[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL64120.1

[Show Plain Result]


## Summary of Sequence Search
    1::274
   15::197     1e-34  47%  198 aa  Y1384_METJA RecName: Full=Putative nitroreductase MJ1384;       
   56::151     5e-13  40%  172 aa  Y226_ARCFU RecName: Full=Putative NADH dehydrogenase/NAD(P)H
  140::356     5e-08  23%  356 aa  TFXC_RHILT RecName: Full=Trifolitoxin operon protein tfxC;
    6::166     4e-07  31%  249 aa  NFRA_BACSU RecName: Full=Nitro/flavin reductase;       
  221::333     8e-07  32%  373 aa  TFXB_RHILT RecName: Full=Trifolitoxin-processing protein tfxB;
    5::166     1e-06  34%  251 aa  NFRA_STAES RecName: Full=NADPH-dependent oxidoreductase;       
    5::166     1e-06  34%  251 aa  NFRA_STAEQ RecName: Full=NADPH-dependent oxidoreductase;       
    5::166     6e-06  32%  251 aa  NFRA_STAHJ RecName: Full=NADPH-dependent oxidoreductase;       
  112::166     4e-05  40%  251 aa  NFRA_STAAR RecName: Full=NADPH-dependent oxidoreductase;       
   57::160     7e-05  33%  240 aa  FRP_VIBHA RecName: Full=NADPH-flavin oxidoreductase;       
  112::166     9e-05  38%  251 aa  NRFA_STAA8 RecName: Full=NADPH-dependent oxidoreductase;       
  112::166     9e-05  38%  251 aa  NFRA_STAAW RecName: Full=NADPH-dependent oxidoreductase;       
  112::166     9e-05  38%  251 aa  NFRA_STAAS RecName: Full=NADPH-dependent oxidoreductase;       
  112::166     9e-05  38%  251 aa  NFRA_STAAN RecName: Full=NADPH-dependent oxidoreductase;       
  112::166     9e-05  38%  251 aa  NFRA_STAAM RecName: Full=NADPH-dependent oxidoreductase;       
  112::166     9e-05  38%  251 aa  NFRA_STAAC RecName: Full=NADPH-dependent oxidoreductase;       
  112::166     9e-05  38%  251 aa  NFRA_STAAB RecName: Full=NADPH-dependent oxidoreductase;       
  112::166     9e-05  38%  251 aa  NFRA_STAA3 RecName: Full=NADPH-dependent oxidoreductase;       
   95::249     5e-04  24%  272 aa  MCBC_ECOLX RecName: Full=Microcin B17-processing protein mcbC;
    1::274

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRKRTGADVEKVLLPYPRLRGVVSVEEALA
Y1384_METJA     --------------------------------------------------------------IKLEDVLI
Y226_ARCFU      ----------------------------------------------------------------------
TFXC_RHILT      -----------------------------------------KRRKRGTATRLVKPSRELAAAV-ILDGLM
NFRA_BACSU      ------------------------------------------------------------------ETIL
TFXB_RHILT      ----------------------------------------------------------------------
NFRA_STAES      ----------------------------------------------------------------VYELMK
NFRA_STAEQ      ----------------------------------------------------------------VYELMK
NFRA_STAHJ      ----------------------------------------------------------------VYDLMK
NFRA_STAAR      ----------------------------------------------------------------------
FRP_VIBHA       ----------------------------------------------------------------------
NRFA_STAA8      ----------------------------------------------------------------------
NFRA_STAAW      ----------------------------------------------------------------------
NFRA_STAAS      ----------------------------------------------------------------------
NFRA_STAAN      ----------------------------------------------------------------------
NFRA_STAAM      ----------------------------------------------------------------------
NFRA_STAAC      ----------------------------------------------------------------------
NFRA_STAAB      ----------------------------------------------------------------------
NFRA_STAA3      ----------------------------------------------------------------------
MCBC_ECOLX      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NRRSVREFREEPLTLEELGQILWAAYGISETRYGLRTAPSAGAQYPLEVYVVVGEHGVKTGDGYLKPGVY
Y1384_METJA     KRRSVREYCSSPLTLRELSHILFAAYGVTDER-GFKTVPSAGATYPLEIYVVVG----------VEEGVY
Y226_ARCFU      ----------------------------------------------------------------------
TFXC_RHILT      NRRSFKPFTRKQLSITEVSEILW--FGNLYARERAVIAENRDFESPRDIAFVVTYGQIDWQDGSLPPGVY
NFRA_BACSU      NHRSIRSFTDQLLTAEEIDTLVKSAQAASTSSY-VQAYSIIGVSDPRELSVLAGNQPYVEKNGHFF--VF
TFXB_RHILT      -----------------------------------KAVPSGGARHPIEFYVVVGDE-----IAGIEAGVY
NFRA_STAES      QHHSVRKFKNQPLGSETVEKLVEAGQSASTSSY-LQTYSIIGVEDPARLKEVSGQPYV-LDNGYLF--VF
NFRA_STAEQ      QHHSVRKFKNQPLGSETVEKLVEAGQSASTSSY-LQTYSIIGVEDPARLKEVSGQPYV-LDNGYLF--VF
NFRA_STAHJ      KHHSVRQFKDKALSDETVQKLVEAGQSASTSSY-LQTYSIIGVDDPKQLKEVSGQPYV-VDNGYLF--VF
NFRA_STAAR      ----------------------------------------------------------------------
FRP_VIBHA       ----------------------------------------------------------------------
NRFA_STAA8      ----------------------------------------------------------------------
NFRA_STAAW      ----------------------------------------------------------------------
NFRA_STAAS      ----------------------------------------------------------------------
NFRA_STAAN      ----------------------------------------------------------------------
NFRA_STAAM      ----------------------------------------------------------------------
NFRA_STAAC      ----------------------------------------------------------------------
NFRA_STAAB      ----------------------------------------------------------------------
NFRA_STAA3      ----------------------------------------------------------------------
MCBC_ECOLX      ------------LSIRTIEKLLVNAFSSPDPGSVRRPYPSGGALYPIEVFLC--RLSENTENWQAGTNVY


                         +         .         .         .         .         *         .:210
query           HYDPHSHTLTLKKTGDFREALYQAALEQIWVLKAPVSLIFTAVYSRTXXXXXXXXXXXXXPMDLGHAGQN
Y1384_METJA     KYIPERHSIVRILDEEVGHELALAALKQMFXXXXXXXXXXXXNYERTTRVYGDRGFRYVH-MEVGHVAQN
Y226_ARCFU      -----------------KKRLAMAALKQMFIAEAPVVIVVCANYPRSMRVYGERGRLYAE-QDATAAIEN
TFXC_RHILT      RYNVVNHELEAIRAGDFKLDMAKLAIGQSRASSGLFTFVICGDLKSYTSRYRHERSYRNLLINTSQLAQF
NFRA_BACSU      CADLYRHQQLAEEKGEHISEL----LENTEMFM--VSLIDAAL-----------------------AAQN
TFXB_RHILT      HYNVRHHRLAIEIASTSLKALQEASSVLPRSRSKPFGFAFTCRFERSMFRYREPRSYRVMQFDLGHIHAN
NFRA_STAES      VLDYYRHHLVDEVAASNMETSYGSA-EGLLVGTIDVALV----------------------------AQN
NFRA_STAEQ      VLDYYRHHLVDEVAASNMETSYGSA-EGLLVGTIDVALV----------------------------AQN
NFRA_STAHJ      VLDYYRHNL-INENVDFDMQTSFESAEGLLVGAIDVALV----------------------------SEN
NFRA_STAAR      -------------------------------------------------------------IDAALVAEN
FRP_VIBHA       -----------------RNELAQFAGNQAYVESAAEFLVFCIDYQRPDVQADFTELTLIGAVDSGIMAQN
NRFA_STAA8      -------------------------------------------------------------IDAALVAEN
NFRA_STAAW      -------------------------------------------------------------IDAALVAEN
NFRA_STAAS      -------------------------------------------------------------IDAALVAEN
NFRA_STAAN      -------------------------------------------------------------IDAALVAEN
NFRA_STAAM      -------------------------------------------------------------IDAALVAEN
NFRA_STAAC      -------------------------------------------------------------IDAALVAEN
NFRA_STAAB      -------------------------------------------------------------IDAALVAEN
NFRA_STAA3      -------------------------------------------------------------IDAALVAEN
MCBC_ECOLX      HYLPLSQALEPVATCN-TQSLYRSLSDSERLGKPHFALVYCIIFEKALFKYRYRGYRMAL-METGSMYQN


                         .         .         .         +         .         .         .:280
query           VYLQATALGLGTVAVGAFYDDQVAEILDLPDGETPLYIMPIGRPIxxxxxxxxxxxxxxxxxxx
Y1384_METJA     VYLMATSLGLGTVSVGAFYDNEIREILKIK--EYPLLLMPVGRKI-------------------
Y226_ARCFU      ILLAVTALNLGAVWVGAFDEEQVSEILELPEYVRPMAIIPIGHP--------------------
TFXC_RHILT      YLTLATINDFNTFLTPAIHDEKMHLFLEAED-DLPLYLVTAG----------------------
NFRA_BACSU      MSIAAESMGLGICYIGGIRNDKVTEVLQTPDHVLPLFGLAVGHP--------------------
TFXB_RHILT      EVLAAKILGL------------------------------------------------------
NFRA_STAES      MAVAAEDMGYGIVYLGSLRNDRVREILNLPDYTFPLFGMAVGEP--------------------
NFRA_STAEQ      MAVAAEDMGYGIVYLGSLRNDRVREILNLPDYTFPLFGMAVGEP--------------------
NFRA_STAHJ      VALAAEDMGYGIVYLGSLRNDRVKEILDLPEYAFPLFGMAVGEP--------------------
NFRA_STAAR      IAVTAEDMGYGIVFLGSLRNDRVREILDLPDYVFPLFGMAVGEP--------------------
FRP_VIBHA       CLLAAESMGLGGVYIGGLRNSQVDELLGLPENSAVLFGMCLGHP--------------------
NRFA_STAA8      IAVTAEDMGYGIVFLGSLRNDRVREILDLPDYVFPVFGMAVGEP--------------------
NFRA_STAAW      IAVTAEDMGYGIVFLGSLRNDRVREILDLPDYVFPVFGMAVGEP--------------------
NFRA_STAAS      IAVTAEDMGYGIVFLGSLRNDRVREILDLPDYVFPVFGMAVGEP--------------------
NFRA_STAAN      IAVTAEDMGYGIVFLGSLRNDRVREILDLPDYVFPVFGMAVGEP--------------------
NFRA_STAAM      IAVTAEDMGYGIVFLGSLRNDRVREILDLPDYVFPVFGMAVGEP--------------------
NFRA_STAAC      IAVTAEDMGYGIVFLGSLRNDRVREILDLPDYVFPVFGMAVGEP--------------------
NFRA_STAAB      IAVTAEDMGYGIVFLGSLRNDRVREILDLPDYVFPVFGMAVGEP--------------------
NFRA_STAA3      IAVTAEDMGYGIVFLGSLRNDRVREILDLPDYVFPVFGMAVGEP--------------------
MCBC_ECOLX      AVLVADQIGLKNRVWAGYTDSYVAKTMNL-----------------------------------