[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL63374.1

[Show Plain Result]


## Summary of Sequence Search
    1::327
    9::253     4e-21  31%  350 aa  GLCE_ECOLI RecName: Full=Glycolate oxidase subunit glcE;
   47::219     6e-19  27%  470 aa  GLCD_BACSU RecName: Full=Glycolate oxidase subunit glcD;
  147::346     3e-17  35%  611 aa  ADAS_DICDI RecName: Full=Alkyldihydroxyacetonephosphate synthase;  
  141::315     2e-13  30%  597 aa  ADAS_CAEEL RecName: Full=Alkyldihydroxyacetonephosphate synthase;  
  157::337     1e-12  28%  587 aa  DLD1_YEAST RecName: Full=D-lactate dehydrogenase [cytochrome] 1,
  212::417     1e-12  30%  658 aa  ADAS_HUMAN RecName: Full=Alkyldihydroxyacetonephosphate synthase,
  212::417     1e-12  30%  658 aa  ADAS_CAVPO RecName: Full=Alkyldihydroxyacetonephosphate synthase,
  199::404     4e-12  29%  645 aa  ADAS_MOUSE RecName: Full=Alkyldihydroxyacetonephosphate synthase,
   72::363     5e-12  29%  507 aa  LDHD_HUMAN RecName: Full=Probable D-lactate dehydrogenase,
  198::403     9e-12  29%  644 aa  ADAS_RAT RecName: Full=Alkyldihydroxyacetonephosphate synthase,
  114::257     2e-11  28%  484 aa  LDHD_MOUSE RecName: Full=Probable D-lactate dehydrogenase,
  150::329     2e-11  29%  576 aa  DLD1_KLULA RecName: Full=D-lactate dehydrogenase [cytochrome],
  165::338     1e-10  27%  631 aa  ADAS_DROME RecName: Full=Alkyldihydroxyacetonephosphate synthase;  
   74::275     4e-10  24%  496 aa  DLD3_YEAST RecName: Full=D-lactate dehydrogenase [cytochrome] 3;   
  115::303     5e-10  28%  533 aa  D2HDH_DANRE RecName: Full=D-2-hydroxyglutarate dehydrogenase,
  136::309     2e-09  23%  613 aa  ADAS_TRYBB RecName: Full=Alkyldihydroxyacetonephosphate synthase;  
  127::315     3e-09  25%  544 aa  D2HDH_BOVIN RecName: Full=D-2-hydroxyglutarate dehydrogenase,
  106::345     3e-09  22%  530 aa  DLD2_YEAST RecName: Full=D-lactate dehydrogenase [cytochrome] 2,
  118::298     7e-09  30%  600 aa  GLDH_BRAOL RecName: Full=L-galactono-1,4-lactone dehydrogenase,
  118::306     7e-09  25%  535 aa  D2HDH_RAT RecName: Full=D-2-hydroxyglutarate dehydrogenase,
  118::306     7e-09  25%  535 aa  D2HDH_MOUSE RecName: Full=D-2-hydroxyglutarate dehydrogenase,
  128::308     1e-08  28%  610 aa  GLDH_ARATH RecName: Full=L-galactono-1,4-lactone dehydrogenase,
  104::298     2e-08  28%  583 aa  GLDH2_ORYSJ RecName: Full=L-galactono-1,4-lactone dehydrogenase 2,
  104::292     3e-08  25%  521 aa  D2HDH_HUMAN RecName: Full=D-2-hydroxyglutarate dehydrogenase,
   62::330     2e-07  23%  499 aa  GLCD_ECOLI RecName: Full=Glycolate oxidase subunit glcD;
   62::330     2e-07  23%  499 aa  GLCD_ECOL6 RecName: Full=Glycolate oxidase subunit glcD;
   58::200     4e-05  24% 1027 aa  Y1163_HAEIN RecName: Full=Uncharacterized protein HI1163;
   28::190     5e-05  28%  526 aa  ALO_YEAST RecName: Full=D-arabinono-1,4-lactone oxidase;       
   34::199     5e-05  25%  461 aa  ALO_SCHPO RecName: Full=D-arabinono-1,4-lactone oxidase;       
   27::177     2e-04  23%  440 aa  GGLO_SCYTO RecName: Full=L-gulonolactone oxidase;       
   13::88      4e-04  32%  148 aa  RL9_STRAW RecName: Full=50S ribosomal protein L9;
   76::277     5e-04  22%  523 aa  CKX3_ARATH RecName: Full=Cytokinin dehydrogenase 3;       
  109::263     0.001  23%  561 aa  DIM_ARATH RecName: Full=Cell elongation protein DIMINUTO;AltName:
    1::327

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRPKSVEELVELMKEANRDRRRLLPICKGSKAHLGPPVEYDEELQLWDMPKVLEVDEEEMVVRTSACISA
GLCE_ECOLI      ------QALLEQVNQAISDKTPLVIQGSNSKAFLGRPVT-GQTLDVRCHRGIVNYDPTELVITARVGTPL
GLCD_BACSU      --PRNTDEISRILTICSEHRVPIVPRGSGTNLCGGTPTEGGLVLLFKHMNQILEIDEENLTATVQPGVIT
ADAS_DICDI      --PHSHEEVERLVQLAHKYNVVIIPMGGGSNI-VGAPVSNERSIDMRRMNKVLWVDRREMTACIQVGIMG
ADAS_CAEEL      --PKSEHEIVKIIEGAMSHNCAIIPIGGGTSVTLDTPETEKRAVISMDMAKILWIDRENLTCRAQAGIVG
DLD1_YEAST      --PHTTEEVSKILKICHDNNMPVVPFSGGTSTRIGDTITVDLSKF---MNNVVKFDKLDLDITVQAGLPW
ADAS_HUMAN      --PTCHDDVVKIVNLACKYNLCIIPIGGGTSVSYGLMCPADESLDTSQMNRILWVDENNLTAHVEAGITG
ADAS_CAVPO      --PTCHDDVVKIVNLACKYNLCIIPIGGGTSVSYGLMCPADESLDTSQMNRILWVDENNLTAHVEAGITG
ADAS_MOUSE      --PTCHDDVVKIVNLACKYNLCIIPIGGGTSVSYGLMCPADESLDTSQMNRILWVDENNLTAHVEAGITG
LDHD_HUMAN      --PQNVEQVSRLAALCYRQGVPIIPFGTGTGLEXXXXXXXXXXXNLTHMDRILELNQEDFSVVVEPGVTR
ADAS_RAT        --PTCHDDVVKIVNLACKYNLCIIPIGGGTSVSYGLMCPADESLDTSQMNRILWVDENNLTAHVEAGITG
LDHD_MOUSE      -------------------------------------------INLTHMDQITELNTEDFSVVVEPGVTR
DLD1_KLULA      --PRNTEDVSKLLKICHKYSIPVIPFSGGTEGHFLPTVVLDISKYL---NKIIQLNKEDLDVVVQGGVPW
ADAS_DROME      --PRCHDEVVQLVRLANKHNVMLVPFGGGTSVSGAITCPQNESLDTSQMNRLLWLNRENLTVCFESGIVG
DLD3_YEAST      --PNSTDKVSKIMKYCNDKKLAVVP--QGGNTDLSVPVFDEIVLSLRNMNKVRDFDPVSGTFKCDAGVVM
D2HDH_DANRE     LRPKTTEGVSQILRYCNE---RNLAVCPGNTGLVGGSVPVFDEIILSTMNQVFAFDNISGILTCQAGCVL
ADAS_TRYBB      --PNNHDDCVKIMELAQKHNVVVVPFGGGTNVTGGEPNPFETRIDMRRMGRMLHIDTESGTAVFEVGVLG
D2HDH_BOVIN     LRPRTTQEVAHILRYCHERNLAVNPQ-GGNTGMVGGSTPVFDEIILSTMNQVLSFHDVSGVLVCQAGCVL
DLD2_YEAST      LRPKSVEKVSLILNYCNDEKIAVVPQ-GGNTGLVGGSVPIFDELSLANLNKIRDFDPVSGILKCDAGVIL
GLDH_BRAOL      -QPETLADLEALVKEAHEKKNRIRPVGSGLSPN-GIGLSRSGMVNLALMDKVLEVDKEKKRVRVQAGIRV
D2HDH_RAT       LRPQTSEEVSQILRHCYKRNLAVNPQ-GGNTGMVGGSVPVFDEVILSTMNQVISFHDVSGILVCQAGCVL
D2HDH_MOUSE     LRPQTSEEVSQILRHCYKRNLAVNPQ-GGNTGMVGGSVPVFDEVILSTMNQVISFHDVSGILVCQAGCVL
GLDH_ARATH      -QPENLADLEALVKESHEKKLRIRPVGSGLSPN-GIGLSRSGMVNLALMDKVLEVDKEKKRVTVQAGIRV
GLDH2_ORYSJ     LQPDSLPVLHDALAAAHGERRKLRPLGSGLSPN-GLALSRAGMVNLALMDKVLDVDAKKKTVTVQAGIRV
D2HDH_HUMAN     LRPRTSEEVSHILRHCHERNLAVNPQ-GGNTGMVGGSVPVFDEIILSTMNRVLSFHSVSGILVCQAGCVL
GLCD_ECOLI      --PKQMEQVTAILAVCHRLRVPVVTRGAGTGLSGGAPLEKGVLLVMARFKEILDINPVGRRARVQPGVRN
GLCD_ECOL6      --PKQMEQVTAILAVCHRLRVPVVTRGAGTGLSGGAPLEKGVLLVMARFKEILDINPVGRRARVQPGVRN
Y1163_HAEIN     --PKTVADIVRITKLANLPEYQSISFTPGGTGTNGQSINNNIIVDLSHMTAILELNVKERWVRVQAGVVK
ALO_YEAST       -QPSSIDEVVELVKSARLAEKSLVTVGSGSPSNMCVTDEWLVNLDRLDVQKFVEYPELHYAVTVDAGMRL
ALO_SCHPO       --PKTEEQLREILVDANSNGKKIRVVGAGSPSDIVCTSGY--LLSLDKMNKVVSFDPDSLSITVQAGIRF
GGLO_SCYTO      --PTTVEEIRQILELANQRNKRVKVVCGHSPSDIACTDNY--LVRLNKLNRILQVDKERKWITAEAGILL
RL9_STRAW       ----------------------------------------------------------------------
CKX3_ARATH      --PSSVEDITDLIK-LSFDSQLSFPLAARGHGHSHRGQASAKDGVVVNMRSMVNRDRGIKVSRTCLYVDA
DIM_ARATH       ------------------------------------------EVDLGEFRNILEINKEKMTARVEPLVNM


                         .         .         *         .         .         .         .:140
query           VELQEELRKRGRRLALDPPLFRRSSIGGILSTNFYGPMAYRYMTPRDQLLSVKIVTGKGEFMKFGAPVVK
GLCE_ECOLI      VTIEAALESAGQMLPCEPPHYEEATWGGMVACGLAGPRRPWSGSVRDFVLGTRIITGAGKHLRFGGEVMK
GLCD_BACSU      LDMIRAVESKGLFYPPDPSSMKISTIGGNINENSGGLRGLKYGVTRDYVIGLEVVLANGDIIRTGGKLAK
ADAS_DICDI      PELEKQLHKQGVSLGHDPDSFEFSTLGGWLATCSSGHQSDKYGDIEDMAVSFRTVTPTGTLLRNGA---R
ADAS_CAEEL      QSLERQLNKKGFTCGHEPDSIEFSTLGGWVSTRASGMKKNKYGNIEDLVVHLNFVCPKGIIQK-QCQVPR
DLD1_YEAST      EDLNDYLSDHGLMFGCDPG--PGAQIGGCIANSCSGTNAYRYGTMKENIINMTIVLPDGTIVKTKKRPRK
ADAS_HUMAN      QELERQLKESGYCTGHEPDSLEFSTVGGWVSTRASGMKKNIYGNIEDLVVHIKMVTPRGIIEK-SCQGPR
ADAS_CAVPO      QELERQLKESGYCTGHEPDSLEFSTVGGWISTRASGMKKNIYGNIEDLVVHMKVVTPRGVIEK-SCQGPR
ADAS_MOUSE      QDLERQLKESGYCTGHEPDSLEFSTVGGWISTRASGMKKNIYGNIEDLVVHMKMVTPRGVIEK-SSQGPR
LDHD_HUMAN      KALNAHLRDSGLWFPVDPGA--DASLCGMAATGASGTNAVRYGTMRDNVLNLEVVAGRGRHFRFGSPCVK
ADAS_RAT        QDLERQLKESGYCTGHEPDSLEFSIVGGWISTRASGMKKNVYGNIEDLVVHMKMVTPRGVIEK-SSQGPR
LDHD_MOUSE      KALNTHLRDSGLWFPVDPGA--DASLCGMAATGASGTNAVRYGTMRDNVINLEVVLPDGRLLHTGRHYRK
DLD1_KLULA      EELNEYLNDHGLLFGCDPG--PGAQIAGCIANSCSGTNAYRYGTMKENVVNITMCMADGTIVKTKRRPRK
ADAS_DROME      QDLERVLRSEGLTVGHEPDSYEFSTLGGWVATRASGMKKNVYGNIEDLVVRVRMVTPSGTLERCSAPRVS
DLD3_YEAST      RDAHQFLHDHDHIFPLDLPSRNNCQVGGVVSTNAGGLNFLRYGSLHGNVLGLEVVLPNGEIISNINALRK
D2HDH_DANRE     ENLSHYLEERDFIMPLDLGAKGSCHIGGNVSTNAXXXXXXXXXXXXXTVLGLEVVLADGHVLNCLATLRK
ADAS_TRYBB      PDIDEQLSRYGFMMGHDPDSYAYSTLGGWIAARGSGAMSNKYGDIENMILAMRVVTPVG---VVETPLTS
D2HDH_BOVIN     EALSQYVEERGFIMPLDLGAKGSCHIGGNVATNAGGLRVLRYGSLRGTVLGLEVVLADGTVLNCLTSLRK
DLD2_YEAST      ENANNYVMEQNYMFPLDLGAKGSCHVGGVVATNAGGLRLLRYGSLHGSVLGLEVVMPNGQIVNSMHSMRK
GLDH_BRAOL      QQLVDAIQEYGLTLQ-NFASIREQQIGGIIQVGAHGTGA-RLPPIDEQVIGMKLVTGTIELSKDNDPEL-
D2HDH_RAT       EELSRYVQERDFIMPLDLGAKGSCHIGGNVATNAGGLRFLRYGSLRGTVLGLEVVLADGTILNCLTSLRK
D2HDH_MOUSE     EELSRYVQERDFIMPLDLGAKGSCHIGGNVATNAGGLRFLRYGSLRGTVLGLEVVLADGTILNCLTSLRK
GLDH_ARATH      QQLVDAIKDYGLTLQ-NFASIREQQIGGIIQVGAHGTGA-RLPPIDEQVISMKLVTPAKGTIELSRE--K
GLDH2_ORYSJ     AELVDTLREHGLTLQ-NFASIREQQVGGIIQVGAHGTGA-RLPPIDEQVISMKLVTPAKGTIELSRE--K
D2HDH_HUMAN     EELSRYVEERDFIMPLDLGAKGSCHIGGNVATNAGGLRFLRYGSLHGTVLGLEVVLADGTVLDCLTSLRK
GLCD_ECOLI      LAISQAVAPHNLYYAPDPSSQIACSIGGNVAENAGGVHCLKYGLTVHNLLKIEVQTLDGEALTLGSDAL-
GLCD_ECOL6      LAISQAVAPHNLYYAPDPSSQIACSIGGNVAENAGGVHCLKYGLTVHNLLKIEVQTLDGEALTLGSDAL-
Y1163_HAEIN     DQLNQFLKPHGLFFAPELSTSNRATLGGMINTDASGQGSLQYGKTSNHVLALRAVLINGEILDTSAVNSV
ALO_YEAST       YQLNEFLGAKGYSIQ-NLGSISEQSVAGIISTGSHGSSPYHGLI-SSQYVNLTIVNGKGELKFLDAENDP
ALO_SCHPO       YQVQEILQNLGYSLPIVGSI-SETSVSGIMSTCTHGSSLQHQVLPH-YIKSMRIMLADGSIVTCSRELQK
GGLO_SCYTO      SDLNEKLDALGLALS-NIGAVSDVALGGVIGTGTHN-TGIQHGILATQIVAMTLMTAAGDTLECSNTVNR
RL9_STRAW       ----------------------------------------------------------------------
CKX3_ARATH      AWLWIEVLNKTLELGLTPVSYLYLTVGGTLSNGGISGQTFRYGPQITNVLEMDVITGKGEI----ATCSK
DIM_ARATH       GQISRATVPMNLSLAVVAEL-DDLTVGGLINGYGIEGSSHIYGLFADTVEAYEIVLAGGELVR----ATR


                         +         .         .         .         .         *         .:210
query           DVAGYNIKRLIAGSWGTLAVLVEAYMRIYALPESVAVMATGRKSLQELRKLHVAGAAEADGVLYLRFEGV
GLCE_ECOLI      NVAGYDLSRLMVGSYGCLGVLTEISMKVISLQEAMSEIAE-----WQLQPLPISGLCYFDNALWIRLEGG
GLCD_BACSU      DVAGYDLTRLFVGSEGTLGIVTEAIVKLVPKPET------------------------------------
ADAS_DICDI      SGAGINYKHIILGSEGTLGIITEAVMKVHAVPQAVPTFAHAVSALQQIRSSEV-----------------
ADAS_CAEEL      MSSGPDIHQIILGSEGTLGVVSEVTIKIFPIPE-------------------------------------
DLD1_YEAST      SSAGYNLNGLFVGSEGTLGIVTEATVKCHVKPETVAVVS-------------------------------
ADAS_HUMAN      MSTGPDIHHFIMGSEGTLGVITEATIKIRPVPESVAFFEQGVACLREIAKQRCAPAS-------------
ADAS_CAVPO      MSTGPDIHHFIMGSEGTLGVITEATIKIRPTPESVAFFEQGVACLREIAKQRCAPAS-------------
ADAS_MOUSE      MSTGPDIHHFIMGSEGTLGVITEATIKIRPTPESVAFFEQGVACLREIAKQRCAPAS-------------
LDHD_HUMAN      SAAGYNLTGLFVGSEGTLGLITATTLRLHPAPEATVAATCAFPSVQAASTVHILQAAVVAPTLFLEFHGS
ADAS_RAT        MSTGPDIHHFIMGSEGTLGVITEATIKIRPTPESVAFFEQGVACLREIAKQRCAPAS-------------
LDHD_MOUSE      SAAGYNLTGLFVGSEGTLGIITSTTLRLHPAPEATVAATCAFPSVQ------------------------
DLD1_KLULA      SSAGYNLNGLIIGSEGTLGIVTEATIKCHVRSETVAVV--------------------------------
ADAS_DROME      --CGPDFNHVILGSEGTLGVITEVVLKVRPLP--------------------------------------
DLD3_YEAST      DNTGYDLKQLFIGAEXXXXXXXXXXXXXXXKPKALNAVFFGIENFDTVQKLFVKAKSELSEIL-------
D2HDH_DANRE     DNTGYDLKQLFIGSEGTLGVITAVSILCPRKPKAVNVAFLGCSSFQQL----------------------
ADAS_TRYBB      RPCGVDLNAMFVGSEGAFGLVTEAVVKIERLPE-------------------------------------
D2HDH_BOVIN     DNTGYDLKQLFIGSEGTLGVITAVSILCPPKPSTVNVAFLGCPGFAEV----------------------
DLD2_YEAST      DNTGYDLKQLFXXXXXXXXXXXXXXXLTVPKPKAFNVSYLSVESFEDVQKVFVRARQELSEILAFEFMDA
GLDH_BRAOL      ----FHLARCGLGGLGVVAEVTLQCVERQELLEHTYV-----STLEEIKKNH------------------
D2HDH_RAT       DNTGYDLKQMFIGSEGTLGVITAVSIVCPPRPKAVNVAFLGCPGFTEV----------------------
D2HDH_MOUSE     DNTGYDLKQMFIGSEGTLGVITAVSIVCPPRPKAVNVAFLGCPGFAEV----------------------
GLDH_ARATH      DPELFHLARCGLGGLGVVAEVTLQCVARHELVEHTYV-----SNLQEIKKNH------------------
GLDH2_ORYSJ     DPDLFYLARCGLGGLGVVAEVTLQCVERHQLIEHTFV-----SSADEVKKNHKKWLSENKHIKYL-----
D2HDH_HUMAN     DNTGYDLKQLFIGSEGTLGIITTVSILCPPKPRAVNVAFLGCPGFAEV----------------------
GLCD_ECOLI      DSPGFDLLALFTGSEGMLGVTTEVTVKLLPKPPVARVLLASFDSVEKAGLIHAGYPVDAEAILLCELDGV
GLCD_ECOL6      DSPGFDLLALFTGSEGMLGVTTEVTVKLLPKPPVARVLLASFDSVEKAGLIHAGYPVDAEAILLCELDGV
Y1163_HAEIN     DV--------------------------------------------------------------------
ALO_YEAST       EVF-----KAALLSVGKIGIIVSATIRV------------------------------------------
ALO_SCHPO       DMFA-----AAQVSLGALGVIVDITISVVPAFDLVA----------------------------------
GGLO_SCYTO      EI--FQATRLHLGSLGVV----------------------------------------------------
RL9_STRAW       ------------GAAGDVVDVKDGYARNYLIPRNFAIRWTGEKDVEQIRKIHEIQTIEQANEIKARLEGV
CKX3_ARATH      DM-NSDLFFAVLGGLGQFGIITRARIKLEVAPKRAKWLRFLYIDFSEFTRDQERVISKTDGVDFL-----
DIM_ARATH       DNEYSDLYYAIPWSQGTLGLLVAAEIRLIKVKEYMRLTYIPVKDLQALAQGYIDSFAPKDG---------


                         .         .         .         +         .         .         .:280
query           KSEVEYRLSKAGRGDVFYDREAEEKWSSVTEAEELFASxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GLCE_ECOLI      EGSV-----KAARELLGGEEVAGQFWQQLREQQLPFFS--------------------------------
GLCD_BACSU      ----------------------------------------------------------------------
ADAS_DICDI      ----------------------------------------------------------------------
ADAS_CAEEL      ----------------------------------------------------------------------
DLD1_YEAST      ----------------------------------------------------------------------
ADAS_HUMAN      ----------------------------------------------------------------------
ADAS_CAVPO      ----------------------------------------------------------------------
ADAS_MOUSE      ----------------------------------------------------------------------
LDHD_HUMAN      QQALEEQLQRTGASDFSWAKEAEER---------------------------------------------
ADAS_RAT        ----------------------------------------------------------------------
LDHD_MOUSE      ----------------------------------------------------------------------
DLD1_KLULA      ----------------------------------------------------------------------
ADAS_DROME      ----------------------------------------------------------------------
DLD3_YEAST      ----------------------------------------------------------------------
D2HDH_DANRE     ----------------------------------------------------------------------
ADAS_TRYBB      ----------------------------------------------------------------------
D2HDH_BOVIN     ----------------------------------------------------------------------
DLD2_YEAST      KSQV---LAKSQLKDAAFPLEDEHPFYILIE---------------------------------------
GLDH_BRAOL      ----------------------------------------------------------------------
D2HDH_RAT       ----------------------------------------------------------------------
D2HDH_MOUSE     ----------------------------------------------------------------------
GLDH_ARATH      ----------------------------------------------------------------------
GLDH2_ORYSJ     ----------------------------------------------------------------------
D2HDH_HUMAN     ----------------------------------------------------------------------
GLCD_ECOLI      ESDVQEDLLKAGATDVRLAQDEAER---------------------------------------------
GLCD_ECOL6      ESDVQEDLLKAGATDVRLAQDEAER---------------------------------------------
Y1163_HAEIN     ----------------------------------------------------------------------
ALO_YEAST       ----------------------------------------------------------------------
ALO_SCHPO       ----------------------------------------------------------------------
GGLO_SCYTO      ----------------------------------------------------------------------
RL9_STRAW       KVRLAVRSGDAGR---------------------------------------------------------
CKX3_ARATH      ----------------------------------------------------------------------
DIM_ARATH       ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GLCE_ECOLI      -----------------------------------------------
GLCD_BACSU      -----------------------------------------------
ADAS_DICDI      -----------------------------------------------
ADAS_CAEEL      -----------------------------------------------
DLD1_YEAST      -----------------------------------------------
ADAS_HUMAN      -----------------------------------------------
ADAS_CAVPO      -----------------------------------------------
ADAS_MOUSE      -----------------------------------------------
LDHD_HUMAN      -----------------------------------------------
ADAS_RAT        -----------------------------------------------
LDHD_MOUSE      -----------------------------------------------
DLD1_KLULA      -----------------------------------------------
ADAS_DROME      -----------------------------------------------
DLD3_YEAST      -----------------------------------------------
D2HDH_DANRE     -----------------------------------------------
ADAS_TRYBB      -----------------------------------------------
D2HDH_BOVIN     -----------------------------------------------
DLD2_YEAST      -----------------------------------------------
GLDH_BRAOL      -----------------------------------------------
D2HDH_RAT       -----------------------------------------------
D2HDH_MOUSE     -----------------------------------------------
GLDH_ARATH      -----------------------------------------------
GLDH2_ORYSJ     -----------------------------------------------
D2HDH_HUMAN     -----------------------------------------------
GLCD_ECOLI      -----------------------------------------------
GLCD_ECOL6      -----------------------------------------------
Y1163_HAEIN     -----------------------------------------------
ALO_YEAST       -----------------------------------------------
ALO_SCHPO       -----------------------------------------------
GGLO_SCYTO      -----------------------------------------------
RL9_STRAW       -----------------------------------------------
CKX3_ARATH      -----------------------------------------------
DIM_ARATH       -----------------------------------------------