[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL63125.1

[Show Plain Result]


## Summary of Sequence Search
    1::471
   82::540     e-115  50%  541 aa  Y1136_METJA RecName: Full=Uncharacterized protein MJ1136;
   80::542     e-101  45%  547 aa  ELP3_CAEEL RecName: Full=Probable elongator complex protein 3;     
   86::548     e-100  46%  549 aa  ELP3_XENLA RecName: Full=Elongator complex protein 3;       
   83::545     e-100  46%  546 aa  ELP3_CHICK RecName: Full=Elongator complex protein 3;       
   86::548     e-100  46%  549 aa  ELP3_XENTR RecName: Full=Elongator complex protein 3;       
   81::542     e-100  45%  544 aa  ELP3_SCHPO RecName: Full=Probable elongator complex protein 3;     
   85::547     e-100  45%  548 aa  ELP3_DANRE RecName: Full=Elongator complex protein 3;       
   86::548      e-99  45%  552 aa  ELP3_DROME RecName: Full=Probable elongator complex protein 3;     
   84::546     3e-99  45%  547 aa  ELP3_BOVIN RecName: Full=Elongator complex protein 3;       
   84::546     8e-99  45%  547 aa  ELP3_HUMAN RecName: Full=Elongator complex protein 3;       
   93::555     5e-98  44%  557 aa  ELP3_YEAST RecName: Full=Elongator complex protein 3;       
   96::559     1e-96  44%  559 aa  ELP3_DICDI RecName: Full=Probable elongator complex protein 3;     
  110::572     2e-96  45%  573 aa  ELP3_ORYSJ RecName: Full=Elongator complex protein 3;       
   84::546     2e-96  44%  547 aa  ELP3_MOUSE RecName: Full=Elongator complex protein 3;       
   80::544     4e-96  43%  548 aa  ELP3_CAEBR RecName: Full=Probable elongator complex protein 3;     
  102::564     5e-86  42%  565 aa  ELP3_ARATH RecName: Full=Elongator complex protein 3;       
  128::294     7e-19  31%  322 aa  Y486_METJA RecName: Full=Uncharacterized protein MJ0486;
   97::306     5e-13  27%  322 aa  YTQA_BACSU RecName: Full=Putative protein ytqA;
  106::241     5e-13  29%  309 aa  YHCC_ECOLI RecName: Full=Uncharacterized protein yhcC;
  106::241     5e-13  29%  309 aa  YHCC_ECO57 RecName: Full=Uncharacterized protein yhcC;
   16::206     2e-09  32%  383 aa  Y463_HAEIN RecName: Full=Oxygen-independent coproporphyrinogen-III
  142::245     3e-06  32%  451 aa  HEMN_PARDP RecName: Full=Oxygen-independent coproporphyrinogen-III
   93::197     3e-06  29%  379 aa  HEMN_BACSU RecName: Full=Oxygen-independent coproporphyrinogen-III
   96::201     8e-06  29%  376 aa  Y532_BUCAP RecName: Full=Oxygen-independent coproporphyrinogen-III
  271::380     2e-05  25%  426 aa  Y1487_METJA RecName: Full=Uncharacterized methyltransferase MJ1487;
   96::202     9e-05  29%  378 aa  YGGW_ECOLI RecName: Full=Oxygen-independent coproporphyrinogen-III
  102::217     9e-05  25%  412 aa  Y1917_SYNY3 RecName: Full=Oxygen-independent coproporphyrinogen-III
   68::245     2e-04  24%  358 aa  YOPP_BACSU RecName: Full=SPBc2 prophage-derived probable
  240::376     6e-04  22%  501 aa  HEMZ_BACSU RecName: Full=Oxygen-independent coproporphyrinogen-III
    1::471

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xASGVHVVALMTQPFPCPGRCTFCPSSADAPKSYMPDSPVVLRAKRNRYDPYLQTAGRIKVYIENGHTPS
Y1136_METJA     --SGVAVVAVMTSPEKCPGKCIFCPGGVDVPQSYTGREPATMRGLMFNFDPYLQTKARIEQLEKVGHPTN
ELP3_CAEEL      -ASGIAVVAVMSKPHRCPNICVYCPGGPDSDFEYSTQSPTSMRAIRARYNPYLQTRGRLNQLMQLGHSVD
ELP3_XENLA      -ASGIAVVAVMCKPHRCPNICVYCPGGPDSDFEYSTQSPTSMRAIRARYDPYLQTRHRVEQLKQLGHNVD
ELP3_CHICK      -ASGIAVVAVMCKPHRCPNICVYCPGGPDSDFEYSTQSPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVD
ELP3_XENTR      -ASGIAVVAVMCKPHRCPNICVYCPGGPDSDFEYSTQSPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVD
ELP3_SCHPO      -ASGIAVVAVMCKPHRCPNVCVYCPGGPDSDFEYSTQSPTSMRAIRARYDPYEQARGRVEQLRSLGHTVD
ELP3_DANRE      -ASGIAVVAVMCKPHRCPNICVYCPGGPDSDFEYSTQSPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVD
ELP3_DROME      -ASGIAVVAVMCKPHRCPNICVYCPGGPDSDFEYSTQSPTSMRAIRSRYDPFLQTRHRVEQLKQLGHSVD
ELP3_BOVIN      -ASGIAVVAVMCKPHRCPNICVYCPGGPDSDFEYSTQSPTSMRAIRARYDPYLQTRHRIEQLKQLGHSVD
ELP3_HUMAN      -ASGIAVVAVMCKPHRCPNICVYCPGGPDSDFEYSTQSPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVD
ELP3_YEAST      -ASGIAVVAVMCKPHRCPNICVYCPGGPDSDFEYSTQSPTSMRAIRARYDPYEQARGRVEQLKQLGHSID
ELP3_DICDI      -ASGIAVVAVMCKPHRCPNICVYCPGGPDSDFEYSTQSPTSMRAIRARYNPFLQTRHRIDQLKRLGHNVE
ELP3_ORYSJ      -ASGIAVVAVMSKPHRCPNICVYCPGGPDSDFEYSTQSPTSMRAIRARYNPYVQARSRIDQLKRLGHSVD
ELP3_MOUSE      -ASGIAVVAVMCKPHRCPNICIYCPGGPDSDFEYSTQSPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVD
ELP3_CAEBR      -ASGIAVVAVMSKPHRCPNICVYCPGGPDSDFEYSTQSPTSMRAIRARYNPYLQTRGRLNQLMQLGHSVD
ELP3_ARATH      -ASGIAVVAVMSKPHRCPNICVYCPGGPDSDFEYSTQSPTSMRAIRARYNPYVQARSRIDQLKRLGHSVD
Y486_METJA      ----------------------------------------------------------------------
YTQA_BACSU      ----------------------------------------------------------------------
YHCC_ECOLI      ----------------------------------------------------------------------
YHCC_ECO57      ----------------------------------------------------------------------
Y463_HAEIN      ----------------CVQKCPYCDFNSHAQKSDIPEQDYILQADLQRFKDSIQQRKLHSIFIGGG-TPS
HEMN_PARDP      ----------------------------------------------------------------------
HEMN_BACSU      ----------------------------------------------------------------------
Y532_BUCAP      ----------------------------------------------------------------------
Y1487_METJA     ----------------------------------------------------------------------
YGGW_ECOLI      ----------------------------------------------------------------------
Y1917_SYNY3     ----------------------------------------------------------------------
YOPP_BACSU      -------------------------------KSLVPDDLVVSKSELSNYVKYLQEKGLVNNSINRKMTSL
HEMZ_BACSU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KIEAVIMGGTFSALPRGYREWFVANIYKALNDFPHWTSSADPTPNLEAEQIRNETAELRMVALTVETRPD
Y1136_METJA     KIELIIMGGTFPARDIEYQDWFIKRCLDAMN-------GVDASSLEEAQKI-NETAEHRCVALCIETRPD
ELP3_CAEEL      KVEFIVMGGTFMSLPEDYRDFFIRNLHDAL--------SGHTSASVEEAVAYSERSKMKCIGITIETRPD
ELP3_XENLA      KVEFIVMGGTFMALPEDYRDFFIRNLHDALSGH---------TSNSVSEAVRSERSNTKCVGITIETRPD
ELP3_CHICK      KVEFIVMGGTFMALPEDYRDYFIRNLHDALSGH---------TSNNVAEAVKSERSLTKCVGITIETRPD
ELP3_XENTR      KVEFIVMGGTFMALSEDYRDFFIRNLHDALSGH---------TSNSVSEAVRSERSNTKCVGITIETRPD
ELP3_SCHPO      KVEYIIMGGTFMSLPESYRHTFIANLHNAL--------SGATTEDLDEAVKFSEQSETKCVGITIETRPD
ELP3_DANRE      KVEFIVMGGTFMALPEEYRDYFIRNLHDALSGH---------TSNNVTEAVRSERSNTKCVGITIETRPD
ELP3_DROME      KVEFIVMGGTFMCLPEEYRDYFIRNLHDALSGH----SSANV-----AEAVRSEKSRTKCIGITIETRPD
ELP3_BOVIN      KVEFIVMGGTFMALPEEYRDYFIRNLHDAL--------SGHTSNNIYEAVKYSERSLTKCIGITIETRPD
ELP3_HUMAN      KVEFIVMGGTFMALPEEYRDYFIRNLHDAL--------SGHTSNNIYEAVKYSERSLTKCIGITIETRPD
ELP3_YEAST      KVEYVLMGGTFMSLPKEYREDFIVKLHNALSGFNG--------NDIDEAILYSQQSLTKCVGITIETRPD
ELP3_DICDI      KVEFIIMGGTFMSLPSDYRDYFIRNLHDALSGH---------TSNNVAEAVKSEQSNVKCVGITIETRPD
ELP3_ORYSJ      KVEFILMGGTFMSLPADYRDYFIRNLHDAL--------SGHTSANVEEAVCYSEHGAVKCIGMTIETRPD
ELP3_MOUSE      KVEFIVMGGTFMALPEEYRDYFIRSLHDAL--------SGHTSNNIHEAIKYSERSFTKCVGITIETRPD
ELP3_CAEBR      KVEFIVMGGTFMSLPEDYRDFFIRNLHDAL--------SGHTSASVEEAVAYSERSKMKCIGITIETRPD
ELP3_ARATH      KVEFILMGGTFMSLPAEYRDFFIRNLHDAL--------SGHTSANVEEAVAYSEHSATKCIGMTIETRPD
Y486_METJA      -----------------------------------------------------------VIGLSIGTRPD
YTQA_BACSU      --------------------------------FQAFTNTHAPVEVLR-EKFESVLALDDVVGISIATRPD
YHCC_ECOLI      -------------------------------------------------------SQANIVGLCVGTRPD
YHCC_ECO57      -------------------------------------------------------SQANIVGLCVGTRPD
Y463_HAEIN      ---------LFSAESIAY---LLKEIKKQI----------DFEDNIE---------------ITLEANPG
HEMN_PARDP      ---------------------------------------------------------------SVEIDPN
HEMN_BACSU      ----------------------------------------------------------------VEANPD
Y532_BUCAP      --------------------------------------------------------------ITIEANPT
Y1487_METJA     -----------------------------------------------------------------EVRPE
YGGW_ECOLI      --------------------------------------------------------------ITMEANPG
Y1917_SYNY3     --------------------------------------------------------------ISIEIDPG
YOPP_BACSU      KM-------LYTYLEHDYKDYIDLSVFNTVERLKTVTKNWDKTTQTEAERIAQD-------MYINERQKP
HEMZ_BACSU      --------------------------------------TAEEMDLLYEEMVRSFPDVKNIREITVEARPD


                         +         .         .         .         .         *         .:210
query           FINKAEVDFLLKLGVTRVELGVQSIYDDVLQKVKRGHGAAEVVEATAILKDSAYKVCYHVMPGLPGSDPD
Y1136_METJA     YCGEKEINQMLKLGATRVELGVQTIYNEILEFCKRGHTVEDTIKATQLLKDSGLKVSYHLMPGMPGSDME
ELP3_CAEEL      YCLPRHLNDMLLYGCTRLEIGVQSTYEDVARDTNRGHTVKSVCETFHMAKDTGYKVVIHMMPDLPNVGLE
ELP3_XENLA      YCLKRHLSDMLCYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLSKDAGFKVVSHMMPDLPNMGLE
ELP3_CHICK      YCLKRHLSDMLSYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDAGFKVVAHMMPDLPNMGLE
ELP3_XENTR      YCLKRHLSDMLSYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHMAKDAGFKVVSHMMPDLPNVGLE
ELP3_SCHPO      YCLDQHLDEMLRYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCETFQLAKDTGYKVVTHMMPDLPNVGME
ELP3_DANRE      YCLKRHLSDMLGYGCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFHLAKDAGFKVVAHMMPDLPNVGME
ELP3_DROME      YCLKRHISDMLSYGCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFQLGKDAGYKIVTHMMPDLPNVDFE
ELP3_BOVIN      YCMKRHLSDMLTYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLE
ELP3_HUMAN      YCMKRHLSDMLTYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLE
ELP3_YEAST      YCTQTHLDDMLKYGCTRLEIGVQSLYEDVARDTNRGHTVRSVCETFAVSKDAGYKVVSHMMPDLPNVGME
ELP3_DICDI      HCLKLHLSNMLTYGCTRLEIGVQSVFEDIARDTNRGHTVRAVLESFQLAKDSGFKVVAHMMPDLPNMGME
ELP3_ORYSJ      YCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVAHMMPDLPNVGVE
ELP3_MOUSE      YCMKRHLSDMLTYGCTRLEIGVQSVYEDVARDTNRGHTVKAACESFHLAKDSGFKVVTHMMPDLPNVGLE
ELP3_CAEBR      YCLPRHLNDMLLYGCTRLEIGVQSTYEDVARDTNRGHTVKSVCETFHMAKDTGYKVVIHMMPDLPNVGLE
ELP3_ARATH      YCLGPHLRQMLIYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVAHMMPDLPNVGVE
Y486_METJA      CLEKEKLDILAEYVENGIDLGVQSMHQKTLEILNRGHDVSDIIKAIKDCHKRGIKVCGHVILGLPGESWK
YTQA_BACSU      CLPDDVVDYLAELNERTVELGLQTVHERTALLINRAHDFNCYVEGVNKLRKHGIRVCSHIINGLPLEDRD
YHCC_ECOLI      CVPDAVLDLLCEYKEVWLELGLQTAHDKTLHRINRGHDFACYQRTTQLARQRGLKVCSHLIVGLPGEGQA
YHCC_ECO57      CVPDAVLDLLCEYKEVWLELGLQTAHDKTLHRINRGHDFACYQRTTQLARQRGLKVCSHLIVGLPGEGQA
Y463_HAEIN      TVEAERFKGYVSAGIMRISMGIQSFNDDKLQRLGRIHNAAEAKSAVNLAKVSGLKFNLDLMHGLPNQTLE
HEMN_PARDP      EIDEARMDALAEAGLNRASIGVQD-FDPEIQKIIGREQSFEVTKAVDMIRDRGISLNADILYGLPHQDPH
HEMN_BACSU      DLSAEKLKILKEAGVNRLSFGVQTFEDDLLEKIGRVHKQKDVFTSFERAREIGFEISLDLMFGLPGQTLK
Y532_BUCAP      TLEYKRFFNYKKSGINRFSIGVQTFNSDLLKKIERTYNKREAILAVEEIKKINKNFNLDIMYGLPNSLKD
Y1487_METJA     HVNIETVDLILRYADNKLVIGAQSGSEKVLELCHRGHTVEDVYNAVRVARKAGLGVDVDFIFGLPG-ETE
YGGW_ECOLI      TVEADRFVDYQRAGVNRISIGVQSFSEEKLKRLGRIHGPQEAKRAAKLASGLGLRFNLDLMHGLPDQSLE
Y1917_SYNY3     TFDQVQLQGYKNLGINRFSLGVQAFQDNLLALCGRHHRRRDIDQATAIAKENIENWSLDLITGLPQTAAD
YOPP_BACSU      LMKKLFVKFAIRTSF-RVSAILRVRWKDIQLDESTGHYIVTVIDGSQVVSTGINQVFYEELLQLKEED-D
HEMZ_BACSU      TITEEKLAVLNKYDIDRISINPQSYENETLKAIGRHHTVEETIEKYHLSRQHGMNINMDLIIGLPGEGVK


                         .         .         .         +         .         .         .:280
query           RDLEMVREIFSNPSYMPDCVKIYPLYVVPNTELSEDWRRGLYKSYDEETWLELLAKIYASIPRWVRVMRF
Y1136_METJA     MDKKMFKEIFENPDFKPDMVKIYPCLVIEGTELYEMWKRGEYKPYREEEAIEIISYAKSIMPKWVRTSRI
ELP3_CAEEL      RDKEQFLELFESPAFRPDGLKLYPTLVIRGTGLYELWKTGRYQSYPPSVLVDLIATILSLVPPWTRVYRV
ELP3_XENLA      RDIEQFIEFFENPAFRPDGMKLYPTLVIRGTGLYELWKTGRYRSYSPSTLVDLVARILALVPPWTRVYRV
ELP3_CHICK      RDTDQFVEFFENPAFRPDGMKLYPTLVIRGTGLYELWKTGRYKSYPPSTLVDLVARILALVPPWTRVYRV
ELP3_XENTR      RDTEQFIEFFENPAFRPDGMKLYPTLVIRGTGLYELWKTGRYRSYSPSTLVDLVARILALVPPWTRVYRV
ELP3_SCHPO      RDIFQFQEYFENPAFRTDGLKLYPTLVIRGTGLYELWKTGRYKNYTPNALVDLIARILALVPPWTRIYRI
ELP3_DANRE      RDVEQFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKTGRYKSYSPSALVDLVARILALVPPWTRVYRV
ELP3_DROME      RDIEQFIEYFENPAFRSDGLKIYPTLVIRGTGLYELWKTGRYKSYPPSMLVDLVAKILALVPPWTRVYRV
ELP3_BOVIN      RDIEQFTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLIELVARILALVPPWTRVYRV
ELP3_HUMAN      RDIEQFTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLVELVARILALVPPWTRVYRV
ELP3_YEAST      RDIEQFKEYFENPDFRTDGLKIYPTLVIRGTGLYELWKTGRYKSYSANALVDLVARILALVPPWTRIYRV
ELP3_DICDI      RDIYGFMEFFENPAFRADGLKIYPTLVIRGTGLYELWKTGTYKNYSPDSLVDLIAKVLALVPPWTRIYRI
ELP3_ORYSJ      RDLESFREFFENPAFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPELLVDIVARILSMVPPWTRVYRV
ELP3_MOUSE      RDIEQFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYRSYSPSDLIELVARILALVPPWTRVYRV
ELP3_CAEBR      RDKEQFLELFESPAFRPDGLKLYPTLVIRGTGLYELWKTGRYQSYPPSVLVDLIATILSLVPPWTRVYRV
ELP3_ARATH      RDMXXXXXXXXXXXXRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPEQLVDIVARILSMVPPWTRVYRV
Y486_METJA      EMMETAKIL----SLLEEAVKIYPLVVVKGTKLEEMYWKGEYRTLDENQYISLVCDFLEHLSPYVLIQRL
YTQA_BACSU      MMMETAKAV---ADLDVQGIKIHLLHLLKGTPMVKQYEKGKLEFLSQDDYVQLVCDQLEIIPPEMIVHRI
YHCC_ECOLI      ECLQTLERVVETG---VDGIKLHPLHIVKGSIMAKAWEAGRLNGIELEDY--------------------
YHCC_ECO57      ECLQTLERVVETG---VDGIKLHPLHIVKGSIMAKAWEAGRLNGIELEDY--------------------
Y463_HAEIN      EALDDLRQAI---ELSPPHISWYQLTIEPNT---------------------------------------
HEMN_PARDP      RIAESVQKLL---ALSPDRVALYGYAHVP-----------------------------------------
HEMN_BACSU      ---HLEHSINTALSLDAEHYSVYSLIVEPKT---------------------------------------
Y532_BUCAP      VLLDLQYAVKYNPTH----ISWYQLTLEPNT---------------------------------------
Y1487_METJA     EDVEKTIKVMKDLIKMGAKIHAHTFMPLPQTPFAK-----------------------------------
YGGW_ECOLI      EALGDLRQIELNPPHL----SWYQLTIEPNT---------------------------------------
Y1917_SYNY3     WHSSLTLALAAGPKH----ISCYDLVLEPQTVFDKWEQRG------------------------------
YOPP_BACSU      SETELVFQGLSEQS--------------------------------------------------------
HEMZ_BACSU      ---EFRHSLSETEKLMPESLTVHTLSFKRASEMTRN----------------------------------


                         .         *         .         .         .         .         +:350
query           GRDIPLHHVLDGPRWGNMRQIVLKHMERLGLKCQEIRCREVGIKLANNVPIQPGPVEVKKTEYEASGGLE
Y1136_METJA     QRDIPATVIVDGVKKSNLGELVYKYMEKHGIKCKCIRCREVGVMYKKGIMPDIEHIKLCREEYEASGGTE
ELP3_CAEEL      QRDIPMPLVSSGVEHGNLREHAMAKMKELGLKCRDVRTREVGIQEIHN-KVRPEDVELIRRDYTANGGWE
ELP3_XENLA      QRDIPMPLVSSGVEHGNLRELALARMKDLGTECRDVRTREVGIQEIHH-KVRPYQVELIRRDYVANGGWE
ELP3_CHICK      QRDIPMPLVSSGVEHGNLRELALARMKDLGTQCRDVRTREVGIQEIHH-KVRPYQIELIRRDYVANGGWE
ELP3_XENTR      QRDIPMPLVSSGVEHGNLRELALARMKDLGTECRDVRTREVGIQEIHH-KVRPYQVELIRRDYVANGGWE
ELP3_SCHPO      QRDIPMPLVSSGVETGNLRELALNRMRDLGTKCRDIRAREVGMQEVHH-KIHPEQVELLRRDYTANGGWE
ELP3_DANRE      QRDIPMPLVSSGVEHGNLRELALARMKDMGTECRDVRTREVGIQEIHH-KVRPYQVELIRRDYVANGGWE
ELP3_DROME      QRDIPMPLVSSGVEHGNLRELALARMKDLGTTCRDVRTREVGIQEIHN-KVRPYEIELIRRDYVANGGWE
ELP3_BOVIN      QRDIPMPLVSSGVEHGNLRELAFARMKDLGIQCRDVRTREVGIQEIHH-KVRPYQVELVRRDYVANGGWE
ELP3_HUMAN      QRDIPMPLVSSGVEHGNLRELALARMKDLGIQCRDVRTREVGIQEIHH-KVRPYQVELVRRDYVANGGWE
ELP3_YEAST      QRDIPMPLVTSGVDNGNLRELALARMKDLGTTCRDVRTREVGIQEVHH-KVQPDQVELIRRDYYANGGWE
ELP3_DICDI      QRDIPMPLVTSGVEYGNLRELCLARMKDFGTKCRDVRTREVGIQEVHH-KIKPDQVELIRRDYVANGGWE
ELP3_ORYSJ      QRDIPMPLVTSGVEKGNLRELALARMEDLGLKCRDVRTREAGIQDIHH-KIRPDEVELVRRDYAANEGWE
ELP3_MOUSE      QRDIPMPLVSSGVEHGNLRELAFARMKDLGIQCRDVRTREVGIQEIHH-RVRPYQVELVRRDYVANGGWE
ELP3_CAEBR      QRDIPMPLVSSGVEHGNLREHAMAKMKELGLKCRDVRTREVGIQEIHN-KVRPEDVELIRRDYTANGGWE
ELP3_ARATH      QRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVRTREAGIQDIHH-KIKPEQVELVRRDYTANEGWE
Y486_METJA      SKDKVPESIKVSPEW-------------------------------------------------------
YTQA_BACSU      TGDGPI-ELMIGPMWSVNKWEVLKELENRG----------------------------------------
YHCC_ECOLI      ----------------------------------------------------------------------
YHCC_ECO57      ----------------------------------------------------------------------
Y463_HAEIN      ----------------------------------------------------------------------
HEMN_PARDP      ----------------------------------------------------------------------
HEMN_BACSU      ----------------------------------------------------------------------
Y532_BUCAP      ----------------------------------------------------------------------
Y1487_METJA     ----------------------------------------------------------------------
YGGW_ECOLI      ----------------------------------------------------------------------
Y1917_SYNY3     ----------------------------------------------------------------------
YOPP_BACSU      ----------------------------------------------------------------------
HEMZ_BACSU      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           IFLEAVGPDDTLYAILRLRIPNRPHRPELYKAALVRELHVYGPAVPVGKQGIWWQHSGMGRELMRLAEEI
Y1136_METJA     IFLSYEDKNDILIAFLRLREPYKPFRKEIDNTMLVRQLHVCGQEKPLTKKEITWQHKGYGRKLLEEAERI
ELP3_CAEEL      TFISYEDPQDILIGLLRLRISDKAHRPELKNVSVVRELHVYGSVVSVARDPKKFQHQGYGSLLMEEAERI
ELP3_XENLA      TFLSYEDPEDILIGLLRLRCSEESFRPELKGVSIVRELHVYGSVVPISRDPSKFQHQGFGMLLMEEAERI
ELP3_CHICK      TFLSYEDPEDILVGLLRLRCSEESFRPELKGVSIVRELHVYGSVVPVSRDPSKFQHQGFGMLLMEEAERI
ELP3_XENTR      TFLSYEDPEDILIGLLRLRCSEQSFRPELKGVSIVRELHVYGSVVPISRDPSKFQHQGFGMLLMEEAERI
ELP3_SCHPO      TFLSYEDPQDILIGLLRLRCSDKTYRPEFQPTSLVRELHVYGSAVPVSRDPKKFQHQGFGTLLLEEAERI
ELP3_DANRE      TFLSYEDPEDILIGLLRLRCSPQSFRPELKGVSIVRELHVYGSVVPVSRDPSKFQHQGFGMMLMEEAERI
ELP3_DROME      TFLSYEDPEDILVGLLRLRCSPDTFRPELKECSIVRELHVYGSVVPVARDPTKFQHQGFGMLLMEEAERI
ELP3_BOVIN      TFLSYEDPDDILIGLLRLRCSEETFRFELVGVSIVRELHVYGSVVPVSRDPTKFQHQGFGMLLMEEAERI
ELP3_HUMAN      TFLSYEDPDDILIGLLRLRCSEETFRFELGGVSIVRELHVYGSVVPVSRDPTKFQHQGFGMLLMEEAERI
ELP3_YEAST      TFLSYEDPKDILIGLLRLRKASKTYRKEFQRTSIVRELHVYGSVVPLSRDPRKFQHQGFGTLLMEEAERI
ELP3_DICDI      TFLSFEDPQDILIGLLRLRCSETSFRPELKECSIVRELHVYGSVVGINRDPTKFQHQGYGTLLMEEAERI
ELP3_ORYSJ      TFLSYEDQQDILIGLLRLRKCGRNVTPELVRCSIVRELHVYGTAVPVGRDADKLQHQGYGTLLMEEAERI
ELP3_MOUSE      TFLSYEDPDDILIGLLRLRCSEETFRFELGGVSIVRELHVYGSVVPVSRDPTKFQHQGFGMLLMEEAERI
ELP3_CAEBR      TFISYEDPQDILIGLLRLRISDKAHRAELKNVSVVRELHVYGSVVSVARDPKKFQHQGYGSLLMXXXXXX
ELP3_ARATH      TFLSYEDTQDILVGLLRLRCGKNVTCPELMKCSVVRELHVYGTAVPVGRDADKLQHQGYGTLLMXXXXXX
Y486_METJA      ----------------------------------------------------------------------
YTQA_BACSU      ----------------------------------------------------------------------
YHCC_ECOLI      ----------------------------------------------------------------------
YHCC_ECO57      ----------------------------------------------------------------------
Y463_HAEIN      ----------------------------------------------------------------------
HEMN_PARDP      ----------------------------------------------------------------------
HEMN_BACSU      ----------------------------------------------------------------------
Y532_BUCAP      ----------------------------------------------------------------------
Y1487_METJA     ----------------------------------------------------------------------
YGGW_ECOLI      ----------------------------------------------------------------------
Y1917_SYNY3     ----------------------------------------------------------------------
YOPP_BACSU      ----------------------------------------------------------------------
HEMZ_BACSU      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AGEFGALKIAVISGVGVREYYRKLGYERCGPYMCKPLGAxxxxxxxxxxxx
Y1136_METJA     AEEFGKKKILVTSGIGVREYYRKLGYERVGAYMGKYL--------------
ELP3_CAEEL      AEEHGSDKIAVISGVGTREYYRKLGYELDGPYMSKML--------------
ELP3_XENLA      ADEHGSWKIAVISGVGTRNYYRKIGYELEGPYMVKRL--------------
ELP3_CHICK      AEEHGSWKIAVISGVGTRNYYRKIGYELEGPYMVKRL--------------
ELP3_XENTR      AEEHGSCKIAVISGVGTRNYYRKLGYELEGPYMVKKL--------------
ELP3_SCHPO      AKEHGSKKISVISGVGVRKYYQKLGYTLDGPYMSK----------------
ELP3_DANRE      ADEHGSSKLAVISGVGTRNYYRKMGYELEGPYMVKNL--------------
ELP3_DROME      AEEHGSTKLAVISGVGTRNYYRKMGYQLDGPYMSKSI--------------
ELP3_BOVIN      AEEHGSGKIAVISGVGTRNYYRKIGYRLQGPYMVKTL--------------
ELP3_HUMAN      AEEHGSGKIAVISGVGTRNYYRKIGYRLQGPYMVKML--------------
ELP3_YEAST      AEEHGSEKISVISGVGVRNYYGKLGYELDGPYMSK----------------
ELP3_DICDI      AEEHGSIKLAVIAGVGTRHYYRKLGYELDGVYVSKYLG-------------
ELP3_ORYSJ      AKEHRSKKIAVISGVGTRHYYRKLGYELEGPYMVKCL--------------
ELP3_MOUSE      AEEHGSGKMAVISGVGTRNYYRKIGYRLQGPYMVKML--------------
ELP3_CAEBR      XXXXXSDKIAVISGVGTRDYYRKLGYELDGPYMSKTLDA------------
ELP3_ARATH      XXXXXSNKIGVISGVGTRHYYRKLGYELEGPYMVKHL--------------
Y486_METJA      ---------------------------------------------------
YTQA_BACSU      ---------------------------------------------------
YHCC_ECOLI      ---------------------------------------------------
YHCC_ECO57      ---------------------------------------------------
Y463_HAEIN      ---------------------------------------------------
HEMN_PARDP      ---------------------------------------------------
HEMN_BACSU      ---------------------------------------------------
Y532_BUCAP      ---------------------------------------------------
Y1487_METJA     ---------------------------------------------------
YGGW_ECOLI      ---------------------------------------------------
Y1917_SYNY3     ---------------------------------------------------
YOPP_BACSU      ---------------------------------------------------
HEMZ_BACSU      ---------------------------------------------------