[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL63787.1

[Show Plain Result]


## Summary of Sequence Search
    1::142
    8::120     2e-17  39%  164 aa  YBP3_ACIAM RecName: Full=Uncharacterized 17.7 kDa protein in bps2
   12::138     1e-13  27%  194 aa  Y653_METJA RecName: Full=Uncharacterized protein MJ0653;
   89::201     5e-13  31%  280 aa  Y1225_METJA RecName: Full=Uncharacterized protein MJ1225;
   12::152     1e-12  30%  186 aa  Y450_METJA RecName: Full=Uncharacterized protein MJ0450;
    4::124     1e-12  31%  196 aa  Y525_METKA RecName: Full=Uncharacterized protein MK0525;AltName:
  393::501     4e-12  35%  509 aa  Y100_METJA RecName: Full=Uncharacterized protein MJ0100;
  170::284     7e-12  35%  296 aa  Y1232_METJA RecName: Full=Uncharacterized protein MJ1232;
  100::212     3e-10  32%  300 aa  YR33_THEPE RecName: Full=Uncharacterized 33.4 kDa protein in
   80::182     4e-10  39%  206 aa  UMP3_ARATH RecName: Full=Uncharacterized protein At5g10860,
  134::267     4e-10  35%  450 aa  MGTE_THET8 RecName: Full=Magnesium transporter mgtE;
  219::324     3e-08  27%  328 aa  KDSD_YERPE RecName: Full=Arabinose 5-phosphate isomerase;       
   99::240     5e-08  33%  490 aa  IMDH_AQUAE RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
   98::216     4e-07  31%  488 aa  IMDH_STAES RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
   98::216     4e-07  31%  488 aa  IMDH_STAEQ RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
   98::205     7e-07  30%  488 aa  IMDH_STAHJ RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
   98::216     7e-07  29%  488 aa  IMDH_STAAW RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
   98::216     7e-07  29%  488 aa  IMDH_STAAS RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
   98::216     7e-07  29%  488 aa  IMDH_STAAR RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
   98::216     7e-07  29%  488 aa  IMDH_STAAN RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
   98::216     7e-07  29%  488 aa  IMDH_STAAM RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
   98::216     7e-07  29%  488 aa  IMDH_STAAC RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
   98::216     7e-07  29%  488 aa  IMDH_STAAB RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
   98::216     7e-07  29%  488 aa  IMDH_STAA8 RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
   98::216     7e-07  29%  488 aa  IMDH_STAA3 RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
    2::59      1e-06  33%  265 aa  Y188_METJA RecName: Full=Uncharacterized protein MJ0188;
   82::219     1e-06  30%  730 aa  MUG70_SCHPO RecName: Full=Meiotically up-regulated gene 70 protein;
  219::324     1e-06  25%  328 aa  KDSD_SHIFL RecName: Full=Arabinose 5-phosphate isomerase;       
  219::324     1e-06  25%  328 aa  KDSD_ECOLI RecName: Full=Arabinose 5-phosphate isomerase;       
  219::324     1e-06  25%  328 aa  KDSD_ECO57 RecName: Full=Arabinose 5-phosphate isomerase;       
   22::165     2e-06  36%  168 aa  Y1426_METJA RecName: Full=Uncharacterized protein MJ1426;
  111::188     2e-06  36%  421 aa  Y1404_METJA RecName: Full=Uncharacterized protein MJ1404;
  219::324     2e-06  25%  328 aa  KDSD_ECOL6 RecName: Full=Arabinose 5-phosphate isomerase;       
   10::127     3e-06  28%  127 aa  Y868_METJA RecName: Full=Uncharacterized protein MJ0868;
   98::216     4e-06  30%  488 aa  IMDH_STAS1 RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
  101::203     2e-05  31%  486 aa  IMDH_PYRHO RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
  104::219     2e-05  29%  493 aa  IMDH_STRP3 RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
  101::203     2e-05  31%  485 aa  IMDH_PYRAB RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
  104::219     3e-05  29%  493 aa  IMDH_STRPY RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
  104::219     3e-05  29%  493 aa  IMDH_STRP8 RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
  104::219     3e-05  29%  493 aa  IMDH_STRP6 RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
  104::219     3e-05  29%  493 aa  IMDH_STRP1 RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
  216::314     4e-05  26%  321 aa  GUTQ_ECOLI RecName: Full=Protein gutQ;
  223::324     5e-05  24%  328 aa  KDSD_SALTY RecName: Full=Arabinose 5-phosphate isomerase;       
  223::324     6e-05  24%  328 aa  KDSD_SALTI RecName: Full=Arabinose 5-phosphate isomerase;       
  214::278     1e-04  32%  329 aa  YE29_HELPJ RecName: Full=Uncharacterized protein jhp_1324;
   95::206     1e-04  27%  494 aa  IMDH_CHLP8 RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
  628::730     1e-04  32%  746 aa  CLCN5_CAVPO RecName: Full=H(+)/Cl(-) exchange transporter
   95::206     1e-04  28%  494 aa  IMDH_CHLTE RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
  214::278     3e-04  31%  329 aa  Y1429_HELPY RecName: Full=Uncharacterized protein HP_1429;
  700::802     3e-04  27%  818 aa  CLCN3_RAT RecName: Full=H(+)/Cl(-) exchange transporter 3;AltName:
  122::181     3e-04  28%  352 aa  ADA_MOUSE RecName: Full=Adenosine deaminase;       
  619::730     4e-04  32%  746 aa  CLCN5_RAT RecName: Full=H(+)/Cl(-) exchange transporter 5;AltName:
  619::730     4e-04  32%  746 aa  CLCN5_RABIT RecName: Full=H(+)/Cl(-) exchange transporter
  619::730     4e-04  32%  746 aa  CLCN5_PONAB RecName: Full=H(+)/Cl(-) exchange transporter
  619::730     4e-04  32%  746 aa  CLCN5_PIG RecName: Full=H(+)/Cl(-) exchange transporter 5;AltName:
  619::730     4e-04  32%  746 aa  CLCN5_MOUSE RecName: Full=H(+)/Cl(-) exchange transporter
  619::730     4e-04  32%  746 aa  CLCN5_HUMAN RecName: Full=H(+)/Cl(-) exchange transporter
  691::802     4e-04  32%  818 aa  CLCN3_RABIT RecName: Full=H(+)/Cl(-) exchange transporter
  674::785     4e-04  32%  801 aa  CLCN3_PONAB RecName: Full=H(+)/Cl(-) exchange transporter
  691::802     4e-04  32%  818 aa  CLCN3_MOUSE RecName: Full=H(+)/Cl(-) exchange transporter
  691::802     4e-04  32%  818 aa  CLCN3_HUMAN RecName: Full=H(+)/Cl(-) exchange transporter
  633::744     4e-04  32%  760 aa  CLCN3_CAVPO RecName: Full=H(+)/Cl(-) exchange transporter
   71::142     7e-04  30%  496 aa  IMDH_METJA RecName: Full=Inosine-5'-monophosphate dehydrogenase;   
  256::332     9e-04  30%  339 aa  Y392_METJA RecName: Full=Zinc metalloprotease MJ0392;       
    1::142

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPVDN
YBP3_ACIAM      -----IATTKVYVVKPNVTIAEAAKEMKEHNLGSLVV-IDSQNRVVGIITERDIVKA-ASNRDIDSPVEK
Y653_METJA      -----VMSFPVIKATKNMSIYDIANIMTENNIGAVVIVENNKP--IGIVTERDIVRVVSKNLKPKDVLEE
Y1225_METJA     -----IMEENVITLKENADIDEAIETFLTKNVGGAPIVND-ENQLISLITERDVIRALLDKIDENEVIDD
Y450_METJA      --------KKPIVVSGDVSVYDVAKLMVEQDVPVLVVCERPNHESIEVATDKDIIKKVLIRKLPPDKVED
Y525_METKA      VSVGEVARRDVITGSPTETAVEIAYKMREHGIGSVVIVNE-KDEPIGIITERDVIKVVSQGKNPDEVIAD
Y100_METJA      -----ILSKPPITAHSNISIMEAAKILIKHNINHLPIVDEHGK-LVGIITSWDIAKALA---QNKKTIEE
Y1232_METJA     IKVGDVGIKEVWTINPNCTLRETAKLFAEKYIGAPVVDND---KLVGVISLHDIAENIDN---IDKKVKE
YR33_THEPE      -----------------SDLREVIELMVERGIGALAVVDEDLR-VVGIVSERHVISLLAN-VETHVKVKE
UMP3_ARATH      ------------------TVYDAVKSMTQHNVGALVVVKPGEQQLAGIITERDYLRKIIGRSSKSTKVGD
MGTE_THET8      --AGGLMTPEYVAVREGMTVEEVLRFLRRAETIYYIYVVDEKGRLKGVLSLRDLIVA-----DPRTRVAE
KDSD_YERPE      -------------VSPDASLRDALLEITRKSLGLTVICDDSMR-IKGIFTDGDLRRVFDMGIDLNNAIAD
IMDH_AQUAE      ---------NPVTVKPDTRVKEALDIMAKYKISGVPVVDE-ERKLIGILTNRDL-----RFIKPSKPVSE
IMDH_STAES      ---------NPFFLTPEESVYEAEALMGKYRIGVPIVDNQEDRKLIGILTNRDLIEDFSIKISDVMTKDN
IMDH_STAEQ      ---------NPFFLTPEESVYEAEALMGKYRIGVPIVDNQEDRKLIGILTNRDLIEDFSIKISDVMTKDN
IMDH_STAHJ      ---------NPFYLTPDESVYEAEALMGKYRIGVPIVSDKESRELVGILTNRDLIEDFSIKISDVMTKEN
IMDH_STAAW      ---------NPFFLTPEESVYEAEALMGKYRIGVPIVDNKEDRNLVGILTNRDLIEDFSIKIVDVMTQEN
IMDH_STAAS      ---------NPFFLTPEESVYEAEALMGKYRIGVPIVDNKEDRNLVGILTNRDLIEDFSIKIVDVMTQEN
IMDH_STAAR      ---------NPFFLTPEESVYEAEALMGKYRIGVPIVDNKEDRNLVGILTNRDLIEDFSIKIVDVMTQEN
IMDH_STAAN      ---------NPFFLTPEESVYEAEALMGKYRIGVPIVDNKEDRNLVGILTNRDLIEDFSIKIVDVMTQEN
IMDH_STAAM      ---------NPFFLTPEESVYEAEALMGKYRIGVPIVDNKEDRNLVGILTNRDLIEDFSIKIVDVMTQEN
IMDH_STAAC      ---------NPFFLTPEESVYEAEALMGKYRIGVPIVDNKEDRNLVGILTNRDLIEDFSIKIVDVMTQEN
IMDH_STAAB      ---------NPFFLTPEESVYEAEALMGKYRIGVPIVDNKEDRNLVGILTNRDLIEDFSIKIVDVMTQEN
IMDH_STAA8      ---------NPFFLTPEESVYEAEALMGKYRIGVPIVDNKEDRNLVGILTNRDLIEDFSIKIVDVMTQEN
IMDH_STAA3      ---------NPFFLTPEESVYEAEALMGKYRIGVPIVDNKEDRNLVGILTNRDLIEDFSIKIVDVMTQEN
Y188_METJA      ----------------------------------------------------------------SVKVSE
MUG70_SCHPO     -------------------VTETAQLMAAKRQNCVLVVDDDEQ-LAGIVTATDIARCVGAGLNARQTIAD
KDSD_SHIFL      -------------VKKTASLRDALLEVTRKNLGMTVICDD-NMMIEGIFTDGDLRRVFDMGVDVRQSIAD
KDSD_ECOLI      -------------VKKTASLRDALLEVTRKNLGMTVICDD-NMMIEGIFTDGDLRRVFDMGVDVRQSIAD
KDSD_ECO57      -------------VKKTASLRDALLEVTRKNLGMTVICDD-NMMIEGIFTDGDLRRVFDMGVDVRQSIAD
Y1426_METJA     --------KKPIVVYEDNDLIDVIRLFRKNKIGAPVLNKDGK--LVGIISESDIVKTIVTHILPS-PLDD
Y1404_METJA     --------------------------------------------MVGIITDYDIMRAAKSKIMKDTKVTK
KDSD_ECOL6      -------------VKKTASLRDALLEVTRKNLGMTVICDD-NMMIEGIFTDGDLRRVFDMGVDVRRSIAD
Y868_METJA      -----VMKKGVVEVTLDTKLSDVIKTMAKYDISSVVVSDG--ETFWGIITDTDVLKHYNDLDKTAE---E
IMDH_STAS1      ---------NPFFLTPEESVFEAEALMGKYRIGVPIVNNKEDRQFVGIITNRDL-RFIEDF---SIKISD
IMDH_PYRHO      --------EDVITIAPDETVDFALFLMEKHGIDGLPVVEDEK--VVGIITKKDI------AAREGKLVKE
IMDH_STRP3      -------------LTPEHKVSEAEELMQRYRIGVPIVETLANRKLVGIITNRDM-RFISNYNAPIS--EH
IMDH_PYRAB      --------EDVITISPEETVDFALFLMEKHDIDGLPVVENEK--VVGIISKKDI------AAREGKLVKE
IMDH_STRPY      -------------LTPEHKVSEAEELMQRYRIGVPIVETLANRKLVGIITNRDM-RFISDYNAPIS--EH
IMDH_STRP8      -------------LTPEHKVSEAEELMQRYRIGVPIVETLANRKLVGIITNRDM-RFISDYNAPIS--EH
IMDH_STRP6      -------------LTPEHKVSEAEELMQRYRIGVPIVETLANRKLVGIITNRDM-RFISDYNAPIS--EH
IMDH_STRP1      -------------LTPEHKVSEAEELMQRYRIGVPIVETLANRKLVGIITNRDM-RFISDYNAPIS--EH
GUTQ_ECOLI      -----------------ASVMDAMLELSRTGLG-LVAVCDAQQQVQGVFTDGDLRRWLVGGGALTTPVNE
KDSD_SALTY      -----------------ATLRDALLEITRKNLGMTVICDESMK-IDGIFTDGDLRRVFDMGGDMRQGIAE
KDSD_SALTI      -----------------ATLRDALLEITRKNLGMTVICDESMK-IDGIFTDGDLRRMFDMGGDMRQGIAE
YE29_HELPJ      ---------NLPLIAPSTSFKDALIEMSEKRLGSAILVND-NNELVGVLSDGDVRRALLKGLSLESEVKH
IMDH_CHLP8      --------RNPITLFEDATIQEAIDLMLRHSIGIPVVERPTPEGLKGIVTNRDLRMTTSS----NEKITT
CLCN5_CAVPO     ---------------------------SQRLVGFLIISENARKEQDGVVSTSIIYFTVPPYTAPTLKLRN
IMDH_CHLTE      --------RNPIHLFEDATIQDAIDLMIRHSIGIPVVEHPTPEGLKGIVTNRDLRMTASS----DEKITT
Y1429_HELPY     ---------NLPLIAPSTSFKDALIEMSEKRLGSAILVNEAN-ELVGVLSDGDVRRALLKGVSLKSEVRH
CLCN3_RAT       ---------------------------SQRLVGFAIAIESARKKQEGVVGSSRVCFAQHTPSLPAESPRP
ADA_MOUSE       ----------------------------------------------GDVTPDDVVDLVNQGLQEGEQAFG
CLCN5_RAT       --------------------------------GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVRN
CLCN5_RABIT     --------------------------------GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVRN
CLCN5_PONAB     --------------------------------GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVRN
CLCN5_PIG       --------------------------------GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVRN
CLCN5_MOUSE     --------------------------------GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVRN
CLCN5_HUMAN     --------------------------------GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVRN
CLCN3_RABIT     --------------------------------GFPVIMSKESQRLVGFALRRDLTIAIESARKPSLPAES
CLCN3_PONAB     --------------------------------GFPVIMSKESQRLVGFALRRDLTIAIESARKPSLPAES
CLCN3_MOUSE     --------------------------------GFPVIMSKESQRLVGFALRRDLTIAIESARKPSLPAES
CLCN3_HUMAN     --------------------------------GFPVIMSKESQRLVGFALRRDLTIAIESARKPSLPAES
CLCN3_CAVPO     --------------------------------GFPVIMSKESQRLVGFALRRDLTIAIESARKPSLPAES
IMDH_METJA      ----------------------------------------------GVIHRNMSIEEQVHQVQAVKKADE
Y392_METJA      -----------------------------------------------VVENGKLVGCIGIGIHKKEGTVR


                         .         .         *         .         .         .         .:140
query           IMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKESDVIERLVEYAEERIDEISA
YBP3_ACIAM      YMTKDVKGVTEDTEVTDALDIMLNNGFRHLIIKSNGKLYGIVSIRDLAR---------------------
Y653_METJA      VMSKKIITIPQNASITEAAKIMATHGIKRLPVVKDGELVGIVTQSDIVRVSELLEIVIEYA---------
Y1225_METJA     YITRDVIVATPGERLKDVARTMVRNGFRRLPVVSEGRLVGIITSTDFIK---------------------
Y450_METJA      ISSGKLVTIPPNTTIDEALEIMNKYKTNELFIVDDGKIVGVITEEDLIKIASTLKELVNYLLQIIDEVTS
Y525_METKA      IMSQPVITVEEDMEVNEAVKLMVDKGIRRLIVDDNGKLIGIVTMQDILQ---------------------
Y100_METJA      IMTRNVITAHEDEPVDHVAIKMSKYNISGVPVVDDRRVVGIVTSEDI-----------------------
Y1232_METJA     VMRRDVITIHKDEKIYDALKIMNKNNVRLVIVDDNNKIVGIITRTDILK---------------------
YR33_THEPE      IMTSEVVYLSPMDSLFEGMRVMSERRIRRLPLVSGEELRGIVTIKDVLSREDVLARLKE-----------
UMP3_ARATH      IMTEKLITVTPETKVLRAMQLMTDNRIRHIPVIKDKGMIGMVSIGD------------------------
MGTE_THET8      IMNPKVVYVRTDTDQEEVARLMADYDFTVLPVVDEGRLVGIVTVDDVL---DVLE---AEATEDIHKLGA
KDSD_YERPE      VMTRGGIRVPPNILAVDALNLMESRHITALLVADGDQLLGVVHMHDMLR---------------------
IMDH_AQUAE      FMTKELITAPEGITLDEAEEIFRKYKIEKLPIVDKGKIKGLITIKDIVKRKDELGRLVGTGEETLDRVAA
IMDH_STAES      LITAPV-----GTTLDEAEAILQKHKIEKLPLVENGRLEGLITIKD-------IEKVLEFPYAAKDE---
IMDH_STAEQ      LITAPV-----GTTLDEAEAILQKHKIEKLPLVENGRLEGLITIKD-------IEKVLEFPYAAKDE---
IMDH_STAHJ      LITAPV-----GTTLDEAETILQEHKIEKLPLVENGRLEGLITIKDIEK---------------------
IMDH_STAAW      LITAPV-----NTTLEEAEKILQKHKIEKLPLVKDGRLEGLITIKD-------IEKVIEFPNAAKDE---
IMDH_STAAS      LITAPV-----NTTLEEAEKILQKHKIEKLPLVKDGRLEGLITIKD-------IEKVIEFPNAAKDE---
IMDH_STAAR      LITAPV-----NTTLEEAEKILQKHKIEKLPLVKDGRLEGLITIKD-------IEKVIEFPNAAKDE---
IMDH_STAAN      LITAPV-----NTTLEEAEKILQKHKIEKLPLVKDGRLEGLITIKD-------IEKVIEFPNAAKDE---
IMDH_STAAM      LITAPV-----NTTLEEAEKILQKHKIEKLPLVKDGRLEGLITIKD-------IEKVIEFPNAAKDE---
IMDH_STAAC      LITAPV-----NTTLEEAEKILQKHKIEKLPLVKDGRLEGLITIKD-------IEKVIEFPNAAKDE---
IMDH_STAAB      LITAPV-----NTTLEEAEKILQKHKIEKLPLVKDGRLEGLITIKD-------IEKVIEFPNAAKDE---
IMDH_STAA8      LITAPV-----NTTLEEAEKILQKHKIEKLPLVKDGRLEGLITIKD-------IEKVIEFPNAAKDE---
IMDH_STAA3      LITAPV-----NTTLEEAEKILQKHKIEKLPLVKDGRLEGLITIKD-------IEKVIEFPNAAKDE---
Y188_METJA      YMTKKVVTVSKDNTVKDVIKLLKETGHNSFPVVENGKLIGIVSVHDIVGKDD------------------
MUG70_SCHPO     IMSTSPLCITSDTRFDDALLLMIEHKFRHLPVVDEGDVIGIINMRACLREQEAAQKLVEALEGAQEEI--
KDSD_SHIFL      VMTPGGIRVRPGILAVEALNLMQSRHITSVMVADGDHLLGVLHMHDLLR---------------------
KDSD_ECOLI      VMTPGGIRVRPGILAVEALNLMQSRHITSVMVADGDHLLGVLHMHDLLR---------------------
KDSD_ECO57      VMTPGGIRVRPGILAVEALNLMQSRHITSVMVADGDHLLGVLHMHDLLR---------------------
Y1426_METJA     VMTRKVIVAKPDMTINDAAKLMVKNNIKRLPVVDDGNLIGIVTRGDLIE---------------------
Y1404_METJA     IMTRNVITINENDSIGKARALMRDNNIRLVVVDDEGNPVGMVTEVDILKK--------------------
KDSD_ECOL6      VMTPGGIRVRPGILAVEALNLMQSRHITSVMVADGDHLLGVLHMHDLLR---------------------
Y868_METJA      IMTTNPITVSPEAPLEKAVEIMAEKGIHHLYVKSEDKIVGVLSSKDIIKFSDLIE---------------
IMDH_STAS1      VMTKELVTAPVGTTLDEAEKLLQQHKIEKLPLVKEGRLEGLITIKD-------IEKVLEFPNSAKDE---
IMDH_PYRHO      LMTKEVITVPESIEVEEALKIMIENRIDRLPVVDRGKLVGLITMSDLV----------------------
IMDH_STRP3      MTSEHLVTAAVGTDLETAERILHEHRIEKLPLVDNGRLSGLITIKD-------IEKVIEFPHAAKDE---
IMDH_PYRAB      LMTKDVITVPENIEVEEALKIMIENRIDRLPVVDEGRLIGLITMSDLV----------------------
IMDH_STRPY      MTSEHLVTAAVGTDLETAERILHEHRIEKLPLVDNGRLSGLITIKD-------IEKVIEFPHAAKDE---
IMDH_STRP8      MTSEHLVTAAVGTDLETAERILHEHRIEKLPLVDNGRLSGLITIKD-------IEKVIEFPHAAKDE---
IMDH_STRP6      MTSEHLVTAAVGTDLETAERILHEHRIEKLPLVDNGRLSGLITIKD-------IEKVIEFPHAAKDE---
IMDH_STRP1      MTSEHLVTAAVGTDLETAERILHEHRIEKLPLVDNGRLSGLITIKD-------IEKVIEFPHAAKDE---
GUTQ_ECOLI      AMTVGGTTLQSQSRAIDAKEILMKRKITAAPVVDNGKLTGAINLQD------------------------
KDSD_SALTY      VMTPGGIRVRPGILAVDALNLMQSRHITSVLVADGDQLLGVLHMHDLLR---------------------
KDSD_SALTI      VMTPGGIRVRPGILAVDALNLMQSRHITSVLVADGDQLLGVLHMHDLLR---------------------
YE29_HELPJ      FATLK-----------------------------------------------------------------
IMDH_CHLP8      IMTTDLITAQEDIDLLAAEEILMQNKIEKLLVIDEGYLKGLITFKDIQK---------------------
CLCN5_CAVPO     ILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLK---------------------
IMDH_CHLTE      IMTTNLVTAKEGIDLLTAEDILMRNKIEKLLIIDNGYLKGLITFKDIQK---------------------
Y1429_HELPY     FATLK-----------------------------------------------------------------
CLCN3_RAT       LKLRSILTVTDHTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDILR---------------------
ADA_MOUSE       IKVRSILCCMRHQPSWEVLELCKKYNQKTVVAMD------------------------------------
CLCN5_RAT       ILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLK---------------------
CLCN5_RABIT     ILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLK---------------------
CLCN5_PONAB     ILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLK---------------------
CLCN5_PIG       ILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLK---------------------
CLCN5_MOUSE     ILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLK---------------------
CLCN5_HUMAN     ILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLK---------------------
CLCN3_RABIT     ILDMSPFTVTDHTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDILR---------------------
CLCN3_PONAB     ILDMSPFTVTDHTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDILR---------------------
CLCN3_MOUSE     ILDMSPFTVTDHTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDILR---------------------
CLCN3_HUMAN     ILDMSPFTVTDHTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDILR---------------------
CLCN3_CAVPO     ILDMSPFTVTDHTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDILR---------------------
IMDH_METJA      VVIKDVITVSPDDTVGEAINVMETYSISGLPVVDNDKLVGIITHRDV-----------------------
Y392_METJA      DYMEKPVVVSEDTDIKEILRKMA--NTDRVFVVEGGKLKGIISKTDILRAMSILE---------------


                         +         .         .         .         .         *         .:210
query           HD
YBP3_ACIAM      --
Y653_METJA      --
Y1225_METJA     --
Y450_METJA      GD
Y525_METKA      --
Y100_METJA      --
Y1232_METJA     --
YR33_THEPE      --
UMP3_ARATH      --
MGTE_THET8      VD
KDSD_YERPE      --
IMDH_AQUAE      --
IMDH_STAES      --
IMDH_STAEQ      --
IMDH_STAHJ      --
IMDH_STAAW      --
IMDH_STAAS      --
IMDH_STAAR      --
IMDH_STAAN      --
IMDH_STAAM      --
IMDH_STAAC      --
IMDH_STAAB      --
IMDH_STAA8      --
IMDH_STAA3      --
Y188_METJA      --
MUG70_SCHPO     --
KDSD_SHIFL      --
KDSD_ECOLI      --
KDSD_ECO57      --
Y1426_METJA     --
Y1404_METJA     --
KDSD_ECOL6      --
Y868_METJA      --
IMDH_STAS1      --
IMDH_PYRHO      --
IMDH_STRP3      --
IMDH_PYRAB      --
IMDH_STRPY      --
IMDH_STRP8      --
IMDH_STRP6      --
IMDH_STRP1      --
GUTQ_ECOLI      --
KDSD_SALTY      --
KDSD_SALTI      --
YE29_HELPJ      --
IMDH_CHLP8      --
CLCN5_CAVPO     --
IMDH_CHLTE      --
Y1429_HELPY     --
CLCN3_RAT       --
ADA_MOUSE       --
CLCN5_RAT       --
CLCN5_RABIT     --
CLCN5_PONAB     --
CLCN5_PIG       --
CLCN5_MOUSE     --
CLCN5_HUMAN     --
CLCN3_RABIT     --
CLCN3_PONAB     --
CLCN3_MOUSE     --
CLCN3_HUMAN     --
CLCN3_CAVPO     --
IMDH_METJA      --
Y392_METJA      --