[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL63893.1

[Show Plain Result]


## Summary of Sequence Search
    1::516
    7::511     e-134  49%  563 aa  Y963_METJA RecName: Full=Uncharacterized protein MJ0963;
  748::1247    8e-74  39% 1288 aa  OPLA_HUMAN RecName: Full=5-oxoprolinase;         EC=3.5.2.9;AltName:
  750::1263    1e-71  38% 1266 aa  OPLA_ARATH RecName: Full=5-oxoprolinase;         EC=3.5.2.9;AltName:
  761::1284    1e-71  38% 1286 aa  YKV5_YEAST RecName: Full=Uncharacterized protein YKL215C;
  748::1247    1e-70  40% 1288 aa  OPLA_RAT RecName: Full=5-oxoprolinase;         EC=3.5.2.9;AltName:
  748::1247    1e-70  41% 1288 aa  OPLA_MOUSE RecName: Full=5-oxoprolinase;         EC=3.5.2.9;AltName:
  748::1247    2e-70  40% 1288 aa  OPLA_BOVIN RecName: Full=5-oxoprolinase;         EC=3.5.2.9;AltName:
  763::1284    6e-69  38% 1317 aa  YAOF_SCHPO RecName: Full=Uncharacterized protein C11D3.15;
  762::1234    2e-67  37% 1265 aa  OPLA_DICDI RecName: Full=5-oxoprolinase;         EC=3.5.2.9;AltName:
  744::1256    2e-65  34% 1260 aa  YAOE_SCHPO RecName: Full=Uncharacterized protein C11D3.14c;
   26::543     1e-53  29%  592 aa  HYUB_PSESN RecName: Full=Hydantoin utilization protein B;AltName:
    1::516

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxELIYRATVYIAEEAGIALRNSAFSPNIRERMDHSVAVLNASGEIVAQAEHIPVHLGSFYVGVKNLFN
Y963_METJA      ---EVIKSSTSYIAEEMGIILRNTAYSPNIKDRLDFSCAILSSNGELIAQAEHIPVHLGSMAIGVKNTVD
OPLA_HUMAN      ------------IAEQMGRILQRTAISTNIKERLDFSCALFGPDGGLVSNAPHIPVHLGAMQETVQF---
OPLA_ARATH      ------------IAEQMGRTLQRTSISTNIKERLDFSCALFSPDGGLVANAPHVPVHLGAMSSTVRW---
YKV5_YEAST      ------------IALQMGTQLRKTSVSTNVKERLDFSCALFDSKGNLVANAPHVPVHLGSMSTCISAQAK
OPLA_RAT        ------------IAEQMGRILQRTAISTNIKERLDFSCALFGPDGGLVSNAPHIPVHLGAMQETVQF---
OPLA_MOUSE      ------------IAEQMGRILQRTAISTNIKERLDFSCALFGPDGGLVSNAPHIPVHLGAMQETVQF---
OPLA_BOVIN      ------------IAEQMGRILQRTAISTNIKERLDFSCALFGPDGGLVSNVPHIPVHLGAMQETVQF---
YAOF_SCHPO      ------------VAEQMGRALQKTSVSTNVKERLDYSCALFDAKGNLVANAPHMPVHLGSMSTCVRT--Q
OPLA_DICDI      ------------IAEQMGKIIIRTSISTNIKERLDFSCALFSPDGGLVANAPAIPIHVGSMQNAVKYQVE
YAOE_SCHPO      ------------ISEQMGQVLQKTAVSVNVKERLDYSCALFSPDGGLVANAPHVPAMLGSMQTAVKWQHN
HYUB_PSESN      ------------VAVEMGHKLARMSYSSIIRESEDFGCALVDVRGQQLCESSHTPLQSGPIPGYIKGIRE


                         .         .         *         .         .         .         .:140
query           ALREAGVELEEGDVVALNDPYISGTHLNDVMVVTPVFWRGRLVAYIVNKAHHVDVGGPVPGSINPSAKTI
Y963_METJA      YLKKESIEIEKDDVIIVNDPYIAGTHLNDITLLKPIFYNDEIIGYVANKAHHVDVGGYAPGSISSNVKEL
OPLA_HUMAN      QIQHLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFWPGRPVFYVASRGHHADIGGITPGSMPPHSTML
OPLA_ARATH      QLKHWGENLNEGDVLVTNHPCAGGSHLPDITVITPVFDKGKLVFFVASRGHHAEVGGITPGSMPPFSKAI
YKV5_YEAST      LWEG---KLKPGDVLITNHPDIGGTHLPDITVITPSFSSGELIFYVASRAHHADIGGILPGSVPPNSKEL
OPLA_RAT        QIQHLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFWPGRPVFYVASRGHHADIGGITPGSMPPHSTTL
OPLA_MOUSE      QIQHLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFWPGRPVFYVASRGHHADIGGITPGSMPPHSTTL
OPLA_BOVIN      QIQQLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFWPGRPVFYVASRGHHADIGGITPGSMPPHSTSL
YAOF_SCHPO      AKIHEG-KLKPGDVLVTNHPSYGGTHLPDITTITPHFEGDEIMFYVAARAHHADIGGILPGSMPSSSKEL
OPLA_DICDI      TL---GSNWKEGEVVLSNHPQAGGSHLPDLTVMTPVYHKGEIVFFVASRGHHADIGGITPGSMPPFSKSI
YAOE_SCHPO      YWKG---KLVPGDVLLSNHPIAGGVHLPDLTVVTPVFDNNKIIFYCAARGHMVDVGGITPGSMPSNSKAI
HYUB_PSESN      IMEDRNDTFNQGDVIMHNSPYHGASHGPDVGFCIPVFYKDELIGFSVTTAHHLDIGSSTPGSCGVDAVDA


                         +         .         .         .         .         *         .:210
query           YEEGFVLPPVKIIKRGEVNKEALSIWLSNVKTPEATIGDLNAQIAANRVGTRRIVELFDKYGALVEEAWK
Y963_METJA      YHEGLIIPPSKLVINGKLNKELLNLITSNVRVPKSTIGDLKAQIASLNIGVERILKLIEKYGREVTEAWN
OPLA_HUMAN      QQEGAVFLSFKLVQGGVFQEEAVTEALSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYM
OPLA_ARATH      WEEGAAIKAFKVVEKGVFQEEGIVKLLQFPSSDETTLSDLQAQIAANQRGISLIKELIEQYGLGTVQAYM
YKV5_YEAST      YEEGTAIYSELVVKEGIFQEEL--IYKLFVEDPSDNISDLKAQVAANTKGIQLIGSLTKEYDLATILKYM
OPLA_RAT        QQEGAVFLSFKLVQGGVFQEEAVTEALSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYM
OPLA_MOUSE      QQEGAVFLSFKLVQGGVFQEEAVTEALSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYM
OPLA_BOVIN      QQEGAVFLSFKLVHGGVFQEEAVTEALSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYM
YAOF_SCHPO      SEEGATIKSEKLVVDGVFQEERMIDLLSGSRCLRDNLNDLKAQVSANQKGINLITSLIKEYGKNSVLRYM
OPLA_DICDI      SEEGAAIMSLKIVKDGHFQEEAVRKTFEKSRNLSDNISDLKAQIAANHKGIQLMQELINHYGLDVVHAYM
YAOE_SCHPO      YEEGAAIKTFKVVKAGTFDEKGLTQLLSGSRTLRDNISDVKAMLSACHRGRSMVEKLVVEYGLDIVQRSM
HYUB_PSESN      YAEGLQFKAIKVYDQGVKNRYVWDILKDNIRAPKLVVGDMEXXXXXXXXXXXXYIEIIEKYGLTVQAASE


                         .         .         .         +         .         .         .:280
query           RAIEYGRLMTQSEISKWPRGVYVAEDYLELGDKFLKIAVRLTIGECVEANYSGTDPQVDAPLNAVLGVTY
Y963_METJA      KSLDYSEEYLKSKI-RDINCICEAVDYLEYKDKLININMKIEINGKIKVDFTGTHRQLDAPLNAVYGVTV
OPLA_HUMAN      GHIQANAELAVRDMSRQARGLPLSEDHMDDGSPILRVQISLSQGSAV-FDFSGTGPEVFGNLNAPRAVTL
OPLA_ARATH      KYVQLNRVSSETPNSRVGNSVTIEEDYMDDGSIILKLTIDADKGE-ASFDFTGTSPEVYGNWNAPEAVTS
YKV5_YEAST      AAIQTNKKMLAKMVEHFGTTKFSGEDRLDDGSLILQVIIRPEKEEYI-FNFDGTSPQVYGNLNAPEAITN
OPLA_RAT        GHIQANAELAVRDMSRQARGLPLAEDHMDDGSPILRVQINLSQGSAV-FDFTGSGSEVFGNLNAPRAITL
OPLA_MOUSE      GHIQANAELAVRDMSRQARGLPLAKDHMDDGSPILHVQINLNQGSAV-FDFSGSGSEVFGNLNAPRAITL
OPLA_BOVIN      GHIQANAELAVRDMARQARGLPLAEDHMDDGSPILRVQINMSQGSAV-FDFSGSGPEVFGNLNAPRAITL
YAOF_SCHPO      KAIQEN---AESAVRQLLLGVLYAEDHMDDGS---KICLRITIDEDAIFDFTGTTEEIYGNINAPEAVTY
OPLA_DICDI      YHIQKNAELAVRDMNLKPLDTLISTDYMDDGS---KIELKLTIDREKKSDWSGSGVEVYGNTNAPTSITL
YAOE_SCHPO      YGIQAAAEKAVRDVLKASQKPLKAIDYMDDGTPLLEVKIDPETGDAV-FDFEGTGPEVYGNWNAPIAITY
HYUB_PSESN      ELMNYSEKMMRDAIKKLPDGEYTAEGFLDPAKKDLRINVTVKVGSDLTVDLTGTSPQVDKPINPLLGTVD


                         .         *         .         .         .         .         +:350
query           AATSFPIRCLIRGDVPINEGFYSCISVKAPEGSLLNPKRPAAVAGGNLETSQRTADAVFKALAEAMPDKV
Y963_METJA      ASTSFALKAVIDPDLPMNHGIFRVLNIIAPEETIVNPKKPAPVSVGNVETSQRIVDVIFKALYHEFPDRV
OPLA_HUMAN      SALIYCLRCLVGRDIPLNQGCLAPVRVVIPRGSILDPSPEAAVVGGNVLTSQRVVDVILGAFGAC-----
OPLA_ARATH      AAVIYCLRCLVNVDIPLNQGCLAPVEIRIPAGSFLSPSEKAAVVGGNVLTSQRVTDVVLTAF------QA
YKV5_YEAST      SAILYCLRCLVGEDIPLNQGCLKPLTIKIPAGSLLSPRSGAAVVGGNVLTSQRVTDVIFNVMADSQGDCX
OPLA_RAT        SALIYCLRCLVGRDIPLNQGCLAPVRVIIPKGSILDPSPEAAVVGGNVLTSQRVVDVILGAFGAC-----
OPLA_MOUSE      SALIYCLRCLVGRDIPLNQGCLAPVQVIIPKGSILDPSPEAAVVGGNVLTSQRVVDVILGAFGAC-----
OPLA_BOVIN      SALIYCLRCLVGRDIPLNQGCLAPVRVVIPKGSILDPSPDAAVVGGNVLTSQRVVDVILGAFGAC-----
YAOF_SCHPO      SAIIYCLRVLISENIPLNQGCLLPIKVIIPDNCFLKPSETAAVVGGNVLTSQRITDTILKAF------QA
OPLA_DICDI      SATIYSLRAMVKSEIPLNQGCLAPILTVIPPGSILNPSFDSAVVGGNVLTSQRLTDVILSAFGAC-----
YAOE_SCHPO      SSVIYCLRSIINQDIPLNEGCLKPIEIRIPPSCFLNPSETAAVVGGNVLTSQRITDVILKAFS------I
HYUB_PSESN      IAIYLTLRSIVYGNFPQNSGLIRPIKIVAPKGTLCNPIFPAPTI-ARFNSGNAVADTLMKALAQVVPHQV


                         .         .         .         .         *         .         .:420
query           PAAGSGTMMNVMMGGVYQGKYWSYYETIXXXXXXXXXXXXVSGVHVNMTNTLNTPIEIAERTYPLLFTAY
Y963_METJA      PAASNGSMNNVIIG----GRGWAFYETIXXXXXXXXXXXXXXXVHANMTNTLNTPIEVIENEYPIMILEY
OPLA_HUMAN      -AASQGCMNNVTLGNAHMG----YYETVAGGAGAGPSWHGRSGVHSHMTNTRITDPEILESRYPVILXXX
OPLA_ARATH      CACSQGCMNNLTFG----DDTFGYYETIGGGCGAGPTWNGTSGVQCHMTNTRMTDPEIFEQRYPVLLHRF
YKV5_YEAST      XXXXXXXXXXXXKTD-KQIKGFGYYETICGGSGAGADSWRGSGVHTNMTNTRMTDTEVFERRYPVLLKEF
OPLA_RAT        -SASQGCMNNVTLGNARMG----YYETVXXXXXXXXXXXXXXXVHSHMTNTRITDPEILESRYPVILRRF
OPLA_MOUSE      -AASQGCMNNVTLGNARMG----YYETVXXXXXXXXXXXXXXXVHSHMTNTRITDPEILESRYPVILRRF
OPLA_BOVIN      -AASQGCMNNVTLGNAHMG----YYETVXXXXXXXXXXXXXXXVHSHMTNTRITDPEILESRYPVILXXX
YAOF_SCHPO      CAASQGDTNNLTFG--IGGKGFGYYETICGGSGAIDGLDGTSGVHTHMTNTRITDLEVLERRYPVILRKF
OPLA_DICDI      -ANSQGCMNNLTFGDETLG----YYETIAGGTGAGPNFNGFTAVQSHMTNTRITDVEIMEKRYPVIVKEF
YAOE_SCHPO      CAASQGCMNNLTFG--YDGENFAMYETIAGGAGAGPTWNGTSGVHTHMTNTRITDPEVVERRAPVILRRF
HYUB_PSESN      -SAGVGNLQVVAFSGQSNENYWVYMDIMEGSYGGRYGKDGMDAVDTLYANTRNNPIEDIESHYPLRVNRY


                         .         .         +         .         .         .         .:490
query           RIXXXXXXXXXXXXXXXIVRAFKVLAPTRLAILADRFKIGPWGIQGGEAGKPGRAYVKKAGGRTIQLDSK
Y963_METJA      SLREDSGGAGKYRGGLGIRRVYKMLSDCMLSIIADRIKISPWGVNNGYSGACGEHYVIK-DGKKIPLSGK
OPLA_HUMAN      XXXXXXXXXXXXXXXXXVTRELLFREEALLSVLTERRAFRPYGLHGGEPGARGLNLLIRKNGRTVNLGGK
OPLA_ARATH      GLRENSXXXXXXXXXXXLVREIEFRKPVVVSILSERRVHSPXXXXXXXXXXXXANYLITKDKRRIYLGGK
YKV5_YEAST      SIRRXXXXXXXXXXXXXVVRDVQFRKAVTASILSERRVIGPHGIKGGQDGSRGNLWVRHSTGALINVGGK
OPLA_RAT        ELXXXXXXXXXXXXXXXXXXELVFREEALLSVLTERRAFQPYGLHGGEPGARGLNLLIRKDGRTVNLGGK
OPLA_MOUSE      ELXXXXXXXXXXXXXXXXXXELVFREEALLSVLTERRAFQPYGLHGGEPGTRGLNLLIRKDGRTVNLGGK
OPLA_BOVIN      XXXXXXXXXXXXXXXXXXXXXLLFREEALLSVLTERRAFQPYGLMGGEPGARGLNLLIRKDGRTVNLGGK
YAOF_SCHPO      IIRENSXXXXXXXXXXXVIRDIEFRIPVTLSILSERRAYHPYGMKGGKDAECGKIWIRKQRVRQINVGGK
OPLA_DICDI      SVRYXXXXXXXXXXXXXVVREIQFLKNFTVSILSERRSLQPRGLMGGENAERGLNLVLKNNGKYINIGSK
YAOE_SCHPO      CLRENSGGKGEYHGGDGVIRHFEFRRSMHCSILSERRSRAPYGMNGGEDGAMGNTWIDCSNPRYVNLGGK
HYUB_PSESN      ELRDNDSAPGKWRGGIGSIREVSFLADGSFSVEADGHKYAPWGFDDGQDGYVGSLSIRNETNELVQLPSK


                         *         .         .         .         .         +         .:560
query           TITDLEPGDEVVIETPGGGGWGPHxx
Y963_METJA      DTLYLSCGDIVEINTPGGGGYG----
OPLA_HUMAN      TSVTVYPGDVFCLHT-----------
OPLA_ARATH      NTVHVEAGEILQILTPGGGGFG----
YKV5_YEAST      NTIYAQPGDRFIIKTPGGGGFGQY--
OPLA_RAT        TSVTVYPGDVFCLHT-----------
OPLA_MOUSE      TSVTVYPGDAFCLHT-----------
OPLA_BOVIN      TSVPVYPGDVFCLHT-----------
YAOF_SCHPO      NTCHMQAGDHIVIMTPGGGGYGP---
OPLA_DICDI      --------------------------
YAOE_SCHPO      NHVLMGKGDHIVIETPGGGGYG----
HYUB_PSESN      LPNHAQSGSTIQLVGPCGGGYG----