[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL63645.1

[Show Plain Result]


## Summary of Sequence Search
    1::641
  416::606     1e-04  31%  927 aa  SECA_KOCRD RecName: Full=Protein translocase subunit secA;
 1461::1547    1e-04  29% 3137 aa  CO6A3_CHICK RecName: Full=Collagen alpha-3(VI) chain;Flags:
    1::641

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SECA_KOCRD      ----------------------------------------------------------------------
CO6A3_CHICK     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SECA_KOCRD      ----------------------------------------------------------------------
CO6A3_CHICK     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SECA_KOCRD      ----------------------------------------------------------------------
CO6A3_CHICK     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SECA_KOCRD      ----------------------------------------------------------------------
CO6A3_CHICK     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxKDKYEQLVRDLETGPNTVKFAGVEFTVNYENKIMVKYHPRNENAKNAAVNALMARGLREGVHFTVT
SECA_KOCRD      ------KYAAVVRDIEERPVLVGTASVEKS-EYLSRLLAKRGVRHENAKNHAREAIVAQAGRKGAVTVAT
CO6A3_CHICK     ----RDFISRIVQQLDVGPNKVRIGVVQFS----NNVFPEFYLRTHKSKNAVLQAIRRLRLRGG--YPVN


                         .         .         .         .         *         .         .:420
query           TEGTERYEIRVTKEAFVKAIDALVHSGLEEGKHYSVYGKWRIISVKAEQKDVIVNALKAAGLKEGRDFTV
SECA_KOCRD      NMAGRGTDIMLGGNAEFNAVDRMAELGLDPERDAEEYARWPEVLKACEERSEHEEVLEAGGL--------
CO6A3_CHICK     AGKALDY---VVKNYFIKSAGSRIEDGVPQ----------------------------------------


                         .         .         +         .         .         .         .:490
query           KSSRYYVVYITYDGLREIQRMASNGDMEAEKFIRELEDVLRRRHGDGAAKKLTEVxxxxxxxxxxxxxxx
SECA_KOCRD      -----YVLGTERHESRRIDRSGRQGDPGESRFYLSLSDDLMRLFNPGAAQRLMAI---------------
CO6A3_CHICK     ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SECA_KOCRD      ----------------------------------------------------------------------
CO6A3_CHICK     ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SECA_KOCRD      ----------------------------------------------------------------------
CO6A3_CHICK     ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxx
SECA_KOCRD      -----------
CO6A3_CHICK     -----------