[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL64389.1

[Show Plain Result]


## Summary of Sequence Search
    1::667
   10::684     2e-76  32%  689 aa  YYAL_BACSU RecName: Full=Uncharacterized protein yyaL;
   21::729     4e-59  27%  729 aa  YP65_CAEEL RecName: Full=Uncharacterized protein B0495.5;
   68::789     9e-57  29%  789 aa  SPT20_RAT RecName: Full=Spermatogenesis-associated protein
   65::784     2e-56  30%  786 aa  SPT20_HUMAN RecName: Full=Spermatogenesis-associated protein
   69::790     3e-56  29%  790 aa  SPT20_MOUSE RecName: Full=Spermatogenesis-associated protein
   10::58      6e-08  46%   79 aa  YYAO_BACSU RecName: Full=Uncharacterized protein yyaO;
  477::506     6e-04  40%  567 aa  DSBD_CAMJR RecName: Full=Thiol:disulfide interchange protein dsbD; 
  477::506     6e-04  40%  567 aa  DSBD_CAMJE RecName: Full=Thiol:disulfide interchange protein dsbD; 
    1::667

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxLSSSSSPFVLEGLKSRVKWWGWCKEAFEAAEREDKPVLVDVGAVWCHWCHVMDERTYNDEEVA
YYAL_BACSU      -------LINEKSPYLLQHAHNPVDWFPWGEEAFEKAKRENKPVLVSIGYSTCHWCHVMAHESFEDEEIA
YP65_CAEEL      -------LGQEKSPYLLQHANNPIDWYPWGQEAFQKAKDNNKPIFLSVGYSTCHWCHVMEKESFENEATA
SPT20_RAT       -------LINEKSPYLLQHAHNPVDWYPWGQEAFDKAKKENKPIFLSVGYSTCHWCHMMEEESFQNEEIG
SPT20_HUMAN     -------LIHEKSPYLLQHAYNPVDWYPWGQEAFDKARKENKPIFLSVGYSTCHWCHMMEEESFQNEEIG
SPT20_MOUSE     -------LINEKSPYLLQHAYNPVDWYPWGQEAFDKAKKENKPIFLSVGYSTCHWCHMMEEESFQNEEIG
YYAO_BACSU      -------LIAEKSPYLLQHAHNPVDWFPWGEEAFAKAKRENKPVLVSIGSTTCHW---------------
DSBD_CAMJR      -----------------------------------------KPIMLDFTASWCENCKLLDELTFSDERII
DSBD_CAMJE      -----------------------------------------KPIMLDFTASWCENCKLLDELTFSDERII


                         .         .         *         .         .         .         .:140
query           EFINKHFIPXXXXXXXXXXXXXXLQEAAQLISGQSGWPLTVFMTPKGQVIWAATYLPPRREMGLPGMLEV
YYAL_BACSU      RLLNERFVAIKVDREERPDVDSVYMRICQLMTGQGGWPLNVFITPDQKPFYAGTYFPKTSKFNRPGFVDV
YP65_CAEEL      KILNDNFVAIKVDREERPDVDKLYMAFVVASSGHGGWPMSVFLTPDLHPITGGTYFPPDDNRGMLGFPTI
SPT20_RAT       HLLNENFVSVMVDREERPDVDKVYMTFVQATSSGGGWPMNVWLTPSLQPFVGGTYFPPEDGLTRVGFRTV
SPT20_HUMAN     RLLSEDFVSVKVDREERPDVDKVYMTFVQATSSGGGWPMNVWLTPNLQPFVGGTYFPPEDGLTRVGFRTV
SPT20_MOUSE     RLLNENFICVMVDREERPDVDKVYMTFVQATSSGGGWPMNVWLTPGLQPFVGGTYFPPEDGLTRVGFRTV
YYAO_BACSU      ----------------------------------------------------------------------
DSBD_CAMJR      Q---------------------------------------------------------------------
DSBD_CAMJE      Q---------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LEAVLRAYREKRGEVEKFHEDLARELKKWHSPSPGEPRREGQAEVLAALAASFDEEYGGFGGAPKFPPIT
YYAL_BACSU      LEHLSETFANDREHVEDIAENAAKHLQTKTAAKTGEGLSESAIHTFQQLASGFDTIYGGFGQAPKFPMPH
YP65_CAEEL      LNMIHTEWKKEGESLKQRGAQIIKLLQPETASGDVNRSEEVFKSIYSHKQSSFDSRLGGFGRAPKFPKAC
SPT20_RAT       LMRICDQWKQNKNTLLENSQRVTTALLARSEISVGDRQLPPSAATMNSLDEGYDEEYGGFAEAPKFPTPV
SPT20_HUMAN     LLRIREQWKQNKNTLLENSQRVTTALLARSEISVGDRQLPPSAATVQQLDEGYDEEYGGFAEAPKFPTPV
SPT20_MOUSE     LMRICDQWKLNKNTLLENSQRVTTALLARSEISVGDRQIPASAATMNSLDEGYDEEYGGFAEAPKFPTPV
YYAO_BACSU      ----------------------------------------------------------------------
DSBD_CAMJR      ----------------------------------------------------------------------
DSBD_CAMJE      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           QLELLMMRHFYDGVGIYGKMAERTLDAMALGGVYDQLLGGFFRYSTDRSWLIPHYEKLLIDNAELLAVYT
YYAL_BACSU      MLMYLLRYDHNTGQENALYNVTKTLDSMANGGIYDHIGYGFARYSTDDEWLVPHFEKMLYDNALLLTAYT
YP65_CAEEL      DLDFLITFAASENESEKAKMLQKTLESMADGGIHDHIGNGFHRYSVGSEWHIPHFEKMLYDQSQLLATYS
SPT20_RAT       ILNFLFSYWLSHRVTQDGQMALHTLKMMANGGIRDHVGQGFHRYSTDRQWHIPHFEKMLYDQAQLSVVYC
SPT20_HUMAN     ILSFLFSRLTQDGSRAQ-QMALHTLKMMANGGIRDHVGQGFHRYSTDRQWHVPHFEKMLYDQAQLAVAYS
SPT20_MOUSE     ILNFLFSRLTQDGSRAQ-QMALHTLKMMANGGIQDHVGQGFHRYSTDRQWHIPHFEKMLYDQAQLSVVYT
YYAO_BACSU      ----------------------------------------------------------------------
DSBD_CAMJR      ----------------------------------------------------------------------
DSBD_CAMJE      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KAYRQFGKALYKRTAEGIVKWLDEFMRAPEGGYYASQDADVDGEEGGYYRWSXXXXXXXXXXXYPVASKH
YYAL_BACSU      EAYQVTQNSRYKEICEQIITFIQREMTHEDGSFFSALDADTEGEEGKYYVWSGDDLGTLYCQVYDITEEH
YP65_CAEEL      DFHKLTERKNVKHVINDIYQYMQKISH-KDGGFYAAEDADSNKVEGAFCAWELGDKKIGSASLFDVVADY
SPT20_RAT       QAFQISGDEFFSDVAKGILQYVTRNLSHRSGGFYSAEDADVKPQEGALYLWTVKEVQQLLPEPVGGASKH
SPT20_HUMAN     QAFQLSGDEFYSDVAKGILQYVARSLSHRSGGFYSAEDADSPPEEGAYYVWTVKEVQQLLPEPVPLTSKH
SPT20_MOUSE     QAFQISGDEFYADVAKGILQYVTRTLSHRSGGFYSAEDADMKPQEGAYYVWTVKEVQQLLPEPVVGASKH
YYAO_BACSU      ----------------------------------------------------------------------
DSBD_CAMJR      ----------------------------------------------------------------------
DSBD_CAMJE      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           FGLEEYPWPEGKATLRVARPLEGPEAERIYQILIEARRKRKPPFTDTTVYVGWSCAMAYAELLASRLASV
YYAL_BACSU      TKREQIKEDAGLTEKELSLKLEDAR-----QQLLKTREERTYPHVDDKVLTSWN-ALMIAGLAKAAKVYQ
YP65_CAEEL      FDVEDSPHGELKNKNVLRKLLTDEECDEAKEILWNARTQRPSPHLDSKMVTSWQ-GLAITGLVKAYQATE
SPT20_RAT       YGLSENPTQDGQNVLTVRDSLEGLEVEAVRALLFQARKHRPKAHLDNKMLAAWNGLMVSGFAVAGSVLGV
SPT20_HUMAN     YGLTEAPKGEGQNVLTVRYSLEGLDVEAVRTLLFQARKHRPKPHLDSKMLAAWNYAVTGAVLGQDRLINY
SPT20_MOUSE     YGLSEVPNGEGQNVLMVRYSLEGLEVEAVRALLFQARKHRPKAHLDNKMLAAWNAALGMEKLVAQATSGA
YYAO_BACSU      ----------------------------------------------------------------------
DSBD_CAMJR      ----------------------------------------------------------------------
DSBD_CAMJE      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GNKYHAVRTLERFGVEXXXXXXXXXXXXXXXXXXIAALEDYAYCILAWIEGYSHTAKLEFLKVAESAGEI
YYAL_BACSU      EPKYDAITFIEN---KLIIDGRVMVRYRDGEVKNKGFIDDYAFLLWAYLDLYEASFDLSYLQKAKKLTDD
YP65_CAEEL      ETKYRAEKCAEFIGLRRSVYLGANGEVEQGNQEIRAFSDDYAFLIQALLDLYTTVGKDEYLKKAVELQKI
SPT20_RAT       TQATNGAKFLKRHRLKRTCYAGAGGTVEQSNPPCWGFLEDYAFVVRGLLDLYEASQESSWLEWALRLQDI
SPT20_HUMAN     ATNGAKFLKRHMFDVASGRLMRTCYTGPGGTVEHSGFLEDYAFVVRGLLDLYQESAWLEWALRLQDTQDR
SPT20_MOUSE     KFLKRHMFDVSSGRLKRTCYAGTGGTVEQSNPPCWGFLEDYAFVVRGLLDLYEASQESSWLEWALRLQDT
YYAO_BACSU      ----------------------------------------------------------------------
DSBD_CAMJR      ----------------------------------------------------------------------
DSBD_CAMJE      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           LLAKFLEEGGFKDVETVDEIIPTPNYPALDTPNFSGNAVAAIALATLSEVTGDAKYKEAAYRAVSALYGK
YYAL_BACSU      MISLFWDEGGFYFTGHDAEALIVREKEVYDGAVPSGNSVAAVQLLRLGQVTGDLSLIEKAETMFSVFKPD
YP65_CAEEL      CDVKFWNGNGYFISEKTDEDVSVRMIEDQDGAEPTATSIASNNLLRLYDILEKEEYREKANQCFRGASER
SPT20_RAT       QDKLFWDSHGFCSEAELGTDLPLRLKDDQDGAEPSANSVSAHNLLRLHGLTGHKDWMDKCVCLLTAFSER
SPT20_HUMAN     LFWDSQGGGYFCSEAELGAGLPLRLKDDQDGAEPSANSVSAHNLLRLHGFTGHKDWMDKCVCLLTAFSER
SPT20_MOUSE     QDKLFWDPRGFCSEAELGADLPLRLKDDQDGAEPSANSVSAHNLLRLHSFTGHKDWMDKCVCLLTAFSER
YYAO_BACSU      ----------------------------------------------------------------------
DSBD_CAMJR      ----------------------------------------------------------------------
DSBD_CAMJE      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           MERVGPAASGLWIALDLLTLGVPRTVIVGESPELITAALRAYRPWHVVVPITGNWPYKDPAVRAMLNGPK
YYAL_BACSU      IEAY-PSGHAFFMQSVLRHLMPKKEIVIFGSKQIIAELQKAFKPNDSILVAEQPEQCKDIAPFAIIDG-K
YP65_CAEEL      LNTVPIALPKMAVALHRWQIGSTTFVLVGDPKSELLSETRSRLNQKVHIQSEEDLSASGPSHKAMAEGPK
SPT20_RAT       MRRVPVALPEMVRALSAQQQTLKQIVICGDPQAKDTKALSIYIPNKVLILADG-----DPSSFLSRQLPR
SPT20_HUMAN     MRRVPVALPEMVRALSAQQQTLKQIVICGDRQAKDTKALSVYIPNKVLILADG-----DPSSFLSRQLPQ
SPT20_MOUSE     MRRVPVALPEMVRTLSAQQQTLKQIVICGDPQAKDTKALSIYVPNKVLILADGDLPFLSSLRRV---EDR
YYAO_BACSU      ----------------------------------------------------------------------
DSBD_CAMJR      ----------------------------------------------------------------------
DSBD_CAMJE      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           PAAYICAGGACSLPVREPERLEKTIEEFxxxxxxxxx
YYAL_BACSU      TTVYICENFACQQPTTNIEEAIHTL------------
YP65_CAEEL      PAVYMCKGFVCDRPVKAIQELEELFNKF---------
SPT20_RAT       ATVYIFENQACSMPITDPCELRKLLHQ----------
SPT20_HUMAN     ATAYVCENQACSVPITDPCELRKLL------------
SPT20_MOUSE     ATVYIFENQACSMPITDPCELRKLLHQ----------
YYAO_BACSU      -------------------------------------
DSBD_CAMJR      -------------------------------------
DSBD_CAMJE      -------------------------------------