAILKPGGTLLYATCSVLPEENSEQIRAFLSRTPDAQLD----GTG
RSMB_PASMU      IRRLRQASDISALVALQKQILQALWTVLKPNGILLYATCSVLPEENALQIEQFLTNNVDAKLEEGSVGY-
RSMB_CITK8      HPDIKWLRRDRDIAELAKLQSEILDAILKSGGTLVYATCSVLPEENSQQILAFLQRTPDA--TLTGTGTP
RSMF_VIBHB      VRKDEDAMTQSSVVEIADTQKDLIESALKPGGVMVYSTCTLSTEENQQVCHHLKETFGDAVFENAEAALT
NSUN2_DROME     NPDIWLKWNLAQAYNLHGIQYRIVRRGLEVGGRLVYSTCSLNPIENEAVLQRGALELVDAGYKPGMTDWG
RSMF_SHIFL      DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNREENEAVCRWLKETYPDEFLPLGDLFPG
RSMF_SHIF8      DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNREENEAVCRWLKETYPDEFLPLGDLFPG
RSMF_VIBVY      VRKDEDAMSQESVLEIAATQKDLIESALKPGGVMVYSTCTLSEEENQQVCHHLKHTFGDAGAEKALTEDG
RSMF_VIBVU      VRKDEDAMSQESVLEIAATQKDLIESALKPGGVMVYSTCTLSEEENQQVCHHLKHTFGDAGAEKALTEDG
RSMF_VIBSL      IRKDADAMTYQSVVDIADTQKDLIESALKPNGVLVYSTCTLSTEENQQVCHHLKETFGDASLFDNAKATT
RSMB_ENT38      HPDIKWLRRDRDINELAQLQSEILDAVLKPGGTLVYATCSVLPEENSQQIAAFLKRTSNATLR--TTGTP
RSMB_SERP5      IRRLRRDSDXXXXXXXXXXXXXXXWPHLKSGGVMVYATCSILPAENAEQVRHADARLVETGNQ-QQPG--
RSMB_PSESM      HPDIKLTRQLDDIAALATLQGELLDATLQVGGMLVYATCSTLPTENTDVIETSGARELDIAGQAGQPPAG
RSMB_HAEIN      IRRLRKETDIAQLVELQKKILSALWEKLKPNGVLLYATCSVLPEENCEQIQHADAELLSLPFSDDKSAVG
RSMB_ERWT9      HPDIKWLRRDRDIAELAALQQQILDAVLKPGGTLLYATCSVLPEENHVQIRHADATLIETG-DLTQPG--
RSMF_PSEHT      VRKDADALSIDSNIEIAQVQKDLIKSALKPGGTLVYSTCTLTPLENQHVCDFLLSEFGD-----------
RSMB_XYLFA      QPDVLLHRRAEDLLPLLNIQSRLLDATLRPGGVLVYVTCSVLRAENQTQLEAFLARTVDACAEDPGDAYG
NCL1_SCHPO      FRKLWNEWSLKTALGLHATQIKILMRGLQLLEKLVYSTCSLNPIENEAVVSRGSVRLVDVSSELGVDNWN
TRUB_NANEQ      ----------------------------------------------------------------------
RSMB_XYLFT      QPDVLLHRRAEDLLPLLNIQSRLLDATLRPGGVLVYVTCSVLRAENQTQLEAFLARTADACAEDPGDAYG
RSMB_SALPB      HPDIKWLRRDRDIAELAQLQAEILDAVLKPGGTLVYATCSVLPEENRDQIKTFLQRTPDAALETGTPD--
TGS1_MOUSE      -PDYATAETFDIRTMMSPDGFEIFRLSQKITNNIVY----------------------------------
TGS1_RAT        -PDYATAETFDIRTMMSPDGFEIFRLSQKITNNIVY----------------------------------
NCL1_YEAST      MRKVWKDWNTQAGLGLHAVQLNILNRGLHLLKNLVYSTCSLNPIENEAVVAEAGDKIRLVNCDDKLPGFN
RSMB_XANCP      QPDVLLHRRADDIDALCALQARLLEACLRPGGQLLYTTCSLLKRENQTQIEAFLQRTADAQAQLGAQGHA
TRUB_SULTO      ----------------------------------------------------------------------
NSUN4_XENTR     ENNIFHRIRTKQRQMLPLLQAELLVAGLRVRPEVVYSTCSLSQLQNECVVERA-VELADHGVHVKPQDQG
TRUB_THEGJ      ----------------------------------------------------------------------
TGS1_HUMAN      -PDYATAETFDIRTMMSPDGFEIFRLSKKITNNIVY----------------------------------
TRUB_PYRKO      ----------------------------------------------------------------------
NSUN2_CHICK     MRKVWKKWTTQNSLQLHGLQLRIATRGLAEGGRMVYSTCSLNPIENEAVISQGALELADVSSELGITKWN
TRUB_PYRFU      ----------------------------------------------------------------------
TRUB_PYRHO      ----------------------------------------------------------------------
TRUB_METKA      ----------------------------------------------------------------------
NSUN4_XENLA     ENNIFHRIRTKQRQMLPLLQTELLVSGLRVRPEVVYSTCSLSQLQNECVVQRA-----------------
TRUB_SULSO      ----------------------------------------------------------------------
TRUB_PYRAB      ----------------------------------------------------------------------
NSUN4_MOUSE     SLHEEENNIFQRSRKKERQMLPMLQVQXKPGGHVVYSTCSLSHLQNEYVVQGA-----------------
TRUB_METJA      ----------------------------------------------------------------------
RRMT_AZOSB      ----------------------------------------------------------------------
NSUN3_HUMAN     RSWLFSSDSQKASRNLPLLQIELLRSAIKAGGILVYSTCTLSKAENQDVISE------------------
TRUB_PYRAR      ----------------------------------------------------------------------
NSUN3_MOUSE     RSWLFSSDSQKAAKNLPVLQVELVRSAIKAGGLLVYSTCTLSKAENQDVISE------------------
NSUN3_DANRE     RSWLYTPDTHRGEMWLKRTQLPLLQAAVRPGGIVVYSTCTMSRAENQSVVEEVLASY--PGVEL------
NSUN3_BOVIN     RSWLFSSDSQKAARNLPLLQMELLRSAIKAGGLLVYSTCTLSKAENQDVISE------------------
TRUB_HALMA      ----------------------------------------------------------------------
CBF5_EMENI      ----------------------------------------------------------------------
CMOA_PASMU      ----------------------------------------------------------------------
RSMF_SHELP      ----------------------------------------------------------------------
RSMF_VIBPA      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           CRECRRFLPHVHNTPGFFIAVLRGARKEP
NSUN6_HUMAN     CKQLQRFDPSAVPLPDTDMDSLREARRE-
NSUN6_MOUSE     -----------------------------
NOP2_HUMAN      LRSTRRFYPHTHNMDGFFIA---------
NOP2_MOUSE      LRSTRRFYPHTHNMDGFFIA---------
NOP2_SCHPO      LKLTRRYYPHVHNIDGFFVAKLK------
RSMB_SYNY3      TSGMLTILPHHHHQDGFFIANLKKA----
NOP2_YEAST      VKLARRYYPHTYNVDGFFVA---------
RSMB_BACSU      PEKVRPFLPHYFGTDGFFICSMR------
RSMF_SHELP      TSEFLHVWPQIFDSEGFFIAKL-------
RSMB_COXBU      -----------------------------
RSMB_SODGM      C------LPVPTSGDGFFYA---------
RSMF_SHEPW      CTE-EGFLPQIYDSEGFFVAKIK------
RSMB_KLEP7      ASPGQQNLPGVEEGDGFFYAKL-------
RSMF_ALISL      KEGFLHIYPQIFDSEGFFVAKIR------
RSMF_SHESH      CTD-EGFLPQIYDSEGFFIA---------
RSMB_KLEP3      ASPGQQNLPGPEEGDGFFYAKL-------
RSMF_VIBF1      KEGFLHIYPQIFDSEGFFVAKIR------
RSMF_SERP5      AKQALHVFPQIYDSEGFFVARLRKHHSVP
RSMB_YERE8      ----RQNLPHPEDGDGFYYAKL-------
RSMB_PROMH      CDYQHQCLPEQYSGDGFFYALI-------
RSMF_ERWT9      ---YLHVFPHIFDSEGFFVARLRKVASVP
RSMF_ERWCT      TEEFLHVFPQIYDSEGFFVARLRKTGSVP
RSMF_KLEP7      ALTAEGFLPQIYDCEGFFVARLR------
RSMB_SALAR      -QPGQQNLPGAEEGDGFFYAKL-------
RSMF_VIBCM      ----LHIFPQMYDCEGFFVAKIRKLASVP
RSMF_VIBCH      ----LHIFPQMYDCEGFFVAKIRKLASVP
Y026_METJA      -----------------------------
RSMF_SHEHH      CTE-EGFLPQIYDSEGFFVAKIR------
RSMB_PSEPK      -----------------------------
RSMF_VIBFM      KEGFLHIYPQIFDSEGFFVAKIR------
RSMF_SALTY      ----LHVFPQIYDCEGFFVARLR------
RSMF_SALTI      ----LHVFPQIYDCEGFFVARLR------
RSMF_SALSV      ----LHVFPQIYDCEGFFVARLR------
RSMF_SALPC      ----LHVFPQIYDCEGFFVARLR------
RSMF_SALPB      ----LHVFPQIYDCEGFFVARLR------
RSMF_SALNS      ----LHVFPQIYDCEGFFVARLR------
RSMF_SALCH      ----LHVFPQIYDCEGFFVARLR------
RSMF_PECCP      FTDAERVFPQIYDSEGFFVARLRKTASVP
RSMB_VIBCH      ----RQILPGEEAMDGFYYAVL-------
RSMB_SHEON      -----QITPGQHNMDGFYYARL-------
RSMF_SHESM      ---FLHVWPQIYDSEGFFVAKLTKTRSVP
RSMF_SALPK      ----LHVFPQIYDCEGFFVARLR------
RSMF_SALPA      ----LHVFPQIYDCEGFFVARLR------
RSMF_SALHS      ----LHVFPQIYDCEGFFVARLR------
RSMF_SALG2      ----LHVFPQIYDCEGFFVARLR------
RSMF_SALEP      ----LHVFPQIYDCEGFFVARLR------
RSMF_SALDC      ----LHVFPQIYDCEGFFVARLR------
RSMF_PSYIN      TRTAEGFLPQVYDSEGFFVAAIK------
RSMF_ECOUT      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_ECOK1      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_ECO45      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_CITK8      ---FLHVFPQIYDCEGFFVARLR------
RSMB_YERPY      ----KQNLPHPEDGDGFFYA---------
RSMB_YERPS      ----KQNLPHPEDGDGFFYA---------
RSMB_YERPP      ----KQNLPHPEDGDGFFYA---------
RSMB_YERPN      ----KQNLPHPEDGDGFFYA---------
RSMB_YERPG      ----KQNLPHPEDGDGFFYA---------
RSMB_YERPE      ----KQNLPHPEDGDGFFYA---------
RSMB_YERPB      ----KQNLPHPEDGDGFFYA---------
RSMB_YERPA      ----KQNLPHPEDGDGFFYA---------
RSMB_YERP3      ----KQNLPHPEDGDGFFYA---------
RSMB_SHIB3      -QPGKQNLPGAEEGDGFFYAKL-------
RSMB_SALPK      -QPGQQNLPGGEEGDGFFYAKL-------
RSMB_SALPA      -QPGQQNLPGGEEGDGFFYAKL-------
RSMB_ECO27      -QPGKQNLPGAEEGDGFFYAKL-------
RSMF_SHIDS      TNKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_SHEON      -EGFLHVWPQIYDSEGFFVAKLTKTRSVP
RSMF_SHEDO      CTE-EGFLPQIYDSEGFFVAKMRKTASVP
RSMF_SHEAM      TEEFLHIWPQIYDSEGFFVARIR------
RSMF_KLEP3      AEGFLHVFPQIYDCEGFFVARLR------
NSUN5_MOUSE     SEHCLRASPETTLTGGFFIAVFERAEVVP
RSMF_SALA4      XXXXTHVFPQIYDCEGFFVARLR------
RSMB_SHISS      -QPGKQNLPGAEEGDGFFYAKL-------
RSMB_ESCF3      -QPGKQNLPGAEEGDGFFYAKL-------
RSMF_SHESR      -EGFLHVWPQIYDSEGFFVAKLTKTRSVP
RSMF_SHESA      -EGFLHVWPQIYDSEGFFVAKLTKTRSVP
RSMB_SALTY      -QPGQQNLPGGEEGDGFFYAKL-------
RSMB_SALNS      -QPGQQNLPGGEEGDGFFYAKL-------
RSMB_SALDC      -QPGQQNLPGGEEGDGFFYAKL-------
RSMB_ECOLU      -QPGKQNLPGAEEGDGFFYAKL-------
RSMB_ECOLI      -QPGKQNLPGAEEGDGFFYAKL-------
RSMB_ECOLC      -QPGKQNLPGAEEGDGFFYAKL-------
RSMB_ECOHS      -QPGKQNLPGAEEGDGFFYAKL-------
RSMB_ECODH      -QPGKQNLPGAEEGDGFFYAKL-------
RSMB_ECOBW      -QPGKQNLPGAEEGDGFFYAKL-------
RSMF_SHEB9      ---FLHVWPQIYDSEGFFVAKLTKTASVP
RSMF_ECO5E      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_ECO57      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMB_VIBPA      -QPGRQILPGEEDMDGFYYAVLTKTR---
RSMB_SHIDS      -QPGKQNLPGAEEGDGFFYAKL-------
RSMB_SHIBS      -QPGKQNLPGAEEGDGFFYAKL-------
RSMB_ECOUT      -QPGKQNLPGAEEGDGFFYAKL-------
RSMB_ECOSM      -QPGKQNLPGAEEGDGFFYAKL-------
RSMB_ECOSE      -QPGKQNLPGAEEGDGFFYAKL-------
RSMB_ECOK1      -QPGKQNLPGAEEGDGFFYAKL-------
RSMB_ECO8A      -QPGKQNLPGAEEGDGFFYAKL-------
RSMB_ECO5E      -QPGKQNLPGAEEGDGFFYAKL-------
RSMB_ECO57      -QPGKQNLPGAEEGDGFFYAKL-------
RSMB_ECO55      -QPGKQNLPGAEEGDGFFYAKL-------
RSMB_ECO45      -QPGKQNLPGAEEGDGFFYAKL-------
RSMB_ECO24      -QPGKQNLPGAEEGDGFFYAKL-------
RSMF_SHISS      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_SHIBS      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_SHIB3      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_SHEWM      ----LHVWPQIYDSEGFFIAKVR------
RSMF_SHEB2      ---FLHVWPQIYDSEGFFVAKLTKTASVP
RSMF_ECOSE      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_ECOLI      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_ECOL5      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_ECODH      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_ECOBW      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_ECO8A      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_ECO7I      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_ECO55      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_ECO24      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMB_SALTI      -QPGQQNLPGGEEGDGFFYAKL-------
RSMB_SALPC      -QPGQQNLPGGEEGDGFFYAKL-------
RSMB_SALHS      -QPGQQNLPGGEEGDGFFYAKL-------
RSMB_SALG2      -QPGQQNLPGGEEGDGFFYAKL-------
RSMB_SALEP      -QPGQQNLPGGEEGDGFFYAKL-------
RSMB_SALCH      -QPGQQNLPGGEEGDGFFYAKL-------
RSMB_ECOL6      -QPGKQNLPGAEEGDGFFYAKL-------
RSMB_ECO81      -QPGKQNLPGAEEGDGFFYAKL-------
RSMB_ECO7I      -QPGKQNLPGAEEGDGFFYAKL-------
RSMF_PHOPR      FEGAEKSLPQIFDSEGFFVARIR------
RSMF_ECOSM      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_ECO81      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_ECO27      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMB_VIBVY      ----RQILPGEEDMDGFYYAVL-------
RSMF_SHEB8      ---FLHVWPQIYDSEGFFVAKLTKTASVP
RSMF_SALAR      ----LHVFPQIYDCEGFFVARLR------
RSMF_ENTS8      AALTEHVFPQIYDCEGFFVARLR------
RSMF_ENT38      -----------------------------
RSMF_ECOLU      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_ECOLC      LTEFLHVFPQIYDCEGFFVARLRKTQAIP
RSMF_ECOL6      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_ECOHS      LTEFLHVFPQIYDCEGFFVARLRKTQAIP
RSMB_VIBVU      ----RQIIPGEEDMDGFYYAVL-------
RSMB_PHOLL      TNDCKQIIPELNGGDGFFYARL-------
NSUN5_HUMAN     AEHCLRASPETTLSSGFFVAVI-------
RSMF_ESCF3      ADKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_AERHH      ACTPEGYLPQIFDSEGFFVARLR------
RSMB_SHIFL      -QPGKQNQPGAEEGDGFFYAKL-------
RSMB_SALSV      -QPGQQNLPGGEEGDGFFYAKL-------
RSMB_PSEAE      MKQGRQLLPQVEGHDGFYYAKL-------
RSMB_HAEDU      A-IMKQFLPQQNGGDGFFYAKLR------
RSMB_ECOL5      -QPGKQNLPGAEEGDGFFYAKL-------
YEY6_SCHPO      CNSLTKTLPN-------------------
RSMF_SHEPA      CTE-EGFLPQIYDSEGFFVA---------
RSMF_SHEFN      CTE-EGFLPQIYDSEGFFVAKIR------
RSMF_SHEB5      ---FLHVWPQIYDSEGFFVAKLTKTASVP
RSMF_AERS4      ACTPEGYLPQIFDSEGFFVARLRKHHSVP
RSMB_SHIF8      -QPGKQNQPGAEEGDGFFYAKL-------
RSMB_SALA4      -QPGQQNLPGGEEGDGFFYAKL-------
RSMF_SHESW      ---FLHVWPQIYDSEGFFVAKLTKTASVP
RSMF_SHEPC      ---FLHVWPQIYDSEGFFVAKLTKTASVP
RSMB_ERWCT      ----IQILPHADSGDGFFYAKL-------
RSMF_VIBPA      ----LHIFPQVYDCEGFFVARIR------
RSMB_XANAC      AGAGRQRFPGEQHCDGFFYALL-------
RSMB_PECCP      ----IQMLPHADGGDGFFYAKL-------
RSMB_ENTS8      STQ----TPGIQNLPG-------------
RSMB_PASMU      -----QFLPTENGGDGFYYAKLR------
RSMB_CITK8      AQPGVQNLPGAEEGDGFFYAKL-------
RSMF_VIBHB      EEGFLHIFPQVYDCEGFFVARIR------
NSUN2_DROME     LEKCLRVLPHLQDSGGFFVAVLEKRRQ--
RSMF_SHIFL      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_SHIF8      ANKALHVFPQIYDCEGFFVARLRKTQAIP
RSMF_VIBVY      ---FLHIFPQVYDSEGFFVARIR------
RSMF_VIBVU      ---FLHIFPQVYDSEGFFVARIR------
RSMF_VIBSL      TEEFLHIFPQVYDSEGFFVARIR------
RSMB_ENT38      DKPGVQNLPGAEDGDGFFYAKL-------
RSMB_SERP5      ----RQNLPHPEDGDGFFYAKL-------
RSMB_PSESM      IKQGRQLLAQQGGHDGFYYAKL-------
RSMB_HAEIN      F----QFIPQPNSGDGFYYAKL-------
RSMB_ERWT9      ----IQVFPQADGGDGFYYAKL-------
RSMF_PSEHT      -----------------------------
RSMB_XYLFA      AGLGRQRLPGEQGGDGFFYARL-------
NCL1_SCHPO      IQNCLRIYPHFQNTGGFFVAVL-------
TRUB_NANEQ      -----------------------------
RSMB_XYLFT      AGLGRQRLPGEQGGDGFFYARL-------
RSMB_SALPB      -QPGQQNLPGGEEGDGFFYAKL-------
TGS1_MOUSE      -----------------------------
TGS1_RAT        -----------------------------
NCL1_YEAST      LQNCMRVYPHQQNTGGFFITV--------
RSMB_XANCP      AGAGRQRFPGEQQCDGFFYALL-------
TRUB_SULTO      -----------------------------
NSUN4_XENTR     CRVGELVLPHLNFGPMFFCKLLR------
TRUB_THEGJ      -----------------------------
TGS1_HUMAN      -----------------------------
TRUB_PYRKO      -----------------------------
NSUN2_CHICK     LERCIRILPHHQNTGGFFVAVL-------
TRUB_PYRFU      -----------------------------
TRUB_PYRHO      -----------------------------
TRUB_METKA      -----------------------------
NSUN4_XENLA     -----------------------------
TRUB_SULSO      -----------------------------
TRUB_PYRAB      -----------------------------
NSUN4_MOUSE     -----------------------------
TRUB_METJA      -----------------------------
RRMT_AZOSB      -----------------------------
NSUN3_HUMAN     -----------------------------
TRUB_PYRAR      -----------------------------
NSUN3_MOUSE     -----------------------------
NSUN3_DANRE     -----------------------------
NSUN3_BOVIN     -----------------------------
TRUB_HALMA      -----------------------------
CBF5_EMENI      -----------------------------
CMOA_PASMU      -----------------------------
RSMF_SHELP      -----------------------------
RSMF_VIBPA      -----------------------------