[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL63439.1

[Show Plain Result]


## Summary of Sequence Search
    1::69
  202::270     5e-07  32%  270 aa  Y1552_ARCFU RecName: Full=Uncharacterized transporter AF_1552;
  236::286     2e-04  35%  312 aa  YCBK_BACSU RecName: Full=Uncharacterized transporter ycbK;
  300::344     6e-04  44%  348 aa  TM144_MOUSE RecName: Full=Transmembrane protein 144;
  214::259     6e-04  35%  295 aa  RHTA_SALTY RecName: Full=Inner membrane transporter rhtA;
  214::259     7e-04  33%  295 aa  RHTA_ECOLI RecName: Full=Inner membrane transporter rhtA;
  214::259     7e-04  33%  295 aa  RHTA_ECOL6 RecName: Full=Inner membrane transporter rhtA;
  214::259     7e-04  33%  295 aa  RHTA_ECO57 RecName: Full=Inner membrane transporter rhtA;
  207::275     0.001  30%  276 aa  Y266_ARCFU RecName: Full=Uncharacterized transporter AF_0266;
    1::69

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGVFGTVIPYRLFSSAVTKIEGARASVIASVEPVLAALWGFLFFKEIPGLLTLTAYALISTAAVVVARK
Y1552_ARCFU     LGVVPTAVPFVLFSYGMKYVKVQRAPILALIEPLCAGLVGYFYFGETLTLTQLIGGAMILAGVLIAWRE
YCBK_BACSU      IAVVTTVIPFVLMLEGIKRIGAQRAAAISMAGPILTIFYGALFLGERLGLI------------------
TM144_MOUSE     --------------------------IITAGPGLIAALWGILIFKEIQGLLMMLAFCIILAGALCTA--
RHTA_SALTY      VAVLSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGE-----------------------
RHTA_ECOLI      VAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGE-----------------------
RHTA_ECOL6      VAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGE-----------------------
RHTA_ECO57      VAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGE-----------------------
Y266_ARCFU      LGIFSTFFGYLGWYYFLEKEEASRASVFLLAIPVVSLLAGNILLAEPLTLRTVAGSGLVLLGIYIVVRK