[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL64489.1

[Show Plain Result]


## Summary of Sequence Search
    1::816
   61::712     3e-52  30%  758 aa  PHSA_SALTY RecName: Full=Thiosulfate reductase;       
   96::757     2e-44  31%  808 aa  YNFE_ECOLI RecName: Full=Putative dimethyl sulfoxide reductase
   99::756     1e-42  32%  807 aa  YNFF_ECOLI RecName: Full=Probable dimethyl sulfoxide reductase
   95::758     7e-42  33%  806 aa  DMSA_HAEIN RecName: Full=Anaerobic dimethyl sulfoxide reductase
   64::731     1e-41  33%  763 aa  PSRA_WOLSU RecName: Full=Polysulfide reductase chain A;AltName:
  104::766     5e-40  31%  814 aa  DMSA_ECOLI RecName: Full=Anaerobic dimethyl sulfoxide reductase
  124::646     1e-32  30%  910 aa  DDHA_RHOSU RecName: Full=Dimethylsulfide dehydrogenase subunit
   86::847     2e-30  30%  918 aa  SERA_THASE RecName: Full=Selenate reductase subunit alpha;       
   82::463     3e-27  32%  914 aa  CLRA_IDEDE RecName: Full=Chlorate reductase subunit alpha;       
   27::637     9e-24  29%  680 aa  YOAE_BACSU RecName: Full=Probable oxidoreductase yoaE;       
   58::537     1e-21  30%  755 aa  NAPA_DESDA RecName: Full=Periplasmic nitrate reductase;       
   97::690     2e-21  29%  754 aa  NAPA_SYMTH RecName: Full=Nitrate reductase;       
  273::499     1e-16  31%  984 aa  FDHL_STAAB RecName: Full=Putative formate dehydrogenase SAB2186c;  
  273::501     2e-16  31%  984 aa  FDHL_STAAW RecName: Full=Putative formate dehydrogenase MW2229;    
  273::501     2e-16  31%  984 aa  FDHL_STAAS RecName: Full=Putative formate dehydrogenase SAS2201;   
  273::501     2e-16  31%  984 aa  FDHL_STAAN RecName: Full=Putative formate dehydrogenase SA2102;    
  273::501     2e-16  31%  984 aa  FDHL_STAAM RecName: Full=Putative formate dehydrogenase SAV2309;   
  101::753     5e-16  28%  823 aa  TORA_PASMU RecName: Full=Trimethylamine-N-oxide reductase;       
  273::499     5e-16  31%  984 aa  FDHL_STAAR RecName: Full=Putative formate dehydrogenase SAR2393;   
   24::240     5e-16  30%  673 aa  FDHA_METJA RecName: Full=Formate dehydrogenase subunit alpha;      
   81::395     7e-16  24% 1016 aa  FDOG_ECOLI RecName: Full=Formate dehydrogenase-O major subunit;    
  273::501     9e-16  31%  984 aa  FDHL_STAAC RecName: Full=Putative formate dehydrogenase SACOL2301; 
  273::501     9e-16  31%  984 aa  FDHL_STAA8 RecName: Full=Putative formate dehydrogenase
  273::501     9e-16  31%  984 aa  FDHL_STAA3 RecName: Full=Putative formate dehydrogenase
   98::729     2e-15  27%  820 aa  TORA_VIBPA RecName: Full=Trimethylamine-N-oxide reductase;       
   98::764     3e-15  27%  829 aa  NAPA_VIBHB RecName: Full=Periplasmic nitrate reductase;       
   33::241     3e-15  32%  684 aa  FDHA_METFO RecName: Full=Formate dehydrogenase subunit alpha;      
  273::577     4e-15  31%  984 aa  FDHL_STAS1 RecName: Full=Putative formate dehydrogenase SSP0601;   
   98::794     6e-15  26%  831 aa  NAPA_SACD2 RecName: Full=Periplasmic nitrate reductase;       
   61::688     8e-15  27%  715 aa  FDHF_ECOLI RecName: Full=Formate dehydrogenase H;       
   67::710     8e-15  26%  777 aa  BISC_ECOLI RecName: Full=Biotin sulfoxide reductase;       
   98::793     3e-14  24%  831 aa  NAPA_PSYIN RecName: Full=Periplasmic nitrate reductase;       
   81::397     3e-14  25% 1015 aa  FDNG_ECOLI RecName: Full=Formate dehydrogenase, nitrate-inducible,
   89::400     4e-14  24% 1028 aa  FDXG_HAEIN RecName: Full=Formate dehydrogenase major subunit;      
   98::729     1e-13  26%  820 aa  TORA_VIBVY RecName: Full=Trimethylamine-N-oxide reductase;       
   98::729     1e-13  26%  820 aa  TORA_VIBVU RecName: Full=Trimethylamine-N-oxide reductase;       
  100::804     1e-13  25%  834 aa  NAPA_RHIME RecName: Full=Periplasmic nitrate reductase;       
   98::680     1e-13  24%  831 aa  NAPA_BORPA RecName: Full=Periplasmic nitrate reductase;       
   96::678     1e-13  24%  829 aa  NAPA_BORBR RecName: Full=Periplasmic nitrate reductase;       
  112::338     2e-13  28%  848 aa  TORA_ECOLI RecName: Full=Trimethylamine-N-oxide reductase 1;       
  112::338     3e-13  28%  848 aa  TORA_ECO57 RecName: Full=Trimethylamine-N-oxide reductase 1;       
   98::677     3e-13  25%  829 aa  NAPA_VIBPA RecName: Full=Periplasmic nitrate reductase;       
   50::672     4e-13  26%  744 aa  BISC_RHOSH RecName: Full=Biotin sulfoxide reductase;       
  112::338     5e-13  28%  848 aa  TORA_ECOL6 RecName: Full=Trimethylamine-N-oxide reductase 1;       
   98::767     5e-13  24%  829 aa  NAPA_VIBSL RecName: Full=Periplasmic nitrate reductase;       
   98::795     7e-13  25%  828 aa  NAPA1_PHOPR RecName: Full=Periplasmic nitrate reductase 1;       
   98::764     9e-13  24%  829 aa  NAPA_VIBFM RecName: Full=Periplasmic nitrate reductase;       
   98::764     9e-13  24%  829 aa  NAPA_VIBF1 RecName: Full=Periplasmic nitrate reductase;       
   97::629     9e-13  25%  838 aa  NAPA_METS4 RecName: Full=Periplasmic nitrate reductase;       
  329::754     3e-12  25%  825 aa  TORZ_HAEIN RecName: Full=Trimethylamine-N-oxide reductase;       
   98::795     3e-12  26%  832 aa  NAPA_COLP3 RecName: Full=Periplasmic nitrate reductase;       
  273::501     3e-12  29%  984 aa  FDHL_STAHJ RecName: Full=Putative formate dehydrogenase SH0748;    
  116::802     5e-12  24%  831 aa  NAPA_DINSH RecName: Full=Periplasmic nitrate reductase;       
   98::798     6e-12  25%  834 aa  NAPA_PSEU5 RecName: Full=Periplasmic nitrate reductase;       
   98::798     6e-12  25%  834 aa  NAPA_PSEST RecName: Full=Periplasmic nitrate reductase;       
   93::793     6e-12  23%  829 aa  NAPA_PSEAE RecName: Full=Periplasmic nitrate reductase;       
   98::792     6e-12  24%  829 aa  NAPA_AERHH RecName: Full=Periplasmic nitrate reductase;       
   78::386     6e-12  26% 1012 aa  FDHA_DESGI RecName: Full=Formate dehydrogenase subunit alpha;      
   98::798     8e-12  23%  834 aa  NAPA_PSEAB RecName: Full=Periplasmic nitrate reductase;       
   98::677     1e-11  23%  829 aa  NAPA_VIBVU RecName: Full=Periplasmic nitrate reductase;       
   94::790     1e-11  23%  827 aa  NAPA_BURXL RecName: Full=Periplasmic nitrate reductase;       
   35::531     2e-11  29%  667 aa  YYAE_BACSU RecName: Full=Probable oxidoreductase yyaE;       
   98::677     2e-11  23%  829 aa  NAPA_VIBVY RecName: Full=Periplasmic nitrate reductase;       
   98::798     2e-11  23%  834 aa  NAPA_PSEA8 RecName: Full=Periplasmic nitrate reductase;       
   93::790     2e-11  26%  827 aa  NAPA_MAGSA RecName: Full=Periplasmic nitrate reductase;       
   99::795     2e-11  24%  833 aa  NAPA_AGRT5 RecName: Full=Periplasmic nitrate reductase;       
   98::630     4e-11  25%  834 aa  NAPA_PSEMY RecName: Full=Periplasmic nitrate reductase;       
  316::507     4e-11  29%  980 aa  FDHL_BACSU RecName: Full=Putative formate dehydrogenase yrhE;      
   59::291     7e-11  27%  710 aa  NASC_BACSU RecName: Full=Assimilatory nitrate reductase catalytic
   98::798     7e-11  23%  834 aa  NAPA_PSEA7 RecName: Full=Periplasmic nitrate reductase;       
  104::808     7e-11  26%  834 aa  NAPA_BRASB RecName: Full=Periplasmic nitrate reductase;       
   53::230     9e-11  32%  866 aa  NASA_KLEOX RecName: Full=Nitrate reductase;         EC=1.7.99.4;
   98::630     9e-11  26%  831 aa  NAPA_RALEJ RecName: Full=Periplasmic nitrate reductase;       
  110::804     9e-11  23%  827 aa  NAPA_HAES2 RecName: Full=Periplasmic nitrate reductase;       
   95::805     1e-10  24%  828 aa  NAPA_PASMU RecName: Full=Periplasmic nitrate reductase;       
   98::794     1e-10  26%  831 aa  NAPA_PARPN RecName: Full=Periplasmic nitrate reductase;       
  110::804     1e-10  24%  827 aa  NAPA_HAES1 RecName: Full=Periplasmic nitrate reductase;       
   98::789     1e-10  26%  830 aa  NAPA2_PHOPR RecName: Full=Periplasmic nitrate reductase 2;       
   93::790     2e-10  26%  827 aa  NAPA_MAGMG RecName: Full=Periplasmic nitrate reductase;       
  101::808     2e-10  26%  834 aa  NAPA_BRASO RecName: Full=Periplasmic nitrate reductase;       
  129::368     3e-10  29% 1228 aa  NARG_BACSU RecName: Full=Nitrate reductase alpha chain;       
   84::272     4e-10  24%  729 aa  NARB_SYNE7 RecName: Full=Nitrate reductase;         EC=1.7.99.4;
   98::630     4e-10  25%  831 aa  NAPA_CUPTR RecName: Full=Periplasmic nitrate reductase;       
  326::729     6e-10  24%  829 aa  TORA_SHEMA RecName: Full=Trimethylamine-N-oxide reductase;       
   94::804     6e-10  25%  828 aa  NAPA_ACTAC RecName: Full=Periplasmic nitrate reductase;       
   98::304     1e-09  26%  820 aa  TORA_VIBCH RecName: Full=Trimethylamine-N-oxide reductase;       
  326::751     1e-09  24%  829 aa  TORA_SHEON RecName: Full=Trimethylamine-N-oxide reductase;       
   98::792     1e-09  23%  829 aa  NAPA_AERS4 RecName: Full=Periplasmic nitrate reductase;       
   95::789     2e-09  24%  826 aa  NAPA_SHEON RecName: Full=Periplasmic nitrate reductase;       
  103::810     3e-09  25%  839 aa  NAPA_LARHH RecName: Full=Periplasmic nitrate reductase;       
   98::794     4e-09  25%  831 aa  NAPA_RHOS4 RecName: Full=Periplasmic nitrate reductase;       
   96::594     6e-09  25%  829 aa  NAPA_SHEDO RecName: Full=Periplasmic nitrate reductase;       
   98::677     8e-09  23%  829 aa  NAPA_VIBCM RecName: Full=Periplasmic nitrate reductase;       
   98::677     8e-09  23%  829 aa  NAPA_VIBCH RecName: Full=Periplasmic nitrate reductase;       
   98::677     8e-09  23%  829 aa  NAPA_VIBC3 RecName: Full=Periplasmic nitrate reductase;       
  288::502     1e-08  26%  985 aa  YJGC_BACSU RecName: Full=Probable oxidoreductase yjgC;       
   63::331     2e-08  30%  823 aa  DMSA_RHOCA RecName: Full=Dimethyl sulfoxide/trimethylamine N-oxide
   47::259     3e-08  24%  714 aa  NARB_SYNY3 RecName: Full=Nitrate reductase;         EC=1.7.99.4;
   97::628     3e-08  24%  831 aa  NAPA_YERE8 RecName: Full=Periplasmic nitrate reductase;       
   98::596     3e-08  24%  831 aa  NAPA_RALEH RecName: Full=Periplasmic nitrate reductase;       
   95::744     4e-08  31%  809 aa  TORZ_ECOL6 RecName: Full=Trimethylamine-N-oxide reductase 2;       
  101::822     4e-08  24%  851 aa  NAPA_LEPCP RecName: Full=Periplasmic nitrate reductase;       
  101::633     7e-08  26%  837 aa  NAPA_BRAJA RecName: Full=Periplasmic nitrate reductase;       
   94::819     9e-08  26%  827 aa  NAPA_ACTPJ RecName: Full=Periplasmic nitrate reductase;       
   94::819     9e-08  26%  827 aa  NAPA_ACTP7 RecName: Full=Periplasmic nitrate reductase;       
   94::819     9e-08  26%  827 aa  NAPA_ACTP2 RecName: Full=Periplasmic nitrate reductase;       
   63::364     9e-08  30%  822 aa  DMSA_RHOSH RecName: Full=Dimethyl sulfoxide reductase;       
   95::744     1e-07  31%  809 aa  TORZ_ECOLI RecName: Full=Trimethylamine-N-oxide reductase 2;       
   95::744     1e-07  31%  809 aa  TORZ_ECO57 RecName: Full=Trimethylamine-N-oxide reductase 2;       
   97::218     1e-07  31%  936 aa  NAPA_NITSB RecName: Full=Periplasmic nitrate reductase;       
  153::341     2e-07  27% 1247 aa  NARG_ECOLI RecName: Full=Respiratory nitrate reductase 1 alpha
   94::531     2e-07  26%  827 aa  NAPA_HAEPS RecName: Full=Periplasmic nitrate reductase;       
   97::646     5e-07  23%  847 aa  NAPA_BORPD RecName: Full=Periplasmic nitrate reductase;       
   97::569     8e-07  25%  829 aa  NAPA_EDWI9 RecName: Full=Periplasmic nitrate reductase;       
  153::392     1e-06  25% 1246 aa  NARZ_ECOLI RecName: Full=Respiratory nitrate reductase 2 alpha
   34::248     2e-06  24%  938 aa  NARB_SHEFN RecName: Full=Nitrate reductase;         EC=1.7.99.4;
   93::214     8e-06  30%  925 aa  NAPA_CAMFF RecName: Full=Periplasmic nitrate reductase;       
  111::304     1e-05  29%  937 aa  NAPA_HELHP RecName: Full=Periplasmic nitrate reductase;       
   96::593     2e-05  23%  826 aa  NAPA_SHEHH RecName: Full=Periplasmic nitrate reductase;       
   99::338     3e-05  29%  850 aa  TORA_SALTY RecName: Full=Trimethylamine-N-oxide reductase;       
   99::338     3e-05  29%  850 aa  TORA_SALTI RecName: Full=Trimethylamine-N-oxide reductase;       
   98::350     4e-05  27%  838 aa  NAPA_RALPJ RecName: Full=Periplasmic nitrate reductase;       
   92::213     6e-05  29%  924 aa  NAPA_CAMJR RecName: Full=Periplasmic nitrate reductase;       
   91::212     6e-05  29%  923 aa  NAPA_CAMJJ RecName: Full=Periplasmic nitrate reductase;       
   92::213     6e-05  29%  924 aa  NAPA_CAMJE RecName: Full=Periplasmic nitrate reductase;       
   92::213     6e-05  29%  924 aa  NAPA_CAMJ8 RecName: Full=Periplasmic nitrate reductase;       
   92::213     7e-05  27%  924 aa  NAPA_CAMLR RecName: Full=Periplasmic nitrate reductase;       
   97::146     2e-04  39%  937 aa  NAPA_NAUPA RecName: Full=Periplasmic nitrate reductase;       
   97::218     4e-04  26%  928 aa  NAPA_WOLSU RecName: Full=Periplasmic nitrate reductase;       
   92::213     6e-04  27%  920 aa  NAPA_CAMHC RecName: Full=Periplasmic nitrate reductase;       
  116::329     1e-08  27%  825 aa  TORZ_HAEIN RecName: Full=Trimethylamine-N-oxide reductase;       (query 107->293)
    1::816

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLFFVRNGQRMYLL
PHSA_SALTY      ------------------------------------------------------------VVNNKTVFIQ
YNFE_ECOLI      ----------------------------------------------------------------------
YNFF_ECOLI      ----------------------------------------------------------------------
DMSA_HAEIN      ----------------------------------------------------------------------
PSRA_WOLSU      ------------------------------------------------------------VEGDKGVFIR
DMSA_ECOLI      ----------------------------------------------------------------------
DDHA_RHOSU      ----------------------------------------------------------------------
SERA_THASE      -----------------------------------------------------------FVKNGVPMREE
CLRA_IDEDE      -----------------------------------------------------------FVKNGIPMREE
YOAE_BACSU      ---------------------------------------------------------LIHKKDGKIVKVQ
NAPA_DESDA      ------------------------------------------------------------VKDGKAVAIQ
NAPA_SYMTH      ----------------------------------------------------------------------
FDHL_STAAB      ----------------------------------------------------------FEVWTKDREILK
FDHL_STAAW      ----------------------------------------------------------FEVWTKDREILK
FDHL_STAAS      ----------------------------------------------------------FEVWTKDREILK
FDHL_STAAN      ----------------------------------------------------------FEVWTKDREILK
FDHL_STAAM      ----------------------------------------------------------FEVWTKDREILK
TORA_PASMU      ----------------------------------------------------------------------
FDHL_STAAR      ----------------------------------------------------------FEVWTKDREILK
FDHA_METJA      -------------------------------------------------------------KDGRVIGIH
FDOG_ECOLI      ----------------------------------------------------------------------
FDHL_STAAC      ----------------------------------------------------------FEVWTKDREILK
FDHL_STAA8      ----------------------------------------------------------FEVWTKDREILK
FDHL_STAA3      ----------------------------------------------------------FEVWTKDREILK
TORA_VIBPA      ----------------------------------------------------------------------
NAPA_VIBHB      ----------------------------------------------------------------------
FDHA_METFO      ----------------------------------------------------------------------
FDHL_STAS1      ----------------------------------------------------------FDVWTKNREVLK
NAPA_SACD2      ----------------------------------------------------------------------
FDHF_ECOLI      ----------------------------------------------------------------------
BISC_ECOLI      ----------------------------------------------------------------------
NAPA_PSYIN      ----------------------------------------------------------------------
FDNG_ECOLI      ----------------------------------------------------------------------
FDXG_HAEIN      ----------------------------------------------------------------------
TORA_VIBVY      ----------------------------------------------------------------------
TORA_VIBVU      ----------------------------------------------------------------------
NAPA_RHIME      ----------------------------------------------------------------------
NAPA_BORPA      ----------------------------------------------------------------------
NAPA_BORBR      ----------------------------------------------------------------------
TORA_ECOLI      ----------------------------------------------------------------------
TORA_ECO57      ----------------------------------------------------------------------
NAPA_VIBPA      ----------------------------------------------------------------------
BISC_RHOSH      ----------------------------------------------------------------------
TORA_ECOL6      ----------------------------------------------------------------------
NAPA_VIBSL      ----------------------------------------------------------------------
NAPA1_PHOPR     ----------------------------------------------------------------------
NAPA_VIBFM      ----------------------------------------------------------------------
NAPA_VIBF1      ----------------------------------------------------------------------
NAPA_METS4      ----------------------------------------------------------------------
TORZ_HAEIN      ----------------------------------------------------------------------
NAPA_COLP3      ----------------------------------------------------------------------
FDHL_STAHJ      ----------------------------------------------------------FDVWTKDREVLK
NAPA_DINSH      ----------------------------------------------------------------------
NAPA_PSEU5      ----------------------------------------------------------------------
NAPA_PSEST      ----------------------------------------------------------------------
NAPA_PSEAE      ----------------------------------------------------------------------
NAPA_AERHH      ----------------------------------------------------------------------
FDHA_DESGI      ----------------------------------------------------------------------
NAPA_PSEAB      ----------------------------------------------------------------------
NAPA_VIBVU      ----------------------------------------------------------------------
NAPA_BURXL      ----------------------------------------------------------------------
YYAE_BACSU      ----------------------------------------------------------------------
NAPA_VIBVY      ----------------------------------------------------------------------
NAPA_PSEA8      ----------------------------------------------------------------------
NAPA_MAGSA      ----------------------------------------------------------------------
NAPA_AGRT5      ----------------------------------------------------------------------
NAPA_PSEMY      ----------------------------------------------------------------------
FDHL_BACSU      ----------------------------------------------------------------------
NASC_BACSU      ----------------------------------------------------------------------
NAPA_PSEA7      ----------------------------------------------------------------------
NAPA_BRASB      ----------------------------------------------------------------------
NASA_KLEOX      ----------------------------------------------------------------------
NAPA_RALEJ      ----------------------------------------------------------------------
NAPA_HAES2      ----------------------------------------------------------------------
NAPA_PASMU      ----------------------------------------------------------------------
NAPA_PARPN      ----------------------------------------------------------------------
NAPA_HAES1      ----------------------------------------------------------------------
NAPA2_PHOPR     ----------------------------------------------------------------------
NAPA_MAGMG      ----------------------------------------------------------------------
NAPA_BRASO      ----------------------------------------------------------------------
NARG_BACSU      ----------------------------------------------------------------------
NARB_SYNE7      ----------------------------------------------------------------------
NAPA_CUPTR      ----------------------------------------------------------------------
TORA_SHEMA      ----------------------------------------------------------------------
NAPA_ACTAC      ----------------------------------------------------------------------
TORA_VIBCH      ----------------------------------------------------------------------
TORA_SHEON      ----------------------------------------------------------------------
NAPA_AERS4      ----------------------------------------------------------------------
NAPA_SHEON      ----------------------------------------------------------------------
NAPA_LARHH      ----------------------------------------------------------------------
NAPA_RHOS4      ----------------------------------------------------------------------
NAPA_SHEDO      ----------------------------------------------------------------------
NAPA_VIBCM      ----------------------------------------------------------------------
NAPA_VIBCH      ----------------------------------------------------------------------
NAPA_VIBC3      ----------------------------------------------------------------------
YJGC_BACSU      ----------------------------------------------------------------------
DMSA_RHOCA      ------------------------------------------------------------VENGRATAFT
NARB_SYNY3      ----------------------------------------------------------------------
NAPA_YERE8      ----------------------------------------------------------------------
NAPA_RALEH      ----------------------------------------------------------------------
TORZ_ECOL6      ----------------------------------------------------------------------
NAPA_LEPCP      ----------------------------------------------------------------------
NAPA_BRAJA      ----------------------------------------------------------------------
NAPA_ACTPJ      ----------------------------------------------------------------------
NAPA_ACTP7      ----------------------------------------------------------------------
NAPA_ACTP2      ----------------------------------------------------------------------
DMSA_RHOSH      ------------------------------------------------------------VENGRAVAFE
TORZ_ECOLI      ----------------------------------------------------------------------
TORZ_ECO57      ----------------------------------------------------------------------
NAPA_NITSB      ----------------------------------------------------------------------
NARG_ECOLI      ----------------------------------------------------------------------
NAPA_HAEPS      ----------------------------------------------------------------------
NAPA_BORPD      ----------------------------------------------------------------------
NAPA_EDWI9      ----------------------------------------------------------------------
NARZ_ECOLI      ----------------------------------------------------------------------
NARB_SHEFN      ------------------------------------------------------------------LILV
NAPA_CAMFF      ----------------------------------------------------------------------
NAPA_HELHP      ----------------------------------------------------------------------
NAPA_SHEHH      ----------------------------------------------------------------------
TORA_SALTY      ----------------------------------------------------------------------
TORA_SALTI      ----------------------------------------------------------------------
NAPA_RALPJ      ----------------------------------------------------------------------
NAPA_CAMJR      ----------------------------------------------------------------------
NAPA_CAMJJ      ----------------------------------------------------------------------
NAPA_CAMJE      ----------------------------------------------------------------------
NAPA_CAMJ8      ----------------------------------------------------------------------
NAPA_CAMLR      ----------------------------------------------------------------------
NAPA_NAUPA      ----------------------------------------------------------------------
NAPA_WOLSU      ----------------------------------------------------------------------
NAPA_CAMHC      ----------------------------------------------------------------------
TORZ_HAEIN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PNPKHPQPGMCFRPASALQLWNHPLRLKKPLKRVGERGEGKFQEVDWETALNEIAQRLREIVQRYGPESV
PHSA_SALTY      GNPSAPQQGICARGGSGVSLVNDPQRIVKPMKRTGPRGDGEWQVISWQQAYQEIAAKMNAIKAQHGPEXX
YNFE_ECOLI      ----------CLRGRSIRRRINHPDRLNYPMKRVGKRGEGKFERISWDEALDTIASSLKKTVEQYGNEAV
YNFF_ECOLI      ----------CLRGRSIRRRMNHPDRLKYPMKRVGKRGEGKFERISWDEALDTISDNLRRILKDYGNEAV
DMSA_HAEIN      ----------CLRGRSMRRRVYNPDRLKYPMKRIGKRGEGKFKRISWDEALTEIADALKRNIKKYGNESI
PSRA_WOLSU      GNPKDKSRGVCARGGSGFNQLYDPQRLVKPIMRVGERGEGKWKEVSWDEAYTFIAKKLDEIKQKHGAHTV
DMSA_ECOLI      ----------CLRGRSMRRRVYNPDRLKYPMKRVGARGEGKFERISWEEAYDIIATNMQRLIKEYGNESI
DDHA_RHOSU      -------------------------RLRYPMKRVGARGEGKWQRISWDQATEEIADKIIDIYEKYGPKLM
SERA_THASE      QVSEYPQPGVCQKGAVYCSWSKQPDFLKYPLKRVGERGERKWKRISWDEAFTEIADKIIDTTVKRGPGNV
CLRA_IDEDE      QISKYPQPGICQKGAVYCSWSKQPDHIKWPLKRVGERGERKWKRISWDEALTEIADKIIDTTVKRGPGNI
YOAE_BACSU      GDPDHPVTAICNKVRNMTERIYDEKRLTTPLKRTGAKGQAIFEPISWKEAIDTITSRWKQLIDEEGAES-
NAPA_DESDA      GDPNNHNAGLCLKGSLLIPVLNSKERVTQPLVR--RHKGGKLEPVSWDEALDLMASRFRSSIDMYGPNSV
NAPA_SYMTH      -------------------------RILKPLIRKN----GQLTEASWDEALDLVAARFREAIDQHGPDSV
FDHL_STAAB      VQPSHDSPATCVKGKFSWGHINSDQRLTKPLVRKN----GEFHEVEWDEALNVIADNFTSIKEKYGPDAL
FDHL_STAAW      VQPSHDSPATCVKGKFSWGHINSDQRLTKPLVRKN----GEFHEVEWDEALNVIADNFTSIKEKYGPDAL
FDHL_STAAS      VQPSHDSPATCVKGKFSWGHINSDQRLTKPLVRKN----GEFHEVEWDEALNVIADNFTSIKEKYGPDAL
FDHL_STAAN      VQPSHDSPATCVKGKFSWGHINSDQRLTKPLVRKN----GEFHEVEWDEALNVIADNFTSIKEKYGPDAL
FDHL_STAAM      VQPSHDSPATCVKGKFSWGHINSDQRLTKPLVRKN----GEFHEVEWDEALNVIADNFTSIKEKYGPDAL
TORA_PASMU      ---------------------------KRHNSNTAQRGDNRFVRVTWDEALDLFYEELERIQQNYGPWAL
FDHL_STAAR      VQPSHDSPATCVKGKFSWGHINSDQRLTKPLVRKN----GEFHEVEWDEALNVIADNFTSIKEKHGPDAL
FDHA_METJA      PNKRHPEGKLCAKGNYCYQFIHSKDRLTKPLIKK----ESGFVETTWNKALEVIAENLKTYKDEIGFFSS
FDOG_ECOLI      -DPDHPRGALCPKGAGLVDFIHSESRLKFPEYRAP--GSDKWQQISWEEAFDRIAKLMKEIAQNAEGVTV
FDHL_STAAC      VQPSHDSPATCVKGKFSWGHINSDQRLTKPLVRKN----GEFHEVEWDEALNVIADNFTAIKEKHGPDAL
FDHL_STAA8      VQPSHDSPATCVKGKFSWGHINSDQRLTKPLVRKN----GEFHEVEWDEALNVIADNFTAIKEKHGPDAL
FDHL_STAA3      VQPSHDSPATCVKGKFSWGHINSDQRLTKPLVRKN----GEFHEVEWDEALNVIADNFTAIKEKHGPDAL
TORA_VIBPA      --------------------------LKKHKYSADTRGNNRFIRVTWDEALDLFYRELERVQKEYGPWAL
NAPA_VIBHB      -------------------------RLTKPLLRMKDSKDGDFAPVSWDTAFDIMAEKWKASLEKKGPTSI
FDHA_METFO      PWKRHPEGKLCPKGNFCYEIIHREDRLTTPL--IKENGE--FREATWDEAYDLIASKLGA----YDPNEI
FDHL_STAS1      VQPQHESPASCVKGKFGWDYVDSDERLTKPLVRKN----GQFEEVEWEEALSVVAENFNKVKGTHGSDGL
NAPA_SACD2      -------------------------RLTQPLLRKKNAKDGEFEPVTWEEAFTIMAEKFKKTLKEKGPEGI
FDHF_ECOLI      -------------------------RLKTPMIR-RQRG-GKLEPVSWDEALNYVAERLSAIKEKYGPDAI
BISC_ECOLI      --------------------------LASPENPQGIRGQDEFVRVSWDEALDLIHQQHKRIREAYGPASI
NAPA_PSYIN      -------------------------RLTTPLLRMTEGKNGQFEPVSWDAAFDIMADKFKDALKKKGPTAV
FDNG_ECOLI      -DPDHPRGALCPKGAGLLDYVNSENRLRYPEYRAP--GSDKWQRISWEEAFSRIAKLMKATVNRWLSTGM
FDXG_HAEIN      -DPDHPRGALCPKGAGSLDYVNSESRSLYPQYRAP--GSDKWERISWKDAIKRIARLMKDTVNRWATTGI
TORA_VIBVY      --------------------------LKKHKYSADTRGNNRFVRVTWDEALDLFYRELERVQKEYGPWAL
TORA_VIBVU      --------------------------LKKHKYSADTRGNNRFVRVTWDEALDLFYRELERVQKEYGPWAL
NAPA_RHIME      -------------------------RLKTPLKRNGAFADGEFEPVSWDEAFDVMAEQAKKVLKDKGPTAV
NAPA_BORPA      -------------------------RLTQPLLRIKDAKDGEFAPVSWDQAFDVMAEQFKRVLKDKGPEAV
NAPA_BORBR      -------------------------RLTQPLLRMKDAKDGEFAPVSWDQAFDVMAEQFKRVLKDKGPEAV
TORA_ECOLI      ---------------------------KRHLSDTSQRGDNRFVRVSWDEALDMFYEELERVQKTHGP-SA
TORA_ECO57      ---------------------------KRHLSDTSQRGDNRFVRVSWDEALDMFYEELERVQKTHGP-SA
NAPA_VIBPA      -------------------------RLTQPLLRMKDHKDGEFTPVSWDVAFDTMAEKWKASLEKKGPTSV
BISC_RHOSH      ------------------------------------RGRERFLPVSWDAALDLVAGEIRRVSADHGNAAI
TORA_ECOL6      ---------------------------KRHLSDTSQRGDNRFVRVSWDEALDMFYEELERVQKTHGP-SA
NAPA_VIBSL      -------------------------RLEQPLLRMKDHKDGDFAPVSWDKAFDVMAEKWKAALKKNGPTGV
NAPA1_PHOPR     -------------------------RLQTPMLRMGEYNEGDFAPVSWDQAFDVMAEKFKKALKEKGPTSV
NAPA_VIBFM      -------------------------RVQTPMLRMKDNKDGDFAPVSWDVALDTMAEKWKAALKKHGPTGV
NAPA_VIBF1      -------------------------RVQTPMLRMKDNKDGDFAPVSWDVALDTMAEKWKAALKKHGPTGV
NAPA_METS4      -------------------------RLTQPLMRV--RG-GKFQPVSWDQAFDEMARQWKRVLREKGPKAV
TORZ_HAEIN      ----------------------------------------------------------------------
NAPA_COLP3      -------------------------RLTTPLLRMTNGKEGEFTPISWDQAFNVMAEKANDALKKDGPEAL
FDHL_STAHJ      VQPSHDSPATCVKGKFSWGHINSDQRLTKPLVRK----DGEFHEVEWDEALDVIETNFKRIKNEYGGDHL
NAPA_DINSH      ---------------------------------------GTFEPVSWDEAFDVMAQKWKEALAKKGPTSV
NAPA_PSEU5      -------------------------RLTQPLLRMKDGKQGEFQPVTWDQAFDIMEEKYKAALKAGGPEAI
NAPA_PSEST      -------------------------RLTQPLLRMKDGKQGEFQPVTWDQAFDIMEEKYKAALKAGGPEAI
NAPA_PSEAE      -------------------------RLTRPLLRMKDGKQGEFQPISWEQAFDIMAEKFKAALKAKGPESV
NAPA_AERHH      -------------------------RLTQPMLRMTDGKNGNFAPISWDQAFDIMAEKFKTTLKEKGPTAV
FDHA_DESGI      -DPDHPEGSLCAKGASTWQLAENERRPANPLYRAP--GSDQWEEKSWDWMLDTIAERVAQVVNRCGIASV
NAPA_PSEAB      -------------------------RLTRPLLRMKDGKQGEFQPISWEQAFDIMAEKFKAALKAKGPESV
NAPA_VIBVU      -------------------------RLTQPLLRMKDGKEGDFTPVSWDVAFDTMAEKWKASLAKKGPTSI
NAPA_BURXL      -------------------------RLTTPLLRMKDAKDGEFAPVSWDQAFDVMADHFKRTLKEKGPTAV
YYAE_BACSU      --PNHPEGKICGRGRMLETKTNSPDRLRYPMKKQN----GEFVRISWEQALDEIADKLREIKETSETTAV
NAPA_VIBVY      -------------------------RLTQPLLRMKDGKEGDFTPVSWDVAFDTMAEKWKASLAKKGPTSI
NAPA_PSEA8      -------------------------RLTRPLLRMKDGKQGEFQPISWEQAFDIMAEKFKAALKAKGPESV
NAPA_MAGSA      -------------------------RLTKPLLRM-KNGKGEFQPISWDQAFDIMAEKWKEQLKK--PDGV
NAPA_AGRT5      -------------------------RLETPLLRKKNAKDGEFEPVSWDEAFDVMAQQCKRVLKEKGPTAV
NAPA_PSEMY      -------------------------RLTQPLLRMKNGKQGEFQPVSWDQAFDIMAQKIKQAIAEQGPEAV
FDHL_BACSU      ---------------------NSKERITKPLIRKN----GAFVESSWEEALDLVASRLGSIKEQYGKGSV
NASC_BACSU      ------QGRLCIKGMNAHQHALNSSRITRPLLKKN----GEFMPVSWEEALNHIKDQVTMIQTEHGHDAM
NAPA_PSEA7      -------------------------RLTRPLLRMKDGKQGEFQPISWEQAFDIMAEKFKAALKAKGPESV
NAPA_BRASB      ----------------------HPM-LRKTNGKYDKNGE--FTPVSWDEAFDIMALKFKDALKKRGPSGV
NASA_KLEOX      ---------------------------------VGLEGRMLFPEVDWPQALAAAGSRLREIIDRHGPQAV
NAPA_RALEJ      -------------------------RLTKPLLRM-KNGKGEFAPVTWDQAFDEMERQFKRVLKEKGPTAV
NAPA_HAES2      --------------------------------------EGEFTPVTWDFAFKTMAEKFKSALKAKGPNGV
NAPA_PASMU      -------------------------RLTSPMLRMTNGKHGEFTPVSWDQAFTIMAEKFKKALKEKGPNGA
NAPA_PARPN      -------------------------RLTQPLLRKKDAKDGEFTPVSWEEAFDTMAAQAKRVLRDKGPTAL
NAPA_HAES1      --------------------------------------EGEFTPVTWDFAFKTMAEKFKSALKAKGPNGV
NAPA2_PHOPR     -------------------------RLTQPLLRMTDGKNGEFSPISWDQAFDIMAEKWKKTLKEKGPEAI
NAPA_MAGMG      -------------------------RLTRPLLRMKDGKNGEFQPISWDQAFDIMAEKWKEQLKK--PDGV
NAPA_BRASO      -------------------------RLTHPLRKTGGQYDGEFTPVSWDEAFDVMALKFKDALKKRGPSGV
NARG_BACSU      ----------------ALQTHQNPLEAWKSIVENPERGKGGFVRAEWPEVLKLISASLLYTVMKYGPDNV
NARB_SYNE7      -------------------------RLKYPMFRASL--DDPFTEISWDEALDRLCDRIQQTQADYGKDGI
NAPA_CUPTR      -------------------------RLTKPLLRM-KNGQGEFAPVTWERAFDEMERQFKRVLKEKGPTAV
TORA_SHEMA      ----------------------------------------------------------------------
NAPA_ACTAC      -------------------------RLTQPMLRMKDGKNGDFTPVSWDVAFKTMAEKFKAAVKELGPNGV
TORA_VIBCH      --------------------------LKKHKYSAETRGNNRFIRVTWDEAIDLFYRELERVQKQYGPWAL
TORA_SHEON      ----------------------------------------------------------------------
NAPA_AERS4      -------------------------RLTQPMLRMTNGKNGDFAPVSWDQAFDIMAEKFKATLKEKGPTAV
NAPA_SHEON      -------------------------RLTTPLLRMKDHKEGEFTPVSWDVAFDTMAAKWKHSIATKGPTSV
NAPA_LARHH      -------------------------RLTKPLLRM-KNGKGEFTPVTWKQAFDVMEEKFKTAMKAGGPEAV
NAPA_RHOS4      -------------------------RLTTPLLRMKDHKEGEFAPVSWDEAFDVMAAQAKRVLKEKGPKAV
NAPA_SHEDO      -------------------------RLTSPMLRMTDGKHGEFTPVSWEKAFDTMAERWKATIKEKGPTAV
NAPA_VIBCM      -------------------------RLKTPLLRMKDHKDGEFTPVSWDTAFDVMAEKWKASLKTKGPTSV
NAPA_VIBCH      -------------------------RLKTPLLRMKDHKDGEFTPVSWDTAFDVMAEKWKASLKTKGPTSV
NAPA_VIBC3      -------------------------RLKTPLLRMKDHKDGEFTPVSWDTAFDVMAEKWKASLKTKGPTSV
YJGC_BACSU      PQEEAPANGICVKGKFGWDFVNSEERLTKPLIREGDH----FRXXXXXXXXXXXXSKFTELKEAFGPDSL
DMSA_RHOCA      PWEKDPHPTPMLE--GVLDSIYSPTRIKYPMVRRSTRGNGDFVRVSWDQALDLVAAEVKRVEETYGPQGV
NARB_SYNY3      ---QHPQGMVCVKGATVMESMDKQ-RLLYPMFRSSL--DQPWQQISWEAALEIVVDKIQQVKQTLGVSGL
NAPA_YERE8      -------------------------RLTQPLLRMKDGQEGDFTPISWEKAFDIMELKFKNALKEKGPTAV
NAPA_RALEH      -------------------------RLTRPLMRM-KNGKGDFAPVTWDQAFDEMERQFKRVLKEKGPTAV
TORZ_ECOL6      --------------------------LDNPLQPVKGRGEDTYVQVSWEQALKLIHEQHDRIRKANGPSAI
NAPA_LEPCP      -------------------------RLQTPLLRKKNGKEGDFVPVSWDEAFDIMAAKWKETLKTDGPTGI
NAPA_BRAJA      -------------------------RLTQPMLRKANGKNGDFTPVSWTEAFDIMEVKWKEAMKKRGPNGV
NAPA_ACTPJ      -------------------------RVQTPLLRMKDHKEGDFTPVSWDQAFTIMAEKVKDILKKKEPNSV
NAPA_ACTP7      -------------------------RVQTPLLRMKDHKEGDFTPVSWDQAFTIMAEKVKDILKKKEPNSV
NAPA_ACTP2      -------------------------RVQTPLLRMKDHKEGDFTPVSWDQAFTIMAEKVKDILKKKEPNSV
DMSA_RHOSH      PWDKDPAPS--HQLPGVLDSIYSPTRIKYPMVRRSTRGNGDFVRVTWDEALDLVARELKRVQESYGPTGT
TORZ_ECOLI      --------------------------LDNPLQPAKGRGEDTYVQVSWEQALKLIHEQHDRIRKANGPSAI
TORZ_ECO57      --------------------------LDNPLQPAKGRGEDTYVQVSWEQALKLIHEQHERIRKANGPSAI
NAPA_NITSB      -------------------------RLKTPLLRMNDKGEGKFRPVSWKRAFDEMEKQFRKAYNELGPTGV
NARG_ECOLI      ------------------------------------RGRGGFVRSSWQEVNELIAASNVYTIKNYGPDRV
NAPA_HAEPS      -------------------------RLTSPMLRMKDGKNGEFTPVSWDQAFTIMAEKFKKAIKEQGPNGV
NAPA_BORPD      -------------------------RLTRPMLRKKNGANGEFTPISWDEAFDIMAQKWKQALAAGGPDAI
NAPA_EDWI9      -------------------------RLTQPLLRMGQYDEGEFTPVSWDQAFDVMAAKFKGTLKEKGPGAV
NARZ_ECOLI      ------------------------------------RGRGGFIRSNWQELNQLIAAANVWTIKTYGPDRV
NARB_SHEFN      GDNKHPANHLCAKGERLLDSLAQPNVLRYPKLRSG-------MPLDWDKASTLIADTFAKTIAEHGPDSV
NAPA_CAMFF      -------------------------RITKPLLRVNANGEGKFQEVSWKRAFDEMEKQFRKTYAELGPTGI
NAPA_HELHP      -------------------------RLTTPLLRVNSNGEGKFAPVSWKRAFDEMEKQFKKAYNELGPTGI
NAPA_SHEHH      -------------------------RLTTPLLRMKDGQEGEFTPISWDSAFDIMADKWKDTLKTKGPTAV
TORA_SALTY      -------------------------RIRYPMVRVSQRGDNRFVRVSWDEALDLFYQELERVQKTYGP-SA
TORA_SALTI      -------------------------RIRYPMVRVSQRGDNRFVRVSWDEALDLFYQELERVQKTYGP-SA
NAPA_RALPJ      -------------------------RLTQPLLRM-KNGKGEFTPVTWDRAFDEMAMQFKRVIKEKGPTAV
NAPA_CAMJR      -------------------------RLVMPLLRMNEKGEGKFQQVSWQRAFDEMEKQFKKAYNELGVTGI
NAPA_CAMJJ      -------------------------RLVMPLLRMNEKGEGKFQQVSWQRAFDEMEKQFKKAYNELGVTGI
NAPA_CAMJE      -------------------------RLVMPLLRMNEKGEGKFQQVSWQRAFDEMEKQFKKAYNELGVTGI
NAPA_CAMJ8      -------------------------RLVMPLLRMNEKGEGKFQQVSWQRAFDEMEKQFKKAYNELGVTGI
NAPA_CAMLR      -------------------------RLVTPLLRVNAKGEGKFQQVSWQRAFDEMEKHFKKAYKEKGVEGI
NAPA_NAUPA      -------------------------RLTQPLLRMNDKGEGKFRPVSWKRAFDEMEKQFKKYYNELGPTGV
NAPA_WOLSU      -------------------------RLTDPLLRVNEKGEGKFKPVSWKKAFDVMEAQFKRAYNELGPTGI
NAPA_CAMHC      -------------------------RITEPLLRVNSKGEGKFAPVSWKKAFDVMEKEFKKAYKEKGPTGI
TORZ_HAEIN      ------------------------------------RGRDEWVRVSWDEALDLVHNQLKRVRDEHGSTGI


                         +         .         .         .         .         *         .:210
query           AFTRHDHMSWILPFIASVIGTPNIISHEGTCHAASTAVRKFVLGASGPSSVDPDYENANYILLIGRNLDA
PHSA_SALTY      XXXXXXXXXXXHLFLATAFGSPNTFTHASTCPAGKAIAAKVMMG----GDLAMDIANTRYLVSFGHNLGI
YNFE_ECOLI      YIQYSSNMTRSSPSASAVKRLMNCLNQYGSYSTAQISCAMPYTYGSNDGNSTTDIENSKLVVMFGNNAET
YNFF_ECOLI      ------HVLYGTGVDGGNITNSNVLSRYGSYSTAQSAAMSYMFGANDGNSPD-DIANTKLVVMFGNNAET
DMSA_HAEIN      YLNYXXXKSWMIARFMNCIG--GYLNHYGDYSTAQIAVGLDYTYGGGWALGNADIENTKLIVLFGNNPAE
PSRA_WOLSU      AFTARSNKTW-FHHLAQAYGSPNIFGHESTCPLAYNMAGRDVFG----GSMNRDFAKAKYIINMGHNVGI
DMSA_ECOLI      YLNXXXXRSWLVARLMNCCG--GYLNHYGDYSSAQIAELNYTYGGWADGNSPSDIENSKLVVLFGNNPGS
DDHA_RHOSU      THTGSGNMSMMAPYFASLVGQLDIFTDVGDLNTGA----HLAYGNALESFTSDAWFGADYIMLLFNPVAT
SERA_THASE      CMPKRPFASAGYSRLANLIGAPDVSSMTGDLYPGIQTVR---MPARTVSTFD-DWFTSDLILMWHKNIVT
CLRA_IDEDE      YITAYTRMTKLLGAI-----SPDATSMTGDLYTGIQTVR---VPASTVSTFD-DWFTSDLILMWHKNIVT
YOAE_BACSU      ----------ILPY--SFYGNMGKLTAEGMCSKAGSEGYKYTMGIS--AGIDPE-ETVHTKLFIFWGINA
NAPA_DESDA      AWYGSGQCLTEESYVANKIGTNNVDGNPRLCMASAVGGYVTSFGKDEPMGTYADIDQATCFFIIGSNTSE
NAPA_SYMTH      GFYGSGQNLAEETYIANCIGTNNVEGNPRTCMASAVAGFLSTFGKDEPMGNLDDIEHADTFFIIGSNTAE
FDHL_STAAB      SFISSNEESYLMQKLAQVIGTNNVDNCSRYCQAPATKGLFRTVGHGGDSGSIEDLEKAAMSVLIGTNTAE
FDHL_STAAW      SFISSNEESYLMQKLAQVIGTNNVDNCSRYCQAPATKGLFRTVGHGGDSGSIEDLEKAAMSVLIGTNTAE
FDHL_STAAS      SFISSNEESYLMQKLAQVIGTNNVDNCSRYCQAPATKGLFRTVGHGGDSGSIEDLEKAAMSVLIGTNTAE
FDHL_STAAN      SFISSNEESYLMQKLAQVIGTNNVDNCSRYCQAPATKGLFRTVGHGGDSGSIEDLEKAAMSVLIGTNTAE
FDHL_STAAM      SFISSNEESYLMQKLAQVIGTNNVDNCSRYCQAPATKGLFRTVGHGGDSGSIEDLEKAAMSVLIGTNTAE
TORA_PASMU      ---HTGNVGWRSTMIRAVGMHGNSVSTSGDYSTAGQVILPYVLGSTEVYSQGTSWESENIILQVGWNCET
FDHL_STAAR      SFISSNEESYLMQKLAQVIGTNNVDNCSRYCQAPATKGLFRTVGHGGDSGSIEDLEKAAMSVLIGTNTAE
FDHA_METJA      ARCTNEDNYILQKFARVALKTNNIDHCARLUHSATVTGMSACFGSGAMTNSIEDIELADCILIIGSNTFE
FDOG_ECOLI      ASASSNETGYLTQKFSRALGMLAVDNQARVUHGPTVASLAPTFGRGAMTNHWVDIKNANLVVVMGGNAAE
FDHL_STAAC      SFISSNEESYLMQKLAQVIGTNNVDNCSRYCQAPATKGLFRTVGHGGDSGSIEDLEKAAMSVLIGTNTAE
FDHL_STAA8      SFISSNEESYLMQKLAQVIGTNNVDNCSRYCQAPATKGLFRTVGHGGDSGSIEDLEKAAMSVLIGTNTAE
FDHL_STAA3      SFISSNEESYLMQKLAQVIGTNNVDNCSRYCQAPATKGLFRTVGHGGDSGSIEDLEKAAMSVLIGTNTAE
TORA_VIBPA      GWNQTGSFNNCTAHMQRAVGMHNFITKVGDYSTAGQTIMPYVLGSTEVYAQGTSWENSDNIILVGWNCET
NAPA_VIBHB      GMFGSGQWTVMEGYAAAKMMKAGFRSNNNARHCMASAVVGFMFGIDEPMGCYDDFENADAFVLWGSNM-A
FDHA_METFO      GFSPNENIYVNQKFARIVVGTHNIDHCARLCHGPTVAGLAASFGSGAMTNSYASFEDADLIFSIGANLEA
FDHL_STAS1      AFISSNEESYLMQKLAQVIGTNNVDNCSRYCQAPATKGLFRTVGHGGDSGSIEDLEIADMVVLIGTNTAE
NAPA_SACD2      GMFGSGQWTVWEGYAASKLMKAGFRSNNNARHCMASAVGGFMFGIDEPMGCYDDFEHADAFVLWGSNM-A
FDHF_ECOLI      QTTTGNETNYVMKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNADS
BISC_ECOLI      FAVLHKASTLLQRYMALAGGYTGHLGDYST--GAAQAIMPYVVGGSEVYQQQTSWEHSDVVVLIAWNASD
NAPA_PSYIN      GMFGSGQWTLWEGYAASKLRTNNLDPNARHCMASAVGGFMRTFGIDEPMGCYDDLENADVFVLWGSNM-A
FDNG_ECOLI      ASGASNETGMLTQKFARSLGMLAVDNQARVUHGPTVASLAPTFGRGAMTNHWVDIKNANVVMVMGGNAAE
FDXG_HAEIN      ASAMSNEAALLTQKWIRMLGMVPVCNQANTUHGPTVASLAPSFGRGAMTNNWVDIKNANLIIVQGGNAEA
TORA_VIBVY      GWNQTGSFNNCTAHMQRAVGMHNYITKVGDYSTAGQTILPYVLGSTEVYAQGTSWENADNIILVGWNCET
TORA_VIBVU      GWNQTGSFNNCTAHMQRAVGMHNYITKVGDYSTAGQTILPYVLGSTEVYAQGTSWENADNIILVGWNCET
NAPA_RHIME      GMFGSGQWTIFEGYAATKLRSNNLDPNARHCMASAAYAFMRTFGMDEPMGCYDDFEHADAFVLWGSNM-A
NAPA_BORPA      GFGSGQWTVWALKLMKAGFRTNNLDPNARHCMASAAVGFMRTFGADEPMGCYDDIENADAFVLWGSNM-A
NAPA_BORBR      GFGSGQWTVWALKLMKAGFRTNNLDPNARHCMASAAVGFMRTFGADEPMGCYDDIENADAFVLWGSNM-A
TORA_ECOLI      LLTASGWQSTGMFHNASGMLAKAIALHGGTGGDYSTGAAQVILPREQQTSWPLVLQNSKTIVLWGSDLDV
TORA_ECO57      LLTASGWQSTGMFHNASGMLAKAIALHGGTGGDYSTGAAQVILPREQQTSWPLVLQNSKTIVLWGSDLDV
NAPA_VIBPA      GMFGSGQWTVMEGYAAAKMMKAGFRSNNNARHCMASAVVGFMFGIDEPMGCYDDFENADAFVLWGSNM-A
BISC_RHOSH      SCGRFHHASTLLKRMLNLVG--GFTGHVDTYSAAGPVILRHTLGGGQANTLDSIAEHSQTLVVFGRTAQS
TORA_ECOL6      LLTASGWQSTGMFHNASGMLAKAIALHGGTGGDYSTGAAQVILPREQQTSWPLVLQNSKTIVLWGSDLKV
NAPA_VIBSL      GMFGSGQWTVMEGYAAVKLRSNNIDPNARHCMASAVGAFMRTFGIDEPMGCYDDFEHADAFVLWGSNM-A
NAPA1_PHOPR     GMFGSGQWTVMEGYAASKMMKAGFRSNNNARHCMASAVGGFMFGIDEPMGCYDDFEHADSFVLWGSNM-A
NAPA_VIBFM      GMFGSGQWTVMEGYAAVKLRSNNIDPNARHCMASAVGAFMRTFGIDEPMGCYDDFENADSFVLWGSNM-A
NAPA_VIBF1      GMFGSGQWTVMEGYAAVKLRSNNIDPNARHCMASAVGAFMRTFGIDEPMGCYDDFENADSFVLWGSNM-A
NAPA_METS4      GMFGSGQWTIFEGYAATKLMRAGFRSNNNARHCMASAAVGFIFGMDEPMGCYDDFEHADAFVLWGSNM-A
TORZ_HAEIN      ----------------------------------------------------------------------
NAPA_COLP3      GMFGSGQWTVAVKLMKAGFRTNNIDPNARHCMASAVGGFMRTFGIDEPMGCYDDLEAADAFVLWGSNM-A
FDHL_STAHJ      AFIASNEESYLMQKLSQVFGSNNVDNCSRYCQAPATKGLFRTVGHGGDSGSIEDLERAAMTVLIGTNTAE
NAPA_DINSH      GFGSGQWTVWAAKLMKAGFRSNNIDPNARHCMASAVVGFMRTFGIDEPMGCYDDFEHADTFVLWGSNM-A
NAPA_PSEU5      GMFGSGQWTIWEGYAANKLRSNNIDPNARHCMASAAFGFMRTFGMDEPMGCYEDIEAADAFVLWGSNM-A
NAPA_PSEST      GMFGSGQWTIWEGYAANKLRSNNIDPNARHCMASAAFGFMRTFGMDEPMGCYEDIEAADAFVLWGSNM-A
NAPA_PSEAE      GMFGSGQWTVWEGYAANKLFKAGLRSNNNARHCMASAVMGFMFGMDEPMGCYDDIEATDSFVLWGSNM-A
NAPA_AERHH      GFGSGQWTVWAAKLMKAGLRTNNLDPNARHCMASAVVGFMRTFGMDEPMGCYDDIEQADAFVLWGSNM-A
FDHA_DESGI      GSAAMDNEEWIYQAWLRSLGLFYIEHQARIUHSATVAALAESYGRGAMTNHWIDLKNSDVILMMGSN--P
NAPA_PSEAB      GMFGSGQWTVWEGYAANKLFKAGLRSNNNARHCMASAVMGFMFGMDEPMGCYDDIEATDSFVLWGSNM-A
NAPA_VIBVU      GMFGSGQWTVMEGYAAAKMMKAGFRSNNNARHCMASAVVGFMFGIDEPMGCYDDFEHADSFVLWGSNM-A
NAPA_BURXL      GFGSGQWTVWAVKLMKAGFRSNNLDPNARHCMASAVTGFMRTFGMDEPMGCYDDIEQADTFVLWGSNMSE
YYAE_BACSU      LHS-HDYANNGLRFFNGYGGVTEIVG--SICWGSGIEAQSWDFGRSGPL----DIYNSKHVVVWGRNVSR
NAPA_VIBVY      GMFGSGQWTVMEGYAAAKMMKAGFRSNNNARHCMASAVVGFMFGIDEPMGCYDDFEHADSFVLWGSNM-A
NAPA_PSEA8      GMFGSGQWTVWEGYAANKLFKAGLRSNNNARHCMASAVMGFMFGMDEPMGCYDDIEATDSFVLWGSNM-A
NAPA_MAGSA      TFGSGQWTIWASKLFKAGFRSNNLDPNARHCMASAVAGFMRTFGIDEPMGCYDDIEQTDAFVLWGSNM-A
NAPA_AGRT5      GMFGSGQWTIFEGYAATKLRSNNLDPNARHCMASAAYAFMRTFGMDEPMGCYDDFEHADAFVLWGSNM-A
NAPA_PSEMY      GMFGSGQWTVWEGYAANKLMKAGFRSNNNARHCMASAVMGFMFGMDEPMGCYDDIEAADAFVLWGSNM-A
FDHL_BACSU      GFISSSKINYVIQKLAQVFETNNVDNCSRYCQSPATDGLFRTVGMGGDAGTIKDIAKAGLVIIVGAN--P
NASC_BACSU      AVSITNEEAYLLGKFARVGLQTKYIDYNGRCMSXXXXXXNQTFGADGLTNPLSDIPHTRVIILAGTNIAE
NAPA_PSEA7      GMFGSGQWTVWEGYAANKLFKAGLRSNNNARHCMASAVMGFMFGMDEPMGCYDDIEATDSFVLWGSNM-A
NAPA_BRASB      GMFGSGQWTIWEGYAASKLRTNNIDPNARHCMASAVAGMMRTFGIDEPAGCYDDIEAADAFVLWGSNM-A
NASA_KLEOX      AFYASGQLLTEDYYAANFIGAANIDTNSRLCMSSAVTGYKRALGADVVPCSYEDVENSDLVVLVGSN--A
NAPA_RALEJ      GMFGSGQWTVWEGYAASKLYKAGFRSNNNARHCMASAVQGFMFGMDEPMGCYDDFEAADAFVLWGSNM-A
NAPA_HAES2      GMFTSGQSTIFEGVAKSKLFKAGLLSNNNARHCMASAAVAFVFGIDEPMGCYDDIEHADAFVLWGSN---
NAPA_PASMU      GFT--SGQSTIFEGIAKSLRSNNIDPNARHCMASAAVAFMRTFGMDEPMGCYDDIEKADAFVLWGSNM-A
NAPA_PARPN      GMFGSGQWTIFEGYAATKLRSNNLDPNARHCMASAAYAFMRTFGMDEPMGCYDDFEAADAFVLWGSNM-A
NAPA_HAES1      GMFTSGQSTIFEGVAKSKLFKAGLLSNNNARHCMASAAVAFVFGIDEPMGCYDDIEHADAFVLWGSN---
NAPA2_PHOPR     GMFGSGQWTIYDGYAASKLMKAGFRSNNNARHCMASAVVGFIFGIDEPMGCYDDIEAADAFVLWGSNM-V
NAPA_MAGMG      TRVMFGSGQWTIGYAASKLYKAGFRSNNNARHCMASAVAGFMFGIDEPMGCYDDIEQTDAFVLWGSNM-A
NAPA_BRASO      GMFGSGQWTIWEGYAASKLRTNNIDPNARHCMASAVAGMMRTFGIDEPAGCYDDIEATDAFVLWGSNM-A
NARG_BACSU      GFSPIPAMSMISHAFMSLIGGPMLSFYDW--YADLPPASPQIWGDQTDVPESSDWYNSGYIITWGSNVPL
NARB_SYNE7      CFYGSGQFQTEDYYIAQCLGTNNFDTNSRLCMSSAVSAYSLCLGSDGPPACYEDLDLADCLLIVGSNTAE
NAPA_CUPTR      GMFGSGQWTVWEGYAASKLYKAGFRSNNNARHCMASAVQGFMFGMDEPMGCYDDFEAADAFVLWGSNM-A
TORA_SHEMA      ----------------------------------------------------------------------
NAPA_ACTAC      GMFSSGQTTIFEGYAKSKLWSNNIDPNARHCMASAAVAFMRTFGMDEPMGCYNDIEQAEAFVLWGSNM-A
TORA_VIBCH      GWNQTGAFHNCTAMMQRAVGMHNYITKVGDYSTAGQTIMPYVLGSTEVYAQGTSWDNSDNIILVGWNCET
TORA_SHEON      ----------------------------------------------------------------------
NAPA_AERS4      GFGSGQWTVWAAKLMKAGFRTNNLDPNARHCMASAVVGFMRTFGMDEPMGCYDDIEQADAFVLWGSNM-A
NAPA_SHEON      GMFGSGQWTIWEGYAASKLHTNNIDPNARHCMASAVVGFMRTFGIDEPMGCYDDLEAADHFVLWGANM-A
NAPA_LARHH      AFGSGQWTIWAAKFMKAGLRSNNLDPNARHCMASAVVGFMRTFNMDEPMGCYDDIEKADAFVLWGSNM-A
NAPA_RHOS4      GMFGSGQWTIWEGYAASKLRSNNLDPNARHCMASAATAFMRTFGMDEPMGCYDDFEAADAFVLWGSNM-A
NAPA_SHEDO      GFGSGQWTVWAVKLMKAGFGTNNIDPNARHCMASAVAGFMRTFGIDEPMGCYDDMEAADAFVLWGSNM-A
NAPA_VIBCM      GMFGSGQWTVMEGYAAAGFRSNNIDPNARHCMASAVVGFMRTFGIDEPMGCYDDFEHADAFVLWGSNM-A
NAPA_VIBCH      GMFGSGQWTVMEGYAAAGFRSNNIDPNARHCMASAVVGFMRTFGIDEPMGCYDDFEHADAFVLWGSNM-A
NAPA_VIBC3      GMFGSGQWTVMEGYAAAGFRSNNIDPNARHCMASAVVGFMRTFGIDEPMGCYDDFEHADAFVLWGSNM-A
YJGC_BACSU      AFITSNEESYLMQKLAGVIGTNNVDNCSRYCQSPATAGLFRTVGYGGDSGSITDIAQADLVLIIGSNTSE
DMSA_RHOCA      FGGSY---GWKSP---------------GRLHNCTTLLRRMLTLAGGYVNGAGDYSTAQVIMVLAENTEV
NARB_SYNY3      CMYASGQMQTEDYYVAQCLGTNNFDTNSRLCMSSAVSAYSLSFGSDGPPCCYEDLEITDCAFLIGTNTDC
NAPA_YERE8      GMFGSGQWTVWEGYAASKLRSNNLDPNARHCMASSVVGFMRTFGMDEPMGCYDDIEEADAFVLWGSNM-A
NAPA_RALEH      GMFGSGQWTVWEGYAAAKLRSNNIDPNARHCMASAAAGFMRTFGMDEPMGCYDDFEAADAFVLWGSNM-A
TORZ_ECOL6      FAGSYGWRS------------------SGVLHKAQTLLQRYMNLAGGYSGHSGDYENSQVVVLWGMNPEQ
NAPA_LEPCP      GMFGSGQWTVWEGYAAAKLWKAGFRSNNNARHCMASAVTGFMFGIDEPMGCYDDIEQSDAFVLWGSNM-A
NAPA_BRAJA      AMFGSGQWTIWEGYAASKLRTNNIDPNARHCMASAVAGMMRTFGIDEPPGCYDDIEATDAFVLWGSNM-A
NAPA_ACTPJ      GMFSSGQTT-IFEGYAKVLRSNTIDPNARHCMASAAVAFMRTFGMDEPMGCYNDIEKTDAFVLWGSNM-A
NAPA_ACTP7      GMFSSGQTT-IFEGYAKVLRSNTIDPNARHCMASAAVAFMRTFGMDEPMGCYNDIEKTDAFVLWGSNM-A
NAPA_ACTP2      GMFSSGQTT-IFEGYAKVLRSNTIDPNARHCMASAAVAFMRTFGMDEPMGCYNDIEKTDAFVLWGSNM-A
DMSA_RHOSH      FGGSYGHNCQVLMRRALNLAGGFVNSSGDYSTAAAQIIMPHVMGTL------EVYEQQTAWPVVVENTDL
TORZ_ECOLI      FAGSYGWRS------------------SGVLHKAQTLLQRYMNLAGGYSGHSGDYENSQVVVLWGMNPEQ
TORZ_ECO57      FAGSYGWRS------------------SGVLHKAQTLLQRYMNLAGGYSGHSGDYENSQVVVLWGMNPEQ
NAPA_NITSB      AFFGSGQYTVMEGYAAAKLMKAGFRSNNNARHCMASAVAGFIFGIDEPAGCYDDIELTDTIVLWGSNM--
NARG_ECOLI      AFSPIPAMSMVSARYLSLIGGTCLSFYDWYCDLPPASPQTWGEQTDVPESAD--WYNSSYIIAWGSNVQT
NAPA_HAEPS      GFT--SGQSTIFEGVAKSLRSNNIDPNARHCMASAAVAFMRTFGMDEPMGCYDDIEKADAFVLWGSNM-A
NAPA_BORPD      AMFGSGQWTIWEGYAASKLYKAGFRSNNNARHCMASAVVGFMFGIDEPMGCYDDIEHADAFVLWGSNM-A
NAPA_EDWI9      GMFGSGQWTVWEGYAAAKLFKAGFRSNNNARHCMASAVVGFMFGMDEPMGCYDDIEQADAFVLWGSNM-A
NARZ_ECOLI      AFSPIPAMS----MVSYAAGTRYLSLLGGTCYCDLPPASPMTWGEQTDVPESADWYNSSYIIAWGSNVQT
NARB_SHEFN      ALYLSGQLLTEDYYVANFLKTANVDTNSRLCMSSAVSAMQRAFGEDVVPGCYDDLEQADVIVLVGAN--T
NAPA_CAMFF      GYTIQEGYA-ISKLIKGGFRSHNIDPNARHCMASAVVGFMQTFGIDEPAGCYDDIELTDTIVTWGANM--
NAPA_HELHP      AYTIQEGYA-AVKLVKGGFRSNNIDPNARHCMASAVVGFMETFGIDEPAGCYDDIELTDTIVTWGANM-A
NAPA_SHEHH      GMFGSGQWTVWEGYAASKLHTNNIDPNARHCMASAVGGFMRTFGIDEPMGCYDDLEAADQFVLWGANM-A
TORA_SALTY      LLTASGWQSTGMFHNASGMLARAIALHGNSVSTAAQVILPRVVGSMEVYEQQTSWQNSKTIVLWGSDMDV
TORA_SALTI      LLTASGWQSTGMFHNASGMLARAIALHGNSVSTAAQVILPRVVGSMEVYEQQTSWQNSKTIVLWGSDMDV
NAPA_RALPJ      GMFGSGQWTVFEGYAAAGFRSNNLDPNARHCMASAVAGFMRTFGMDEPMGCYDDFEVADAFVLWGSNM-A
NAPA_CAMJR      GYTIQEGYA-ALKLAKAGFRTNNIDPNARHCMASAVVGFMQTFGVDEPSGCYDDIELTDTIITWGANM--
NAPA_CAMJJ      GYTIQEGYA-ALKLAKAGFRTNNIDPNARHCMASAVVGFMQTFGVDEPSGCYDDIELTDTIITWGANM--
NAPA_CAMJE      GYTIQEGYA-ALKLAKAGFRTNNIDPNARHCMASAVVGFMQTFGVDEPSGCYDDIELTDTIITWGANM--
NAPA_CAMJ8      GYTIQEGYA-ALKLAKAGFRTNNIDPNARHCMASAVVGFMQTFGVDEPSGCYDDIELTDTIITWGANM--
NAPA_CAMLR      GIFASGQYTIQEGYAAAKLRSNNIDPNARHCMASAVVGFMQTFGVDEPSGCYDDIELTDTIITWGANM--
NAPA_NAUPA      A---------------------------------------------------------------------
NAPA_WOLSU      GVFGSGQYTIQEGYMAAKLRSNNLDPNARHCMASAVAAFMETFGIDEPAGCYDDIELTDTIITWGANM--
NAPA_CAMHC      AYTIQEGYA-AAKLVKAGFRSNNIDPNARHCMASAVVGFMQVFGIDEPSGCFDDIELTDTIVTWGANM--
TORZ_HAEIN      FAGSYGWFSCGSLHASRTLATGGFVGHKGDYSTAAQVIMPHVLGTEQQTSWESILESSDIIVLWSANMST


                         .         .         .         +         .         .         .:280
query           AMGHIRRLTVAREKGXXXXXXDPRAPNLAYSSVEWIPINPGTDAAFVLSLIYVIISEGLYDAAFLKKYTN
PHSA_SALTY      EVADTHELMTAQEKGAKMVSFDPRLSIFSSKADEWHAIRPGGDLAVLLAMCHVMIDEQLYDASFVERYTS
YNFE_ECOLI      RMGITYLLEKAREKNAKMIVIDPRYTDTAAGEDEWLPIRPGTDAALVAGIAWVLINENLVDQPFLDKYC-
YNFF_ECOLI      RMGVTYYVEQARERNARMIVIDPRYNDTAAGEDEWLPIRPGTDGALACAIAWVLITENMVDQPFLDKYC-
DMSA_HAEIN      TRMSGGGLTYCIEQNAKMIIIDPRYNDTAGREDEWIPIRPGTDAALVAALAYVMIQENLVDQPFLDKY--
PSRA_WOLSU      VISYVRQYMEAIENGAKVVTLEPRLSVMAQKASEWHAIKPGHDLPFVLGFMHTLIFENLYDKKFVQKYCT
DMSA_ECOLI      GGGVTYYLEQARQKNARMIIIDPRYTDTAGREDEWIPIRPGTDAALVNGLAYVMITENLVDQAFLDKYC-
DDHA_RHOSU      RIPDAHFLWEAKWNGARVVSVAPDYNPSSIHSDLWMPIKQGADPFLAMSMVNVIIEGKLYNEAFMKEQTD
SERA_THASE      RIPDAHFLTEARYNGARLVNISPDYNPSSVHADLHLPVTTGTDSHLAAAIVNVLIADKKYKADYLKEQTD
CLRA_IDEDE      RIPDAHFLMEARYNGARLVNISADYNPSSIHSDLFVPVTSGTDSHLAAALVNVLIAGKHYKADYLKEQTA
YOAE_BACSU      VSTNMHQITIARKKGAKIVVIDVHKNQTGRLADWFIPIKPGTDSALALGIMHILFKENLHDEAFLSEYT-
NAPA_DESDA      AHPVLFRRIARREPGVKIIVADPRRTNTSRIADMHVAFRPGTDLAFMHSMAWVIINEELDNPRFWQRYVN
NAPA_SYMTH      AHPIISRITTRKQTGKDVKVIDPRRHRVADIADIFLPFRPGTDLALLNAFAQVIIEEGLHDPDFIERHTT
FDHL_STAAB      AHPVIASRMKRAQKGQKIHVFDIRKHEMAERADRFYQPKPGTDLAWLSAVTKYIIDHDLHDKAFIEEW--
FDHL_STAAW      AHPVIASRMKRAQKGQKIHVFDIRKHEMAERADRFYQPKPGTDLAWLSAVTKYIIDHDLHDKAFIDEWVD
FDHL_STAAS      AHPVIASRMKRAQKGQKIHVFDIRKHEMAERADRFYQPKPGTDLAWLSAVTKYIIDHDLHDKAFIDEWVD
FDHL_STAAN      AHPVIASRMKRAQKGQKIHVFDIRKHEMAERADRFYQPKPGTDLAWLSAVTKYIIDHDLHDKAFIDEWVD
FDHL_STAAM      AHPVIASRMKRAQKGQKIHVFDIRKHEMAERADRFYQPKPGTDLAWLSAVTKYIIDHDLHDKAFIDEWVD
TORA_PASMU      AYKYLEQLKAVAAKDVNVICVDPKSKTQNYLGCDFQYINPQTDVAFMLALAHTLYVENLYDKKFIEMYTV
FDHL_STAAR      AHPVIASRMKRAQKGQKIHVFDIRKHEMAERADRFYQPKPGTDLAWLSAVTKYIIDHDLHDKAFIEEW--
FDHA_METJA      QHPLIRRIMRAKDKGAKIIVIDPRRTITAKNSDIYLQIIPGTNVALINAMINVIIKENLIDKEFIKNRT-
FDOG_ECOLI      AVGFRWAMEAKIHNGAKLIVIDPRFTRTAAVADYYAPIRSGTDIAFLSGVLLYLLNNEKFNREYTEAYTN
FDHL_STAAC      AHPVIASRMKRAQKGQKIHVFDIRKHEMAERADRFYQPKPGTDLAWLSAVTKYIIDHDLHDKAFIDEWVD
FDHL_STAA8      AHPVIASRMKRAQKGQKIHVFDIRKHEMAERADRFYQPKPGTDLAWLSAVTKYIIDHDLHDKAFIDEWVD
FDHL_STAA3      AHPVIASRMKRAQKGQKIHVFDIRKHEMAERADRFYQPKPGTDLAWLSAVTKYIIDHDLHDKAFIDEWVD
TORA_VIBPA      SFKYLAELKEKVAKGEINVLSDPKNKTQRYLENDHLYINPMTDVAFMLAVAHVLYNENLYDKKFIDTY--
NAPA_VIBHB      EMHPVRRLSHPHVKVNVLSTYYHRSFELADHGYIF---NPQSDLAIANFIANYIIENDAVNWDFVNKHTN
FDHA_METFO      HPLVGRKLMRAKMNGAYFIVADPRYTPTAKQADQYIPFKTGTDVALMNAMMNVIISEGLEDKEFIEKRT-
FDHL_STAS1      AHPVIASRIKRGHKNNTLNVFDIRKHEMAERADNFYQPKPGTDLVWLSAVTKYIIDEDLHDKAFINEWVN
NAPA_SACD2      EMHPIRRLSYPHVQVAVMSTYEHRSFDLADLGVVF---TPQSDLAIANFIANYIIQNKKVNWDFVKKHTN
FDHF_ECOLI      HPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRT-
BISC_ECOLI      EQG-LSYFSALRDSGKKLICIDPRSETVDFDKMEWVAPHMGTDVALMLGIAHTLVENGWHDEAFLARCT-
NAPA_PSYIN      EMHPIRRLSNPDVSVHVLSTYTHRSFELADNGMIF---TPQSDLAILNFIANYIIQNDAVDKDFIEKHTN
FDNG_ECOLI      AVGFRWAMEAKNNNDATLIVVDPRFTRTASVADIYAPIRSGTDITFLSGVLRYLIENNKINAEYVKHYTN
FDXG_HAEIN      HPVGFRWAIEAKKNGAKIIVIDPRFNRTASVADLHAPIRSGSDITFLMGVIRYLLETNQIQHEYVKHYTN
TORA_VIBVY      SYAYLAQLKEKVAKGEINVISDPKNKTQRYLENDHLYVNPMTDVPFMLAIAHVLYTENLYDKKFIETY--
TORA_VIBVU      SYAYLAQLKEKVAKGEINVISDPKNKTQRYLENDHLYVNPMTDVPFMLAIAHVLYTENLYDKKFIETY--
NAPA_RHIME      EMHPIRRLGHEHVKVAVLSTFTHRSMDLAD-----IPIKPGTDLAILNYIANHIIQTGRVNEDFVRKHTD
NAPA_BORPA      EMHPIRRLSAPATKVAVLSTFEHRSYELADLT---LTFEPQSDLAILNYIANHIIRTKRVNRDFVDKHT-
NAPA_BORBR      EMHPIRRLSAPATKVAVLSTFEHRSYELADLT---LTFEPQSDLAILNYIANHIIRTKRVNRDFVDKHT-
TORA_ECOLI      YEYYAQLKAKVAAGEIEVISIDPVVTSLGREHVKHIAVNPQTDVPLQLALAHTLYSENLYDKNFLANYCV
TORA_ECO57      YEYYAQLKAKVAAGEIEVISIDPVVTSLGREHVKHIAVNPQTDVPLQLALAHTLYSENLYDKNFLANYCV
NAPA_VIBPA      EMHPVRRLSHPHVRVNVLSTYYHRSFELADHGYIF---NPQSDLAIANFIANYIIENDAVNWDFVNKHTN
BISC_RHOSH      EAGYLRRIV---ERGVRVILVSPLKDDLPWVAAEWWPIRPNTDTALMLGLAGEIVRSGRQDSDFLARCTS
TORA_ECOL6      AAGEIEVISI-----------DPVVTSLGREHVKHIAVNPQTDVPLQLALAHTLYSENLYDKNFLANYCV
NAPA_VIBSL      EMHPVRRLSHPHVKVNVLSTYYHRSFELADTGYIF---EPQSDLAIANFIANYIIQNDAVNWEFVNKHTN
NAPA1_PHOPR     EMHPVRRLSHPHVKVNVLSTYYHRSFELADNGMIF---EPQTDLAIANFIANYIIQNDAVNWDFVTKHTH
NAPA_VIBFM      EMHPVRRLSHPHVKVNVLSTYYHRSFELADKGYIF---EPQSDLAIANFIANYIIQNNAVNWDFVNKHTN
NAPA_VIBF1      EMHPVRRLSHPHVKVNVLSTYYHRSFELADKGYIF---EPQSDLAIANFIANYIIQNNAVNWDFVNKHTN
NAPA_METS4      EMHPIRRLSAPHVRIATLSTYEHRTTELSDQS---LIFQPGTDLAILNFVANYIIQNGAVNRDFVERHVN
TORZ_HAEIN      ----------------------------------------------------------------------
NAPA_COLP3      EMHPIRRLSAPHVKVAVLSTFEHRSFDLADNGMIF---TPQTDLAILNYIANYIIQTGRVNKDFVSKHTN
FDHL_STAHJ      AHPVIASRMKRAQKGQKMHVFDIRKHEMAARADAFYQPKPGTDLVWLGAATKYIIDNDLHDKAFLNDWVD
NAPA_DINSH      EMHPITRLTKPGSEVHVLSTYEHRSFELADNGMVFAP---QTDLAILNYIANYIISTGRVNEDFMSKHVN
NAPA_PSEU5      EMHPVRRLSAPHVKVAVMSTFEHRSFELA--DIPMI-FNPQTDLVILNYIANHIIQSGAVNKEFIDKHTR
NAPA_PSEST      EMHPVRRLSAPHVKVAVMSTFEHRSFELA--DIPMI-FNPQTDLVILNYIANHIIQSGAVNKEFIDKHTR
NAPA_PSEAE      EMHPVRRLSAPQVKVAVLSTFEHRSFELADLPMVF---KPQTDLIILNYIANHIIESGAVNRDFVERHVR
NAPA_AERHH      EMHPIRRLSHQDVQVHVLSTFEHRSFELADNGMVF---TPQTDLAILNYIANYIIQNDKVNWEFVNKHTQ
FDHA_DESGI      AENHFKWVMRAKDKGATLIHVDPRYTRTSTKCDLYAPLRSGSDIAFLNGMTKYILEKELYFKDYVVNYTN
NAPA_PSEAB      EMHPVRRLSAPQVKVAVLSTFEHRSFELADLPMVF---KPQTDLIILNYIANHIIESGAVNRDFVERHVR
NAPA_VIBVU      EMHPVRRLSHPHVKVNVLSTYYHRSFELADSGYIF---KPQSDLAIANFIANYIIQNDAVNWDFVNKHTN
NAPA_BURXL      MHPILRRLSTPTTRVVVLSTFEHRSFDLADQTIIF---TPQSDLAILNYIANYIIRNGNVNRDFVNRHT-
YYAE_BACSU      TNMHLHHLQQVKKKGATITVIDPIFNPTAKLADRYISVKPGMDGWLAAAVLKVLIEMGRTDETFISEHS-
NAPA_VIBVY      EMHPVRRLSHPHVKVNVLSTYYHRSFELADSGYIF---KPQSDLAIANFIANYIIQNDAVNWDFVNKHTN
NAPA_PSEA8      EMHPVRRLSAPQVKVAVLSTFEHRSFELADLPMVF---KPQTDLIILNYIANHIIESGAVNRDFVERHVR
NAPA_MAGSA      EMHPIRRLTHEGCKVAVLSTFEHRSFELADIPMVF---TPQTDLAILNYICHYIISKNAYDKDFIEKHVN
NAPA_AGRT5      EMHPILWTRIADRRLGFDHVRVAVLSTFTHRSMDLADIKPGTDLVILNYIANHIIKTGRVNEDFVRNHTK
NAPA_PSEMY      EMHPIRRLSHPNTRVAVLSTFEHRSFDLAD-----IPLKPQTDLLILNYIANHIIESGAVNKDFVGKHTK
FDHL_BACSU      AEGHTRVKRAHKLHGQKLIVADLRKNEMAERSDLFISPKQGTDQVWLMAVTKYMIDQGWHDQAFIDENVN
NASC_BACSU      CQPTIMPFEKAKENGAYFIAIDPRETATTKIADLHLKIKPGTDAALANGLVKIIIDEQLINEDFIQSRTN
NAPA_PSEA7      EMHPVRRLSAPQVKVAVLSTFEHRSFELADIPMVF---KPQTDLIILNYIANHIIESGAVNRDFVERHVR
NAPA_BRASB      EMHPIRRLSAPHVKVAVLSTFEHRSFDLADIGMVF---KPQTDLYLLNAIANHIIKTGRVNKDFVQAHT-
NASA_KLEOX      AWAHYQRLAQAKRDNMRVVVIDPRRTATCDIADRHLALAPGSDGGLFVGLLNAIAASG------------
NAPA_RALEJ      EMHPIRRLSHPKTRVAVLSTFTHRSFDLAD-----IPITPQTDLAMLNYIANYIIQNNKVNKDFVNKHT-
NAPA_HAES2      -MAEMHPILWSRISDRRLANPDTVSVNVLHRSFELILLKPQSDLAILNYIANYLIENNAINREFIEKHTK
NAPA_PASMU      EMHPIRRLSHPDVKVAVLSTFEHRSFELADLGVIF---TPQSDLAIMNYIANYLIQHDAIDHDFIQKHTK
NAPA_PARPN      EMHPIRRLGHPHVKVAVLSTFTHRSSDLAD-----IPIKPGTDLAILNYIANHIIQTGRVNRDFVDRHTT
NAPA_HAES1      -MAEMHPILWSRISDRRLANPDTVSVNVLHRSFELILLKPQSDLAILNYIANYLIENNAINREFIEKHTK
NAPA2_PHOPR     EMHPIRRLSVPGVKVSVLSTFEHRSFELAD-----IPITPQSDLAILNFIANYIITNDKVNKDFTSKHVN
NAPA_MAGMG      EMHPIRRLTHEGCKVAVLSTFEHRSFELADIPMVF---TPQTDLAILNYICHYIISKNAYNKEFIDKHVN
NAPA_BRASO      EMHPIRRLSAPHVKVAVLSTFEHRSFDLADVGMVF---KPQTDLYILNAIANHIISTGRVNKDFVSAHT-
NARG_BACSU      TRTDAHFLAEARYKGAKVISISPDFAESSKFADDWLSIRQGTDGALAMAMGHVILQEFYVNIEYAKQYTD
NARB_SYNE7      CHPILFNRYRKRHKGTNLIVVDPRCTPTAEVADLHLALKPGSDVALLNGLGWLLYQMGYVKKDFIANQT-
NAPA_CUPTR      EMHPIRRLSHPKTRVAVLSTFTHRSFDLADIPVIF---KPQTDLAMMNYIAHYIIXXXXXHTVFKEGVTN
TORA_SHEMA      ----------------------------------------------------------------------
NAPA_ACTAC      EMHPIRRLSNQDVKVAVLSTFEHRSFELAYSLI----FKPHTDLVXXXXXXXXXXQNDAINRDFVNKHTD
TORA_VIBCH      SFGYLDQLKEKVAKGEINVVSDPKNKTQRFLQNDHLYINPQTDVAFMLALAHVLYTENLYDKKFIETY--
TORA_SHEON      ----------------------------------------------------------------------
NAPA_AERS4      EMHPIRRLSNPDVQVHVLSTFEHRSFELADNGMVF---TPQTDLAILNYVANYIIQNDKVNWEFVNKHTQ
NAPA_SHEON      EMHPIRRLSSKDCRVHVLSTFENRSFDLADNPMVF---HPQSDLVILNYIANYIIQNKAVNTDFVTKHTK
NAPA_LARHH      EMHPIRRLTHPDCQVHVLSTYEHRSFELADNK---LVFGPQTDLAILNYIANHIIQTGAVNKDFIQKYC-
NAPA_RHOS4      EMHPIRRLSHEHVRVAVLSTFTHRSMDLADTP---IIFRPGTDLAILNYIAHHIISTGRVNRDFVDRHTN
NAPA_SHEDO      EMHPIRRLSAPHVKVAVLSTFEHRSFDLADLPMVF---HPQTDLAILNFIANYIIQNNKVNWDFVNKHVN
NAPA_VIBCM      EMHPVRRLSHPHVKVNVLSTYYHRSFELADHGYIF---HPQSDLAIANFIANYIIQNDAVNWDFVNKHTH
NAPA_VIBCH      EMHPVRRLSHPHVKVNVLSTYYHRSFELADHGYIF---HPQSDLAIANFIANYIIQNDAVNWDFVNKHTH
NAPA_VIBC3      EMHPVRRLSHPHVKVNVLSTYYHRSFELADHGYIF---HPQSDLAIANFIANYIIQNDAVNWDFVNKHTH
YJGC_BACSU      SHPVLSRIKRAHKRGQKVIVADIRKHEMAERSDLFVQPRAGSDIVWLNAIAKYLIENGKADERFLRERVN
DMSA_RHOCA      MVGAYPGLEALKAKGTKVIVIDPRTKTVEFFGADHVTPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
NARB_SYNY3      HPIIFNRLRKHHKQNPHVKLIDPRCTATAEVADLHLAINPGSDITLLHGIAYLLKKWNLIDQKFIDNHT-
NAPA_YERE8      EMHPIRRLTNEHVRIAVLSTFEHRSFELADNPIVF---TPQTDLVXXXXXXXXXXXXXXVDQGFLDRHVN
NAPA_RALEH      EMHPIRRLSHPKTRVVVLSTFTHRCFDLADIG---IIFKPQTDLAMLNYIANYIIRNNKVNKDFVNKHT-
TORZ_ECOL6      GLEYFHQL---KKSGKPVIAIDPRSETIEFDNATWIAPNMGTDVALMLGIAHTLMTQGKHDKVFLEKYT-
NAPA_LEPCP      EMHPIRRLSNPHVKVAVLSTYEHRSFDLADQAMIF---KPQTDLAILNYIANYIITNKKVNTEFVKKNIN
NAPA_BRAJA      EMHPIRRLSAPHVRVAVLSTFEHRSFDLADIGMVF---KPQTDLYLLNAIANHIIKTGRVNKDFVAAHTD
NAPA_ACTPJ      EMHPIRRLSDDKVKVVVMSTFEHRSFELADTPIIF---KPHSDLAILNYIANYIIQNDKVNWDFVNKHTD
NAPA_ACTP7      EMHPIRRLSDDKVKVVVMSTFEHRSFELADTPIIF---KPHSDLAILNYIANYIIQNDKVNWDFVNKHTD
NAPA_ACTP2      EMHPIRRLSDDKVKVVVMSTFEHRSFELADTPIIF---KPHSDLAILNYIANYIIQNDKVNWDFVNKHTD
DMSA_RHOSH      MVGAYAGMKALKEKGTRVICINPRTETADYFGADVVSPRPQTDVALMLGMAHTLYSEDLHDKDFLENCTT
TORZ_ECOLI      GLEYFHQL---KKSGKPVIAIDPRSETIEFDNATWIAPNMGTDVALMLGIAHTLMTQGKHDKVFLEKYT-
TORZ_ECO57      GLEYFHQL---KKSGKPVIAIDPRSETIEFFNATWIAPNMGTDVALMLGIAHTLMTQGKHDKVFLEKYT-
NAPA_NITSB      ----------------------------------------------------------------------
NARG_ECOLI      RTPDAHFFTEVRYKGTKTVAVTPDYAEIAKLCDLWLAPKQGTDAAMALAMGHVMLRESQYFTDYVRRYTD
NAPA_HAEPS      EMHPIRRLSKQDAKVAVLSTFEHRSFELADLPIVF---KPQGDLAIMNYIANYLIQNNAIDQDFIQKHTK
NAPA_BORPD      EMHPIRRLTHAGSEVHVLSTFEHRSFELADNGMIFV---PQTDLAILNYLCNYLIQNGRVNREFVEQHVN
NAPA_EDWI9      EMHPIRRLSNDKVQVAVLSTFEQRSFELADNPIIF---TPQSDLVXXXXXXXXXXXXXXVDQAFMDKHVN
NARZ_ECOLI      RTPDAHFFTEVRYKGTKTIAITPDYSEVAKLCDQWLAPKQGTDSALAMAMGHVILKESDYFINYCRRYSD
NARB_SHEFN      AWTHQRILAAIKANNAQLVVIDPLSTATAKQADLHLAIKPGADLTLFHGLLGYLADQNRVDHAYIAAHT-
NAPA_CAMFF      ----------------------------------------------------------------------
NAPA_HELHP      EMHPVRKLSSSNVKVINLSTYTNRTSDLA--DIE-IIFKPHTDLAIWNFLAREIINRNAVDEAFVKE---
NAPA_SHEHH      EMHPIRRLSSPTSRVHVLSTYENRSFDLADNAMVF---RPQSDLVILNYVANYIIQNDAVNKDFVNKHTK
TORA_SALTY      YQYYEQLKEKVASGAISVISIDPVVTSLGRDKVKHIAINPQTDVPLQLALAHTLYSEKLYDKNFLDNYCV
TORA_SALTI      YQYYEQLKEKVASGAISVISIDPVVTSLGRDKVKHIAINPQTDVPLQLALAHTLYSEKLYDKNFLDNYCV
NAPA_RALPJ      EMHPIRRLSAPKTKVAVLSTFTHRSFDLAD-----IPITPQADLAMLNYIANYIITNKKVNTDFVNKHTD
NAPA_CAMJR      ----------------------------------------------------------------------
NAPA_CAMJJ      ----------------------------------------------------------------------
NAPA_CAMJE      ----------------------------------------------------------------------
NAPA_CAMJ8      ----------------------------------------------------------------------
NAPA_CAMLR      ----------------------------------------------------------------------
NAPA_NAUPA      ----------------------------------------------------------------------
NAPA_WOLSU      ----------------------------------------------------------------------
NAPA_CAMHC      ----------------------------------------------------------------------
TORZ_HAEIN      DQKGIEYFKKFQASGKRIICIDPKSETCQMLNAEWIPVNTATDVPLMLGIAHTLVEQGKHDKDFLKKYTS


                         .         *         .         .         .         .         +:350
query           APFLIKPDGQPLTQKDLGQEGTAYLVYDNAAKSLAPHDKAQDPALDYEGEVQTPAGVIKVKTAFRLLAER
PHSA_SALTY      -----------------GFEQLA-----QAVKETTPEWAA--------AQADVPADVI-----VRVTREL
YNFE_ECOLI      ----------------VGYD-------EKTLPADAPKNGHYKAYILGEGD------------------DK
YNFF_ECOLI      ----------------VGYD-------EKTLPANAPRNAHYKAYILGEG----PDGIAK-----------
DMSA_HAEIN      ---CVGYDEKTL-PTDAPKNG---------------HYKAY--ILGYGND-----GIAK-----------
PSRA_WOLSU      GFEELKASIEPCTPEKMAL------------------------------ECDIPADTIK------RLARE
DMSA_ECOLI      ----------------VGYD-------EKTLPASAPKNGHYKAYILGEG----PDGVAK-----------
DDHA_RHOSU      LPILVRSDGMLLREADLEEGGSDQVFYHKVKGSMGSEEKTVDPALEGSFEV----GGIPVTTVFEKVRAE
SERA_THASE      LPFLVRTDGKFLREKDFNKDGSVFYIWDSAPGSMGSKDKAVEPAL----EGTFDANGIEVTTVFARLKAE
CLRA_IDEDE      LPFLVRTDGKFLREKDFKADGSVFYVWDTAPGSMGSKDKTLDPAL--EGNFETHG--IKVTTVFERLKAE
YOAE_BACSU      ----------------VGYE------------ELREHVKQYDP---------------------------
NAPA_DESDA      ---FMDAEGKP---------------------------------SDFEG--------------YKAFLE-
NAPA_SYMTH      F-----------------QDGNGAITFEQYVAFL------QD----------------------------
FDHL_STAAB      ----------------------------------------------------------------------
FDHL_STAAW      ----------------------------------------------------------------------
FDHL_STAAS      ----------------------------------------------------------------------
FDHL_STAAN      ----------------------------------------------------------------------
FDHL_STAAM      ----------------------------------------------------------------------
TORA_PASMU      GFEKFLP----------------YLLGESEDK------------------------VVKD-------AEW
FDHL_STAAR      ----------------------------------------------------------------------
FDHA_METJA      ----------------------------------------------------------------------
FDOG_ECOLI      ASLIVR--------EDYGFEDGLFTGYDAEKRK---YDKSSTYELDENGFAKRDTTLQHPRCVWNLLKQH
FDHL_STAAC      ----------------------------------------------------------------------
FDHL_STAA8      ----------------------------------------------------------------------
FDHL_STAA3      ----------------------------------------------------------------------
TORA_VIBPA      -------------------------------------------CLGFEEFIQYVQGKTKDKV--------
NAPA_VIBHB      -----------FTQADT-----------DIGYGLRDDDPLQKAA-------KNPNSGKLTSISFEEYKKS
FDHA_METFO      ----------------------------------------------------------------------
FDHL_STAS1      H-------------------------FDEYYKSLAP----------------------------------
NAPA_SACD2      F-----------------RVGTTDIGY-----GLRPEHPLQKAAKNADS-----AGASE-PIDFETYAKF
FDHF_ECOLI      ----------------------------------------------------------------------
BISC_ECOLI      ---------------------TGYAVF--ASYLLGESD-----------------GIAK-----------
NAPA_PSYIN      F-----------------RKGVTDIGY-----GLRPTDPLQKAAENPDSGASSP-------ITFEEFAEY
FDNG_ECOLI      ASLLVR--------DDFAFEDGLFSGYDAEKRQ---YDKSSNYQLDENGYAKRDETLTHPRCVWNLLKEH
FDXG_HAEIN      ASFLI--------DEGFKFEDGLFVGYNEEKRN---YDKSKNYQFDENGHAKRDMTLQHPRCVINILKEH
TORA_VIBVY      -------------------------------------------CLGFEEFINYVQGKTKDKV--------
TORA_VIBVU      -------------------------------------------CLGFEEFINYVQGKTKDKV--------
NAPA_RHIME      IGYGLRPD-NPLEVKAVNAKDAA---------KMTPSD-------------------------FESFKSF
NAPA_BORPA      ----------------VFREGNADIGY-----GLRPEHPLQQAARN-----AGDAGGSKPIT-FDDFARF
NAPA_BORBR      ----------------VFREGNADIGY-----GLRPEHPLQQAARN-----AGDAGGSKPIT-FDDFARF
TORA_ECOLI      GPYLLEKDGQP-----------------------------------------------------------
TORA_ECO57      GPYLLEKDGQP-----------------------------------------------------------
NAPA_VIBPA      -----------FTQADT-----------DIGYGLRDDDPLQKAA-------KNPNSGKLTSISFEEYKKS
BISC_RHOSH      GSEL-------------------YLAYLRGEGDGRPKD--------------------------------
TORA_ECOL6      GPYLLEKDGQP-----------------------------------------------------------
NAPA_VIBSL      FKQATTDIGYGLRDNDPLQKAAAN---PNSGKMTDISFE------DYKASV-------------------
NAPA1_PHOPR     FK---------RAETDIGYG----LRDDNPLQMKAKHPNALHP-MDFE---QYKASV-------------
NAPA_VIBFM      --------------------------FKQATTDIGYGLRDDDPI---QMEAANPNSGAMSSISFEEYKKS
NAPA_VIBF1      --------------------------FKQATTDIGYGLRDDDPL---QMEAANPNSGAMSSISFEEYKKS
NAPA_METS4      F---------RVANTDIGYG----LRPEHVLEQRATHAN--------EAAVSQPSN-------FDAYARM
TORZ_HAEIN      ----------------------------------------------------------------------
NAPA_COLP3      FR--------------LGETDIGY--------GLRPEHPLEQKAKN-NGKTKGSSTPID----FDEYAKF
FDHL_STAHJ      ----------------------------------------------------------------------
NAPA_DINSH      IT---------KTATDIG-----YGLRDEHA---------------LQQEAENPNSGKLEPISFDEYAAS
NAPA_PSEU5      FAKGATNIGYGLRPTD-----PLELKAENAAVANTWTD------IGYEDYV-----------------EF
NAPA_PSEST      FAKGATNIGYGLRPTD-----PLELKAENAAVANTWTD------IGYEDYV-----------------EF
NAPA_PSEAE      FAH--------------GAEDIGY--------GLRPDDPLEKKAKNAD-KANTWSDI-----DFKAFAEF
NAPA_AERHH      F-----------------RKGVTDIGY-----GLRPTNPLQQKAKNPDSGDSTPM-------SFDDFAKF
FDHA_DESGI      ASFIV-------------GEGFAFELFAGYNKETRKYDKSKGFERDENGNPKRDETLKHPRCVFQIMKKH
NAPA_PSEAB      FAH--------------GAEDIGY--------GLRPDDPLEKKAKNAD-KANTWSDI-----DFKAFAEF
NAPA_VIBVU      --------------------------FKQATTDIGYGLRDDDPL---QKQAKNPNSGNMTSISFEEYKKS
NAPA_BURXL      ----------------VFKQGNADIGY-----GLRPDNPLQKTARN----AGDPNGSQPI--TFDEFAKF
YYAE_BACSU      ----------------------------------------------------------------------
NAPA_VIBVY      --------------------------FKQATTDIGYGLRDDDPL---QKQAKNPNSGNMTSISFEEYKKS
NAPA_PSEA8      FAH--------------GAEDIGY--------GLRPDDPLEKKAKNAD-KANTWSDI-----DFKAFAEF
NAPA_MAGSA      FK-------KGATDIGYGLRPTHALEKDQA--NAATPDKSDPMTFD----------------EFKAF---
NAPA_AGRT5      FVRGVTDIGYGLRPDD--------PVEVNAANSA---DPTKTEAIDFE-----------------TFKEF
NAPA_PSEMY      --FARGAD-------DIGYGLRADNPLEMQAKNAAKANTWED-------------------MSFEQFAAF
FDHL_BACSU      ----------------------------------------------------------------------
NASC_BACSU      GFEELKQHTDSLDLNDIAEQTSVSLV--------------------------------------------
NAPA_PSEA7      FAH--------------GAEDIGY--------GLRPDDPLEKKAKNAD-KANTWSDI-----DFNAFAEF
NAPA_BRASB      ----VFKKGQT----DIGY-------------GLRPEHPLQKKA----------TGAAKANDATDISFDE
NASA_KLEOX      ----------------------------------------------------------------------
NAPA_RALEJ      ----------------VFKEGVTEIGY-----GLRPDHPLQKAAKNAANPGDSK------PITFDDFAKF
NAPA_HAES2      FK--------------RGETDIGY--------GLRP----QDPREQTAKNVKTAGKMYD--SSFEEFKKL
NAPA_PASMU      FK---------RGETDIGYGLRETHELEKAAKNVKTAGKMHD-------------------SDFEEYKKL
NAPA_PARPN      FV--------------AGATGIGYGLRDDDPREMAAR-TAEDPA------ATTP-------STFEEFAEL
NAPA_HAES1      FK--------------RGETDIGY--------GLRP----QDPREQIAKNVKTAGKMYD--SSFEEFKKL
NAPA2_PHOPR     F-----------------RRGTTDIGY-----GLRPEHPLQQAAKNPDSGDSTP-------MTFEEFKAF
NAPA_MAGMG      FK-------KGATDIGYGLRPTHALEKDQA--NAATPDKADPMTFD----------------EFKAFV--
NAPA_BRASO      ----VFKKGQT----DIGY-------------GLRPEHPLQKKA----------TGAAKANDATDISFDE
NARG_BACSU      FPFLVTTAGRFLHAKDIGRK--------------------------------------------------
NARB_SYNE7      ----------------------------------------------------------------------
NAPA_CUPTR      IGYGLRPD-HPL---------------QKAAKN------AADPGASR-------------PITFDDFARF
TORA_SHEMA      ----------------------------------------------------------------------
NAPA_ACTAC      IGYGLRPEN-PLEQK---------------AKNVKTAGKMYDSNFDE-------------------LKAL
TORA_VIBCH      ----------------------------------------------------------------------
TORA_SHEON      ----------------------------------------------------------------------
NAPA_AERS4      F-----------------RKGTTDIGY------------GLRPTHPTEARAKNPGNGDATPMSFDDFAKF
NAPA_SHEON      FA--------------LGVDDIGY---------------GLRPDHPLEKKAKNPGNGKSTPISFDEYAKF
NAPA_LARHH      --AFMKGD------TDIGYGLRPTHPKQKAAKN--PDSGKMDP------------------ITFEQFAAF
NAPA_RHOS4      F---------ALGATDIGY-------------GLRPEHQLQXXXXXXXXXXMTP-------TDFETFAAL
NAPA_SHEDO      F-----------------RKGTTDIGY-----GLRPHPTQMKSKNAATANDSTPID-------FEQFKKF
NAPA_VIBCM      FKQAVTDIGYGLRD-------------DHPLQKKAKNANSGDVS----------------DISFEEYKKS
NAPA_VIBCH      FKQAVTDIGYGLRD-------------DHPLQKKAKNANSGDVS----------------DISFEEYKKS
NAPA_VIBC3      FKQAVTDIGYGLRD-------------DHPLQKKAKNANSGDVS----------------DISFEEYKKS
YJGC_BACSU      ----------------------------------------------------------------------
DMSA_RHOCA      GPYLMETDSTPKT---------------------------------------------------------
NARB_SYNY3      ----------------------------------------------------------------------
NAPA_YERE8      FR-------RGATDIGYGLRPTHPL--EKAAKN--PGSDASEPM------------------SFDDFKAF
NAPA_RALEH      ----------------VFKEGVTDIGY-----GLRP-----DHPLQKAAKNASDPGAAKVIT-FDEFAKF
TORZ_ECOL6      ----------------------------------------------------------------------
NAPA_LEPCP      F-----------------KKGATDIGY-----GLRPGHALEKDATSYPGADGKPKGNPNDSTSFDEYAKF
NAPA_BRAJA      IGYGLRPE-HPLQKKATG-----------AAKANDSTDMSYDEYVKFVSE--------------------
NAPA_ACTPJ      IGYGLRPDHP--RQKAAKNAKTAGKMYDS----------------DFE--------------EFKKIVE-
NAPA_ACTP7      IGYGLRPDHP--RQKAAKNAKTAGKMYDS----------------DFE--------------EFKKIVE-
NAPA_ACTP2      IGYGLRPDHP--RQKAAKNAKTAGKMYDS----------------DFE--------------EFKKIVE-
DMSA_RHOSH      GFDLF----------------AAYLTGES------------------DGTPKT--------------AEW
TORZ_ECOLI      ----------------------------------------------------------------------
TORZ_ECO57      ----------------------------------------------------------------------
NAPA_NITSB      ----------------------------------------------------------------------
NARG_ECOLI      MPMLV-----------------------------------------------------------------
NAPA_HAEPS      FK--------------RGETDIGYGLRDNAAKNAKTAGKMHD-------------------SSFEEFKQL
NAPA_BORPD      F---------KVGATDIGY-------------GLRPNDPREQSATSXXXXXXXXXXXXXXXXXXXXXXXX
NAPA_EDWI9      I-----------------RKGATDIGY-----GLRPTDPLEKAAKNPGSDASEPMSFDDYK-AF------
NARZ_ECOLI      MPMLVMLEPRDDGSYVPGRMIRASDLVDGLGESNNPQWKT--VAVNTAGELVVPNGSI------------
NARB_SHEFN      ----------------------------------------------------------------------
NAPA_CAMFF      ----------------------------------------------------------------------
NAPA_HELHP      ----------------------------------------------------------------------
NAPA_SHEHH      FAL-----------------GTTDIGY------------GLRPDHPLEKKAKNPGNGKSKPISFDEYAKF
TORA_SALTY      GPYLLEKDGQP-----------------------------------------------------------
TORA_SALTI      GPYLLEKDGQP-----------------------------------------------------------
NAPA_RALPJ      IGYGLRPDNPQKAAKNADKVGDSKISFDEFAKFVSTYD------LDYTTKLANP----------------
NAPA_CAMJR      ----------------------------------------------------------------------
NAPA_CAMJJ      ----------------------------------------------------------------------
NAPA_CAMJE      ----------------------------------------------------------------------
NAPA_CAMJ8      ----------------------------------------------------------------------
NAPA_CAMLR      ----------------------------------------------------------------------
NAPA_NAUPA      ----------------------------------------------------------------------
NAPA_WOLSU      ----------------------------------------------------------------------
NAPA_CAMHC      ----------------------------------------------------------------------
TORZ_HAEIN      AKFLGKTDGQPKT---------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AAKYTPENAEKITGIPADTIRRIAREFATSRGVAEDGWYTAKNGNDFDAYRAILILNALVGNIDKRGGLC
PHSA_SALTY      AA-------------------------CAPHAIVSPGHRATFSQEEIDMRRMIFTLNVLLGNIEREGGLY
YNFE_ECOLI      TAK-TPQWASQITGIPEDRIIKLAREIGTAKAYICQGWGPQRQANGELTARAIAMLPILTGNVGISGG--
YNFF_ECOLI      ----TPEWAAKITSIPAEKIIQLAREIGSAKAYICQGWGPQRHSNGEQTSRAIAMLSVLTXXXXXXXXXX
DMSA_HAEIN      ----TPEWAAKITGIPAERIIKLAREISTKPAFISQGWGPQRRSNGELISRAIAMLPILTGNVGIHGG--
PSRA_WOLSU      FAKAAP------------------------KAIFDFGHRVTFTPQELELRRAMMMVNALVGNIERDGGMY
DMSA_ECOLI      ----TPEWASQITGVPADKIIKLAREISTKPAFISQGWGPQRHANGEIATRAISMLAILTGNVGINGGNS
DDHA_RHOSU      AAKYPPEETAAITGIGPGVVRAEAETFAAKKALLMTGFNIGRYSNGIYTSWALTLMLALTGHGGRTGGLA
SERA_THASE      IAPYTPEATHKTTGIHPSVVRQLAGWIGDCKALRIDGYNNQKHFDGFQCGRLILILNKALGGVKGRPGRS
CLRA_IDEDE      ITPYTPEATQATTGVHPSVVRQLAGWIAECKALILDGYNNQKHFDGFQCGRLKILILTLIGHHGTTGSI-
YOAE_BACSU      ------EKVSTITGVSTEDIYRLAKMYGTSPSFIRIGNGPQHHDNGGMIVRTIACLPAITGQWLHTGGGA
NAPA_DESDA      --NYRPEKVAEICRVPVEQIYGAARAFAES-AATMSLWCMGINQRVQGVFANNLILHLITGQICRPGATS
NAPA_SYMTH      ---YTPEKVAPITGLSPDDXXXXXXXXXXXXXKTMTLWCMGINQRTVGTWNAIYNLHLLTGKICQPGNSP
FDHL_STAAB      ----------------------------------------------------------------------
FDHL_STAAW      ----------------------------------------------------------------------
FDHL_STAAS      ----------------------------------------------------------------------
FDHL_STAAN      ----------------------------------------------------------------------
FDHL_STAAM      ----------------------------------------------------------------------
TORA_PASMU      AAK--------ICAIQAEDIRQFARMLAGKRTQLIFGWAIQRQQHGEQPYWMGTVLAAMLGQIGLAGGAH
FDHL_STAAR      ----------------------------------------------------------------------
FDHA_METJA      ----------------------------------------------------------------------
FDOG_ECOLI      VSRYTPDVVENICGTPKDAFLKVCEYIA------------------------------------------
FDHL_STAAC      ----------------------------------------------------------------------
FDHL_STAA8      ----------------------------------------------------------------------
FDHL_STAA3      ----------------------------------------------------------------------
TORA_VIBPA      --EKTPEWAAAICGVKADKIREFARMLVSGRTQILMGWCIQRQEHGEQPYWAAAVVAAMVGQIGXXXXXX
NAPA_VIBHB      VAPYTVEKASEISGVEKEKLIELAKQYADPNTKVMSLWTMGMNQHTRGVWMNNLIYNLLTGKIATPGNSP
FDHA_METFO      ----------------------------------------------------------------------
FDHL_STAS1      ---YTMEFAEETTGISKDALIDFAHQVADAKSVS-IAWAMGVTQQDIGSDTSTAISNLLLGNYRKPG---
NAPA_SACD2      VADYTVEKASEISGVSEDKLIKLAKLYADPNIKVMSLWTMGVNQHTRGVWMNNLIYNLLTGKISEPGNSP
FDHF_ECOLI      ---YTPESVEDITGVSASEIRQAARMYAQAKSAAILGMGVTQFYQGVETVRSLTSLAMLTGNLGKRGGAC
BISC_ECOLI      ----TAEWAAEICGVGAAKIRELAAIFHQNTTMLMAGWGMQRQQFGEQKHWMIVTLAAMLGQIGTPGGLS
NAPA_PSYIN      VSEFDVDYAVKMSGVPAEKLIELAKVYADPAKKVVSYWTMGFNQHTRGVWANNLMYNVLTGKISKPGSGP
FDNG_ECOLI      VSRYTPDVVENICGTPKADFLKVCEVLAST----------------------------------------
FDXG_HAEIN      VSRYTPEMVERITGVKQKLFLQICEE--------------------------------------------
TORA_VIBVY      --EKTPEWAAPICGVKADKIREFARMLVKGRTQILMGWCIQRQEHGEQPYWAAAVVAAMIGQIGXXXXXX
TORA_VIBVU      --EKTPEWAAPICGVKADKIREFARMLVKGRTQILMGWCIQRQEHGEQPYWAAAVVAAMIGQIGXXXXXX
NAPA_RHIME      VSEYTLDKVVELTGVEAGFLEQLADLYADPKRKVMSLWTMGFNQHVRGVWQMVYNLHLLTGKISEPGNSP
NAPA_BORPA      VSKYDLEYTAKLSGVPKNRLEELAELYADPKVRVTSFWTMGFNQHTRGVWCNNMVYNLLTGKISTPGNSP
NAPA_BORBR      VSKYDLEYTAKLSGVPKNRLEELAELYADPKVRVTSFWTMGFNQHTRGVWCNNMVYNLLTGKISTPGNSP
TORA_ECOLI      --------AEKLTGIDAETIRGLARQMAANRTQIIAGWCVQRMQHGEQWAWMIVVLAAMLXXXXXXXXXX
TORA_ECO57      --------AEKLTGIDAETIRGLARQMAANRTQIIAGWCVQRMQHGEQWAWMIVVLAAMLXXXXXXXXXX
NAPA_VIBPA      VAPYTVEKASEISGVEKEKLIELAKQYADPNTKVMSLWTMGMNQHTRGVWMNNLVYNLLTGKIATPGNSP
BISC_RHOSH      -----AEWASTITGLPAEAIRALAGDLPRTRSMLTVSWSLQRAHHGEQPFWAALGLAAVIXXXXXXXXXX
TORA_ECOL6      --------AEKLTGIDAETIRGLARQMAANRTQIIAGWCVQRMQHGEQWAWMIVVLAAMLXXXXXXXXXX
NAPA_VIBSL      -AEYTVEKASEMSGVSQDDLIKLAKQYADPNIKVMSLWTMGMNQHTRGVWMNSLVYNILTGKISTPGNSP
NAPA1_PHOPR     -AEYTVEKASQMSGVSEEKLIEMAKQYADPKVKVMSLWTMGMNQHTRGVWMNSLVYNILTGKISQPGNSP
NAPA_VIBFM      VAPYTAQKASEMSGVSEEDLITLAKQYADPKTKVMSLWTMGMNQHTRGVWMNSLVYNILTGKIATPGNSP
NAPA_VIBF1      VAPYTAQKASEMSGVSEEDLITLAKQYADPKTKVMSLWTMGMNQHTRGVWMNSLVYNILTGKIATPGNSP
NAPA_METS4      VGEYTLEKTEELTGVSKERLLTLAKTYADPKIRVMSLWTMGFNQHVRGVWANHLVYNLLTGKISEPGNSP
TORZ_HAEIN      ----TAEWAAKICGVPAETIKQLAADFASKRTMLMGGWGMQRQRHGEQTHWMLVTLASMXGGVPTATGGI
NAPA_COLP3      VSTYTVESVSKLSGVPEHKLKELAEMYADPKIKVTSFWTMGFNQHTRGVWANNLVYNLLTGKISTPGNSP
FDHL_STAHJ      ----------------------------------------------------------------------
NAPA_DINSH      VAEYTVDKVSELSGVPAAQLEKLAEQYADPNRKVMSLWTMGFNQHTRGSWVNSLMYNVLVGKISEPGNSP
NAPA_PSEU5      LKPYTLEHAAKESGVPAERLKALAELYADPKVKVMSFWTMGFNQHTRGVWANNMIYNLLTGKISEPGNSP
NAPA_PSEST      LKPYTLEHAAKESGVPAERLKALAELYADPKVKVMSFWTMGFNQHTRGVWANNMIYNLLTGKISEPGNSP
NAPA_PSEAE      VKPYTLERTARESGVPAERLKALAELYADPKRKVVSFWTMGFNQHTRGVWANNLIYNLLTGKISEPGNSP
NAPA_AERHH      VADYDLESVSKLSGVPKDKLEKLAQLYADPSKKVVSYWTMGFNQHTRGVWANNLCYNILTGKISTPGSGP
FDHA_DESGI      YERYDLDKISAICGTPKELILKV-----------------------------------------------
NAPA_PSEAB      VKPYTLERTARESGVPAERLKALAELYADPKRKVVSFWTMGFNQHTRGVWANNLIYNLLTGKISEPGNSP
NAPA_VIBVU      VAPYTVEKASEMSGVAQDKLIELAKQYADPNTKVMSLWTMGMNQHTRGVWMNSLVYNILTGKISTPGNSP
NAPA_BURXL      VSKYDAAYVTKLSGVPQNKLDQLARLYADPKVKVMSFWTMGFNQHTRGTWANNMVLHLLTGKIATPGNSP
YYAE_BACSU      ----------------------------------------------------------------------
NAPA_VIBVY      VAPYTVEKASEMSGVAQDKLIELAKQYADPNTKVMSLWTMGMNQHTRGVWMNSLVYNILTGKIATPGNSP
NAPA_PSEA8      VKPYTLERTARESGVPAERLKALAELYADPKRKVVSFWTMGFNQHTRGVWANNLIYNLLTGKISEPGNSP
NAPA_MAGSA      VAEYTLEKVAKLSGVPADKLEALAKLYADPKVKVVSFWTMGFNQHARGTWVNNMIYNVLMGKISEPGNSP
NAPA_AGRT5      VSEYTLEKTAAMTGVEAGFLEELAELYADPKRKVMSLWTMGFNQHVRGVWANQMVYNLLTGKISEPGNSP
NAPA_PSEMY      VKPYTLERTAKESGVAAERLKALAKLYADPKRKVMSFWTMGFNQHTRGVWANNLILHLLTGKISEPGNSP
FDHL_BACSU      ----------------------------------------------------------------------
NASC_BACSU      ----------------------------------------------------------------------
NAPA_PSEA7      VKPYTLERAARESGVPAERLKALAELYAAPRRKVVSFWTMGFNQHTRGVWANNLIYNLLTGKISEPGNSP
NAPA_BRASB      YAKYTLEKAAEMSGVPLNRLEALAELYADPKTKVVSFWTMGFNQHTRGVWCNNLVYNLLTGKIAEAGNSP
NASA_KLEOX      ----------------------------------------------------------------------
NAPA_RALEJ      VSKYDADYVSKLSGVPKDKLRQLAELYADPNVKVMSLWTMGFNQHTRGSWVNNMVYNVLTGKIATPGNSP
NAPA_HAES2      VAPYTLEKAHEISGVPKEQLEKLAKLYADPNKKVVSYWTMGINQHTRGVWANHLIYNILTGKISLPGCGP
NAPA_PASMU      VAPYTLEKAHEISGVPKEQLEALAKMYADPKLNIVSFWTMGFNQHTRGVWANHLIYNLLTGKISKPGCGP
NAPA_PARPN      VSEYTLDKVSELSGVEPAFLEQLAELYADPDRKVMSLWTMGFNQHGVWANQMVYNLHLLTGKISEPGNSP
NAPA_HAES1      VAPYTLEKAHEISGVPKEQLEKLAKLYADPNKKVVSYWTMGINQHTRGVWANHLIYNILTGKISLPGCGP
NAPA2_PHOPR     VSEYTVEKASEISGVKPDKLIELAELYANPETKVVSFWTMGFNQHTRGVWCNNLVYNLLTGKISTPGNSP
NAPA_MAGMG      -AEYTVEKVSKLSGVPADKLEALAKLYADPKVKVVSFWTMGFNQHTRGTWVNNMIYNVLMGKISEPGNSP
NAPA_BRASO      YAKYTLEKAADMSGVPLNRLQALAELYADPKTKVVSFWTMGFNQHTRGVWCNNLVYNLLTGKIAEAGNSP
NARG_BACSU      ----------------------------------------------------------------------
NARB_SYNE7      ----------------------------------------------------------------------
NAPA_CUPTR      VAKYDADTVSKLSGVPKDKLDQLAELYADTNIKVMSLWTMGFNQHTRGSWANNMVLHLLTGKIATPGNSP
TORA_SHEMA      ----TPEWAAPICGVEAHVIRDLAKTLVKGRTQFMMGWCIQRQQHGEQPYWMAAVLATMIGQIGLPXXXX
NAPA_ACTAC      VAEYTLDKAHEMSGVPKDVLENLAKLYADPKKKVVSYWTMGFNQHTRGVWANHLIYNILTGKISIPGCGP
TORA_VIBCH      ----TPEWAATICGVKPDAIRDFARMLVNGRTQLLFGWCIQRQEHGEQPYWMGAVLAAMIGQIGXXXXXX
TORA_SHEON      ----TPEWAAPICGVEPHIIRDLAKTLVKGRTQIMMGWCIQRQQHGEQPYWMAAVLATMIGQIGLPXXXX
NAPA_AERS4      VADYDLESVSKLSGVSKEKLEKLAQLYADPSKKVVSYWTMGFNQHTRGVWANNLCYNILTGKISTPGSGP
NAPA_SHEON      VSTYTLEYAAKMSGVEPEKLETLAKAYADPKAKVMSLWTMGINQHVRGVWANNMLYNLLTGKIATPGNSP
NAPA_LARHH      VKPYTLEYTARTSCVPAERLKRLAELYADPKKKVVSFWTMGFNQHTRGTWANNLVYNLLTGKISTPGCGP
NAPA_RHOS4      VSEYTLEKAAEISGVXXXXXXXXXXXYADPDRKVMSLWTMGFNQHGVWANHMVYNLHLLTGKISEPGNSP
NAPA_SHEDO      VADYDVESVSKLSGVPEHKLLELAELYADPKVKVTSFWTMGFNQHTRGVWCNNLMYNLLVGKISTPGNSP
NAPA_VIBCM      VAPYTVEKASEISGVSPDKLITLAKQYADPNTKVMSLWTMGMNQHTRGVWMQSLVLHLLTGKIATPGNSP
NAPA_VIBCH      VAPYTVEKASEISGVSPDKLITLAKQYADPNTKVMSLWTMGMNQHTRGVWMQSLVLHLLTGKIATPGNSP
NAPA_VIBC3      VAPYTVEKASEISGVSPDKLITLAKQYADPNTKVMSLWTMGMNQHTRGVWMQSLVLHLLTGKIATPGNSP
YJGC_BACSU      ----------------------------------------------------------------------
DMSA_RHOCA      ----------------------------------------------------------------------
NARB_SYNY3      ----------------------------------------------------------------------
NAPA_YERE8      VAEYTLEKTAKMSGVPEDQLESLAQLYADPKVKLVSYWTMGFNQHTRGVWANNMCLHLLTGKISKPGSGP
NAPA_RALEH      VSKYDADYVSKLSAVPKAKLDQLAELYADPNIKVMSLWTMGFNQHTRGTWANNMVLHLLTGKIATPGNSP
TORZ_ECOL6      ----------------------------------------------------------------------
NAPA_LEPCP      VSEYTAEKVSEISGVTVEQLKALAELYADPKVKVVSYWTMGFNQHTRGTWANNMVYNLLTGKISQPGNGP
NAPA_BRAJA      ---YTLEKAAEMSGVPLNRLEALAELYADPKTKVVSFWTMGFNQHTRGVWCNNLVYNLLTGKISSPGNSP
NAPA_ACTPJ      --PYTLEKAHEISGVPKDQLETLAKMYADPKQTLVSFWTMGFNQHVRGVWVNHMVYNVLTGKISTPGCGP
NAPA_ACTP7      --PYTLEKAHEISGVPKDQLETLAKMYADPKQTLVSFWTMGFNQHVRGVWVNHMVYNVLTGKISTPGCGP
NAPA_ACTP2      --PYTLEKAHEISGVPKDQLETLAKMYADPKQTLVSFWTMGFNQHVRGVWVNHMVYNVLTGKISTPGCGP
DMSA_RHOSH      AAE--------ICGLPAEQIRELARSFVAGRTMLAAGW--------------------------------
TORZ_ECOLI      ----------------------------------------------------------------------
TORZ_ECO57      ----------------------------------------------------------------------
NAPA_NITSB      ----------------------------------------------------------------------
NARG_ECOLI      ----------------------------------------------------------------------
NAPA_HAEPS      VSEYTLDKAHELSGVPKDQLESLAKMYADPNLNIVSFWTMGFNQHVRGVWANHLIYNLLTGKISKPGCGP
NAPA_BORPD      VSTYTLDYTARLSGVPAEKLQRMAELYADPDKKIVSFWTMGFNQHARGTWVNNMIYNVLTGKISQPGCGP
NAPA_EDWI9      VADYTLEKTAKMTGVPQDQLLALAKLYADPNIKVVSYWTMGFNQHTRGVWANNLCYNLLTGKISKPGCGP
NARZ_ECOLI      ----------------------------------------------------------------------
NARB_SHEFN      ----------------------------------------------------------------------
NAPA_CAMFF      ----------------------------------------------------------------------
NAPA_HELHP      ----------------------------------------------------------------------
NAPA_SHEHH      VSSYTLEYAAEMSGVEPEKLELMAKAYADPNVKMMSLWTMGINQHTRGVWANNMLYNLLTGKIATPGNSP
TORA_SALTY      ----------------------------------------------------------------------
TORA_SALTI      ----------------------------------------------------------------------
NAPA_RALPJ      ----------------------------------------------------------------------
NAPA_CAMJR      ----------------------------------------------------------------------
NAPA_CAMJJ      ----------------------------------------------------------------------
NAPA_CAMJE      ----------------------------------------------------------------------
NAPA_CAMJ8      ----------------------------------------------------------------------
NAPA_CAMLR      ----------------------------------------------------------------------
NAPA_NAUPA      ----------------------------------------------------------------------
NAPA_WOLSU      ----------------------------------------------------------------------
NAPA_CAMHC      ----------------------------------------------------------------------
TORZ_HAEIN      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           FQESSKFPSAVTVFQDRIETIIGHVLPPIKAQRLDRLKYPETPATFDALLDAIIEEKPYPVKALFIVATS
PHSA_SALTY      QKKNASVYNKLA--GEKVAPTLAKLMPKPTAQRIDQFKYAAGGGVVQSIIDSALTQKPYPIKAWIMSRHN
YNFE_ECOLI      --NSGARESTYTITIERLPVLDNPVKTSISCSWTDAIDHPQMTAIRDGVRGK--DKLDVPIKFIWNYAGN
YNFF_ECOLI      XXREGSWDLGVEWF-PMLEN-------PVKTQWTDAIDHTEMTATRDGVRGK--EKLDVPIKFLWCYASN
DMSA_HAEIN      --NTGARESAYSIPFVRMPTLKNPVKASIPMFLWTDAIIRGTEMT--ALTDGIVDKLSSPIKVIWNYASN
PSRA_WOLSU      FGKNASFYNQFLGEEDGLKKPKTPAYPKVEVPRIDRIGEKDGEFFLANKGEGIVSGVPCKIHGWFIVRNN
DMSA_ECOLI      GAREGSYSVRMPTLENPIQTSISMFMWTDAIER-----GPEMTALRDGVRGK--DKLDVPIKMIWNYAGN
DDHA_RHOSU      WNQPALLELAFFDFKKLPRLEAGGLGEFVRGGMMDKLK-ARTGFDLDELQEMIDESMPYDMKGLISIADN
SERA_THASE      VSMGEQYRRSKAYFDDELREQIGFGVDEMEALRKESEANGWMP-NWQSIKDPVV----YINAGINTFATS
CLRA_IDEDE      ----------------------------------------------------------------------
YOAE_BACSU      IKHNSGILEYNT----------------NALQRPDLLK-GRTPRSFNMQLGRVLLETDPPIRSLFIYGTN
NAPA_DESDA      FSLTGQ-PNACGGVRD--GGALSHLLPPNAKHRAEMEKLPEPGYHTVALFEALGRG---DVKCMIICETN
NAPA_SYMTH      FSLTGQ-PSACGSVRE--GGGLSHLL-PCGRQVTNEQHRKEVAAVWGVDYTRMSDKVGYRIKALLISCTN
FDHL_STAAB      ----------------------------------------------------------------------
FDHL_STAAW      ----------------------------------------------------------------------
FDHL_STAAS      ----------------------------------------------------------------------
FDHL_STAAN      ----------------------------------------------------------------------
FDHL_STAAM      ----------------------------------------------------------------------
TORA_PASMU      HYSSIGIPSSGAAMPGAFPLNLDEGQKP----KYDNKNYNGYSAVIPCITDSLLQPGEAPYKMAIFTGCN
FDHL_STAAR      ----------------------------------------------------------------------
FDHA_METJA      ----------------------------------------------------------------------
FDOG_ECOLI      ----------------------------------------------------------------------
FDHL_STAAC      ----------------------------------------------------------------------
FDHL_STAA8      ----------------------------------------------------------------------
FDHL_STAA3      ----------------------------------------------------------------------
TORA_VIBPA      XXXXXXVPSTGFAGPGGFPRNLDQGMKP-KWDNNDFNGYSRTIPVIDCLLEPGKEVKLPDFKMMVISGCN
NAPA_VIBHB      FSLTGQ-PSAVGTFAHRLPADMVVANPKHRKIAEDIWKLPEKPGFHAVLQDRMLHDNCYWVQCNNNMQAG
FDHA_METFO      ----------------------------------------------------------------------
FDHL_STAS1      ----------------------------------------------------------------------
NAPA_SACD2      FSLTGQ-PSAVGTFSHRLPADMVVTNPKHRAYAEKIWKLPEGSIPEKVGAHAVLQSKDGEINAYWVQVNN
FDHF_ECOLI      --DMGALPDTYPGYQ--------YVKDPANREKFAKAWGVES---LPAHTGYRISELPHEVRAAYIMGED
BISC_ECOLI      YHNPTRRSAVLSSMQGSLPGGCDAVDKIPVARIVEALENPGGAYQHNGM------NRHFPIRFIWWAGGA
NAPA_PSYIN      FSLTGQ-PSAVGTFSHRLPADLVVANPKHRAIAEKLWKLPEGTIEPKPGYHAVLQNKDSKLNAYWVMCNN
FDNG_ECOLI      ----------------------------------------------------------------------
FDXG_HAEIN      ----------------------------------------------------------------------
TORA_VIBVY      XXXXXXVPSTGFAGPGGFPRNLDAGMKP-KWDNNDFNGYSRTIPVIDCLLEPGKEVKLPDFKMMVISGCN
TORA_VIBVU      XXXXXXVPSTGFAGPGGFPRNLDAGMKP-KWDNNDFNGYSRTIPVIDCLLEPGKEVKLPDFKMMVISGCN
NAPA_RHIME      FSLTGQ-PSAVGTFAHRLPADMTVTNPEHRAEEIWRIPHPEKPGYHAVEQDRMLKDGKLNFYWXXXXXXX
NAPA_BORPA      FSLTGQ-PSAVGTFSHRLPADLVVTNPEHRRHAEEIWKLPDGTIPSKVGAHAVLQNKDGKINAYWVXXXX
NAPA_BORBR      FSLTGQ-PSAVGTFSHRLPADLVVTNPEHRRHAEEIWKLPDGTIPSKVGAHAVLQNKDGKINAYWVXXXX
TORA_ECOLI      XXXXXXXXXXTPGRKGVILSFSGSTSIPPVHDNSDYKGYSST-IPIARFIDAILEPKLPPLKMCIFAGTN
TORA_ECO57      XXXXXXXXXXTPGRKGVILSFSGSTSIPPVHDNSDYKGYSST-IPIARFIDAILEPKLPPLKMCIFAGTN
NAPA_VIBPA      FSLTGQ-PSAVGTFAHRLDMVVAHRQIAEKIWKLPEGTIPPKPGFHAVLQDRMLNDNCYWVQCNNNMQAG
BISC_RHOSH      XXXXXXXXXXXAPFTIGKSPAMSQLSKPINARISDMLLNPGGPYSYEG------EDRRYPIRLVYWSGGN
TORA_ECOL6      XXXXXXXXXXTPGRKGVILSFSGSTSIPPVHDNSDYKGYSST-IPIARFIDAILEPKLPPLKMCIFAGTN
NAPA_VIBSL      FSLTGQ-PSAVGTFSHRLPADMVVANPKHRKIAEDIWKLPEGTIPPKPGKHAVAQDKDGTINAYWVMCNN
NAPA1_PHOPR     FSLTGQ-PSAVGTFSHRLDMVVANPKHRAIAEKIWKLPIPAKPGYHAVQQDRMLKDGK--LNAYWVMCNN
NAPA_VIBFM      FSLTGQ-PSAVGTFSHRLPADMVVANPKHRAISEKIWKLPEGTLNGKPGAHAVVQDKDGKINAYWVMCNN
NAPA_VIBF1      FSLTGQ-PSAVGTFSHRLPADMVVANPKHRAISEKIWKLPEGTLNGKPGAHAVVQDKDGKINAYWVMCNN
NAPA_METS4      FSLTGQ-PSAVGTFSHRLPADMQVNNPEHRKHAEEIWKLPPGLLNGEIGYHAVQQDKDGKLNAYWIMCNN
TORZ_HAEIN      IGSITASPSGKAGAKTWLDDTSKSAFP--LARIADVLLHPGKKIQYNGT------EITYPIKAVYWAGGN
NAPA_COLP3      FSLTGQ-PSAVGTFSHRLPADMKHRAIAEKIWDLPEGTIPAKPGYHAVLQNRMLKDGKLNFYWVQCNNNM
FDHL_STAHJ      ----------------------------------------------------------------------
NAPA_DINSH      FSLTGQ-PSAVGTFAHRLPADMVVMNDAHRALTEKKWNLPEGTIPAKPGFHAVLQHKDGDLNAYWVQCNN
NAPA_PSEU5      FSLTGQ-PSAVGTFSHRLPADMAVTNPKHRAITEKIWKLPEGTIQEKPGFHAVDQSRKLKDGVLKVYWTQ
NAPA_PSEST      FSLTGQ-PSAVGTFSHRLPADMAVTNPKHRAITEKIWKLPEGTIQEKPGFHAVDQSRKLKDGVLKVYWTQ
NAPA_PSEAE      FSLTGQ-PSAVGTFSHRLPADLVVTNPKHRETAEKIWKVPAGTIQEKVGFHAVQQSRMLKDGVLNVYWTQ
NAPA_AERHH      FSLTGQ-PSAVGTFAHRLPADMVVTEPKHRAIAEKIWKLPEGTIPEQVGYHAVLQNKDGKLNAYWVMCNN
FDHA_DESGI      ----------------------------------------------------------------------
NAPA_PSEAB      FSLTGQ-PSAVGTFSHRLPADLVVTNPKHRETAEKIWKVPAGTIQEKVGFHAVQQSRMLNDGVLNVYWTQ
NAPA_VIBVU      FSLTGQ-PSAVGTFAHRLDMVVANPKHRAIAEKIWKLPIPPKPGFHAVLQDRMLHDNCYWVQCNNNMQAG
NAPA_BURXL      FSLTGQ-PSAVGTFSHRLDMVVTNPKHREEAEHIWKLTIPDKPGYHAVLQNRMLRDGKLNAYWXXXXXXX
YYAE_BACSU      ------------------------------------------------------------IEMIIVTCGN
NAPA_VIBVY      FSLTGQ-PSAVGTFAHRLDMVVANPKHRAIAEKIWKLPIPPKPGFHAVLQDRMLHDNCYWVQCNNNMQAG
NAPA_PSEA8      FSLTGQ-PSAVGTFSHRLPADLVVTNPKHRETAEKIWKVPAGTIQEKVGFHAVQQSRMLKDGVLNVYWTQ
NAPA_MAGSA      FSLTGQ-PSAVGTFAHRLPADM--VVMNDKHREITEGLWKLPPGTLNPKIHAVLQHKDGKLNAYWVMCTN
NAPA_AGRT5      FSLTGQ-PSAVGTFAHRLPADMTVTNPEHRAEEIWRIPHPEKPGYHAVQQDRMLHDGKYWVQVNNNVQAG
NAPA_PSEMY      FSLTGQ-PSACGTARE--VGTFSHRLP--ADMLVANPKHRETAEKIWKLPPGTIQEKPGVLKVYWTQVSN
FDHL_BACSU      ----------------------------------------------------------------------
NASC_BACSU      ----------------------------------------------------------------------
NAPA_PSEA7      FSLTGQ-PSAVGTFSHRLPADLVVTNPKHRETAEKIWKVPAGTIQEKVGFHAVQQSRMLKDGVLNVYWTQ
NAPA_BRASB      FSLTGQ-PSAVGTFSHRLDMVVTNKEHRTKAEHIWQLTIPDKPGYHAVLQSRMLKDNAYWVQVNNNLQAG
NASA_KLEOX      ----------------------------------------------------------------------
NAPA_RALEJ      FSLTGQ-PSAVGTFSHRLDMVVTNPKHREEAERIWKLTIVEKPGYHAVLQNRMLRDGKLNAYWXXXXXXX
NAPA_HAES2      FSLTGQ-PSAVGTFIHRLPADLVVIKPEHRKIAEKIWKLPEGLISDKLGFHAVAQSKDGKMQVLWQMCNN
NAPA_PASMU      FSLTGQ-PSAVGTFAHRLDLVVTNPKHVEKAEKLWKLPVIQTQVGYHAVADRALKDKKMNVLWQMCTNNM
NAPA_PARPN      FSLTGQASACVGTFRHRLPSDMTVTNPERRAEEIWRIPHPEQPGLHAVAQDRALHDGTYWIQVNNNLQAS
NAPA_HAES1      FSLTGQ-PSACGTARE-VGTFI-HRLPPEHRKIAEKIKLPEGLISDKLGFHAVAQSKDGKMQVLWQMCNN
NAPA2_PHOPR     FSLTGQ-PSAVGTFAHRLPADLVVTNPEHRAEKIWKLPDGTIPGKVGA--HAVLQSKDGKINAYWIQVNN
NAPA_MAGMG      FSLTGQ-PSACGTARE--VGTFAHRLPADMVVMNDKWKLPAGTINPKIGYHAVLQHKDGKLNAYWVMCTN
NAPA_BRASO      FSLTGQ-PSAVGTFSHRLDMVVTNKEHRTKAEHIWQLTIPDKPGYHAVLQSRMLKDNAYWVQVNNNLQAG
NARG_BACSU      ----------------------------------------------------------------------
NARB_SYNE7      ----------------------------------------------------------------------
NAPA_CUPTR      FSLTGQ-PSAVGTFSHRLDMVVTNPKHREEAERIWKLTIPDKPGYHAVLQNRMLKDGKLNAYWXXXXXXX
TORA_SHEMA      XXXXXXXXXXXXXXXXXXXXXXXRNLDENQKPLFDSSDFKGASSTIPVAIDAILEKVVYPIKMMIFSGNN
NAPA_ACTAC      FSLTGQ-PSACGTARE-VGTFI-HRLPPKHREKAEQIKLPAGVITDVLGFHAVAQSKDGKMRVLWQMCTN
TORA_VIBCH      XXXXXXVPSTGFAGPGGFPRNLDQGAKP-KWDNNDFNGYSRT-IPVARWIDAILEPGKKGFKMMVISGCN
TORA_SHEON      XXXXXXXXXXXXXXXXXXXXXFPRNLDENQKPLFDSTDFKGASSTIPVAIDAILEKVVYPIKMMIFSGNN
NAPA_AERS4      FSLTGQ-PSAVGTFAHRLPADMVVTDPKHRAIAEKIWKLPEGTIPEQVGYHAVLQNKDGKLNAYWVMCNN
NAPA_SHEON      FSLTGQ-PSAVGTFAHRLPADMKHRAITEKMWQVPEGTIPPKPGYHAVLQSRMLKDGKLNCYWTMCTNNM
NAPA_LARHH      FSLTGQ-PSAVGTFAHRLPADLVVMNPEHRKIAENIWKLPEGTIPPKMGLHAVAMQRALKDSKLKVMQAG
NAPA_RHOS4      FSLTGQ-PSAVGTFAHRLPADMVVTNPEHRAHAEEIWKLPAGLLPDWVGAHAVEQDRKYWVQVNNNMQAA
NAPA_SHEDO      FSLTGQ-PSACGTARE--VGTFSHRLPADMV--VTDPKHRKIAENIWKIPSGIIPEKPYWVQVNNNMQAG
NAPA_VIBCM      FSLTGQ-PSAVGTFAHRLDMVVAHRAIAEKVWKLPEGTIPEKPGFHAVQQDRMLKDNCYWVQCNNNMQAG
NAPA_VIBCH      FSLTGQ-PSAVGTFAHRLDMVVAHRAIAEKVWKLPEGTIPEKPGFHAVQQDRMLKDNCYWVQCNNNMQAG
NAPA_VIBC3      FSLTGQ-PSAVGTFAHRLDMVVAHRAIAEKVWKLPEGTIPEKPGFHAVQQDRMLKDNCYWVQCNNNMQAG
YJGC_BACSU      ----------------------------------------------------------------------
DMSA_RHOCA      ----------------------------------------------------------------------
NARB_SYNY3      ----------------------------------------------------------------------
NAPA_YERE8      FSLTGQ-PSAVGTFSHRLPADM--VVTNEKHRQIAETKWQLPAGTIPEKLHAVAQDKDGTLNAYWVMCNN
NAPA_RALEH      FSLTGQ-PSAVGTFSHRLDMVVTNPKHREEAERIWKLTIPDKPGYDAVLQNRMLKDGKLNAYWXXXXXXX
TORZ_ECOL6      ----------------------------------------------------------------------
NAPA_LEPCP      FSLTGQ-PSAVGTFAHRLPADMVVTNPEHRHHAEEIWGLPEGTIPDKIGLHAVAQSKDGKLKCYWVTTNN
NAPA_BRAJA      FSLTGQ-PSAVGTFSHRLDMVVTNKEHRTKAEHIWQLTIPDKPGAHAVLQSRMLKDNAYWVQVNNNLQAG
NAPA_ACTPJ      FSLTGQ-PSAVGTFADMVVTNPKHVEIVEKAWKLPKGTIPTVPG-YPAVMQSRM-LKDGKLNFLWQLCTN
NAPA_ACTP7      FSLTGQ-PSAVGTFADMVVTNPKHVEIVEKAWKLPKGTIPTVPG-YPAVMQSRM-LKDGKLNFLWQLCTN
NAPA_ACTP2      FSLTGQ-PSAVGTFADMVVTNPKHVEIVEKAWKLPKGTIPTVPG-YPAVMQSRM-LKDGKLNFLWQLCTN
DMSA_RHOSH      ----------------------------------------------------------------------
TORZ_ECOLI      ----------------------------------------------------------------------
TORZ_ECO57      ----------------------------------------------------------------------
NAPA_NITSB      ----------------------------------------------------------------------
NARG_ECOLI      ----------------------------------------------------------------------
NAPA_HAEPS      FSLTGQ-PSACGTARE-VGTFI-HRLPPEHVKTAEKLKLPNGVIQTKVGLHAVAQDKDGKLNAYWVMCNN
NAPA_BORPD      FSLTGQ-PSAVGTFAHRLDMVVGNPAHRKIAEELWQLPEGTIPAKVG--LHAVAQSRALKDGKLKCYWTS
NAPA_EDWI9      FSLTGQ-PSAVGTFAHRLPADMVVTNEKHRQIAETRWKIPAGTIPDKVGLHAVAQDKDGKLNAYWVMCNN
NARZ_ECOLI      ----------------------------------------------------------------------
NARB_SHEFN      ----------------------------------------------------------------------
NAPA_CAMFF      ----------------------------------------------------------------------
NAPA_HELHP      ----------------------------------------------------------------------
NAPA_SHEHH      FSLTGQ-PSAVGTFAHRLPADM-VVANPKHREITEKLTIPPKPGFHAVLQSRMLKDGKLNCYWTMCTNNM
TORA_SALTY      ----------------------------------------------------------------------
TORA_SALTI      ----------------------------------------------------------------------
NAPA_RALPJ      ----------------------------------------------------------------------
NAPA_CAMJR      ----------------------------------------------------------------------
NAPA_CAMJJ      ----------------------------------------------------------------------
NAPA_CAMJE      ----------------------------------------------------------------------
NAPA_CAMJ8      ----------------------------------------------------------------------
NAPA_CAMLR      ----------------------------------------------------------------------
NAPA_NAUPA      ----------------------------------------------------------------------
NAPA_WOLSU      ----------------------------------------------------------------------
NAPA_CAMHC      ----------------------------------------------------------------------
TORZ_HAEIN      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           PFHRDVNTXXXXXXXXXXXXIVAIDILPQDHIDWSDYVLPDLMFLEREEIGSIKWSLHAGIRYSHKVLDP
PHSA_SALTY      PFQTVTCRSDLVKTVEQLDLVVSCDVYLSESAAYADYLLPECTYLERDEEVSDMSGLHPAYALRQQVVEP
YNFE_ECOLI      TLHSDINTHEILQDESKCEMIVVIENFMTSSAKYADILLPDLMTVEQEDIIPNDYAGNMGYLI---FLQP
YNFF_ECOLI      TLHGDINTHEVLQDDSKCEMIVGIDHFMTASAKYCDILLPDLMPTEQEDLISHESAGNMG----YVILAQ
DMSA_HAEIN      CLHAQINTHDILQDDTQCEMIITIDNHMTSTAKYSDILLPDCTTSEQMDFALDAFSNMAYVIFADQVI--
PSRA_WOLSU      PVMTQTNADTVIKALKSMDLVVCVDIQVSDTAWFADVVLPDTTYLERDE---------------------
DMSA_ECOLI      CLHSEINTHEILQDDKKCELIVVIDCHMTSSAKYADILLPDCTASEQ-----MDFALDASCGNMSYVIFN
DDHA_RHOSU      KFRRNKNAYRERILEEVEELFVDINVRMDSTAQWADYLLPAAAHYEAWDLRSIAFH-----RFVNVFSRP
SERA_THASE      TGYQHLRENFLKRCELY----VVVDFRLNSGAMYADIVLPAATNLEKLDIRET-----SSTRFIHAFGQP
CLRA_IDEDE      ----------------------------------------------------------------------
YOAE_BACSU      PVAPEANKVRQGLLREDLFTVVH-DLFLTETAAYADIVLPATSAFENTDFYTSYW--HHYIQLQQPVIE-
NAPA_DESDA      PAHTLPNNKVHKAMSHPESFIVCIEAFPDATLEYADLVLPPAFWCERDGVGERRYSL------TEKAVDP
NAPA_SYMTH      PGH-SLPNLNSVRASLEKTFLVVMDAFHNRTTELADVVLPSALWCEKEGIYG-----NTERRTQHLAKAV
FDHL_STAAB      ----------------------------------------------------------------------
FDHL_STAAW      ----------------------------------------------------------------------
FDHL_STAAS      ----------------------------------------------------------------------
FDHL_STAAN      ----------------------------------------------------------------------
FDHL_STAAM      ----------------------------------------------------------------------
TORA_PASMU      HWHRHSERNKMKQAFQRLETIVSINYSWTATCRFSDIVLPACTPFERNDIDAYGSYSNRGVIAMQKLVDP
FDHL_STAAR      ----------------------------------------------------------------------
FDHA_METJA      ----------------------------------------------------------------------
FDOG_ECOLI      ----------------------------------------------------------------------
FDHL_STAAC      ----------------------------------------------------------------------
FDHL_STAA8      ----------------------------------------------------------------------
FDHL_STAA3      ----------------------------------------------------------------------
TORA_VIBPA      PWHHHQDRNRMKKAFRKLQTVVTIEFAWTATCRFSDIVLPACTQWERNDIDVYGSYSNKGLIAMHRLVDP
NAPA_VIBHB      P---NINTERLPGYRNPENFIVVSDPYPTATAQAADLVLPTAMWIEKEAYGNAERRTQAWYQQVETI---
FDHA_METFO      ----------------------------------------------------------------------
FDHL_STAS1      ----------------------------------------------------------------------
NAPA_SACD2      NVQANINEEVLPGYRNPQNFIVVSDAYPTVTAQAADLILPSAMWVEKE---GAYGNAERRTQFWHQLVNA
FDHF_ECOLI      PLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFT---AADRGFQRFFKAVEP
BISC_ECOLI      NFTHHQDTNRLIRAWQKPELVVISECFWTAAAKHADIVLPATTSFERNDLTMTG-------DYSNQHLVP
NAPA_PSYIN      NVQANINEEIIPGYRNPENFIVVSDPYPTVTAQMGDLILPTAMWVEKE---GAYGNAERRTQFWHQQVKA
FDNG_ECOLI      ----------------------------------------------------------------------
FDXG_HAEIN      ----------------------------------------------------------------------
TORA_VIBVY      PWHHHQDRNRMKQAFQKLQTVVTIDFAWTATCRFSDIVLPACTQWERNDIDVYGSYSSRGLIAMHRLVDP
TORA_VIBVU      PWHHHQDRNRMKQAFQKLQTVVTIDFAWTATCRFSDIVLPACTQWERNDIDVYGSYSSRGLIAMHRLVDP
NAPA_RHIME      XXXXXXXXETYQGYRNPDNFIVVSDVYPTITAMSADLILPAAMWVEKEAYGNAERRTHVW----HQLVDA
NAPA_BORPA      XXXXXXXXEGLPGYRNPENFIVVSDAYPTVTTLSADLILPAAMWVEKE---GAYGNAERRTQFWHQLVDA
NAPA_BORBR      XXXXXXXXEGLPGYRNPENFIVVSDAYPTVTTLSADLILPAAMWVEKE---GAYGNAERRTQFWHQLVDA
TORA_ECOLI      PFHRHQQINRIIEGLRKLETVIAIDNQWTSTCRFADIVLPATTQFERNDLDQYGNHSNRGIIAMKQVV--
TORA_ECO57      PFHRHQQINRIIEGWRKLETVIAIDNQWTSTCRFADIVLPATTQFERNDLDQYGNHSNRGIIAMKQVV--
NAPA_VIBPA      P---NINTERLPGYRNPENFIVVSDPYPTATAQAADLILPTAMWIEKEAYGNAERRTQAWYQQVGTV---
BISC_RHOSH      PFHHHQDLNRLSEAWTRPETIIVQDPMFTATAKRADIVLPASTSIERNDL--------AGNKRSDFILAM
TORA_ECOL6      PFHRHQQINRIIEGWRKLETVIAIDNQWTSTCRFADIVLPATTQFERNDLDQYGNHSNRGIIAMKQVV--
NAPA_VIBSL      NMQANINTERLPGYRNPDNFIVCSDPYPTATAQASDLILPTAMWIEKEAYGNAERRTQAWYQQVKTV---
NAPA1_PHOPR     NMQANINEERLPGYRNPENFIVCSDPYPTVTAQASDLILPTAMWVEKEGAYG-----NAERRTQAWYQQV
NAPA_VIBFM      NMQANINTERLPGYRNPENFIVCSDPYPTATAQAADLILPTAMWVEKEGAYG-----NAERRTQAWYQQV
NAPA_VIBF1      NMQANINTERLPGYRNPENFIVCSDPYPTATAQAADLILPTAMWVEKEGAYG-----NAERRTQAWYQQV
NAPA_METS4      NLQTNTNTETYPGYRNPANFVVCSDPYPTVTAMAADVVLPTAMWVEKEAYGNAERRTH-----MWRQLVN
TORZ_HAEIN      PFHQDTNTLVKAFQKPDVVIVNEVNWTPTARM--ADIVLPATTSYERNDLTMAGDYSMMSVYPMKQVV--
NAPA_COLP3      QAAANINEEAYPGYRNPKNFIVVSDPYPTVTAQAADLILPTAMWVEKE---GMYGNAERRTQSWYQMVEA
FDHL_STAHJ      ----------------------------------------------------------------------
NAPA_DINSH      NMQANMNEEGYPGYRNPENFITVSDPYPTVTTMSADLILPTAMWVEKE--GAYGNAERRTQFWRQQVKAP
NAPA_PSEU5      VTNNNVMQEILPGWRNPETFVIVSDVYPTVSAQAADLILPSAMWVEKE---GAYGNAERRTQFWHQLVTA
NAPA_PSEST      VTNNNVMQEILPGWRNPETFVIVSDVYPTVSAQAADLILPSAMWVEKE---GAYGNAERRTQFWHQLVTA
NAPA_PSEAE      VSNNNVMQEVLPGWRNPDNFVIVSDVYPTVSAQAADLILPSAMWVEKE---GAFGNAERRTQFWHQLVKA
NAPA_AERHH      NMQANMNEEGLPGYRNPANFIVVSDPYPTVTAQAADLILPTAMWVEKE---GAYGNAERRTQFWHQQVKP
FDHA_DESGI      ----------------------------------------------------------------------
NAPA_PSEAB      VSNNNVMQEVLPGWRNPDNFVIVSDVYPTVSAQAADLILPSAMWVEKE---GAFGNAERRTQFWHQLVKA
NAPA_VIBVU      P---NINGERLPGYRNPENFIVVSDPYPTATAQAADLILPTAMWIEKEAYGNAERRTQAWYQQVGTV---
NAPA_BURXL      XXXXXINGEALPGYRNPQAFVVVSDVYPTVTAVAADLILPSAMWVEKE---GAYGNAERRTQFWHQLVDA
YYAE_BACSU      PLTQVPNTNKVRQAFEKVPMTVAIDSIMTDTAELCDYVLPTATVFEEEDI-YYSSMYHHYVQYGKKLVEP
NAPA_VIBVY      P---NINGERLPGYRNPENFIVVSDPYPTATAQAADLILPTAMWIEKEAYGNAERRTQAWYQQVGTV---
NAPA_PSEA8      VSNNNVMQEVLPGWRNPDNFVIVSDVYPTVSAQAADLILPSAMWVEKE---GAFGNAERRTQFWHQLVKA
NAPA_MAGSA      NMQTNMNEEGYPGYRNPANFIVVSDPYPTVTALAADLILPTAMWMEKE--GAYGNAERRTQFWRQQVKAP
NAPA_AGRT5      P---NTKNETYLGYRNPENFIVVSDAYPTITAMSADLILPAAMWVEKEAYGNAERRTHVW----HQLVE-
NAPA_PSEMY      NMQAGPNVEILPGWRNPQAFVIVSDVYPTVSAQAADLILPSAMWVEKE---GAYGNAERRTQFWHQLVKA
FDHL_BACSU      ----------------------------------------------------------------------
NASC_BACSU      ----------------------------------------------------------------------
NAPA_PSEA7      VSNNNVMQEVLPGWRNPDNFVIVSDVYPTVSAQAADLILPSAMWVEKE---GAFGNAERRTQFWHQLVKA
NAPA_BRASB      P---NANEETYPGFRNPDNFIVVSDAYPSVTALAADLILPTAMWVEKE---GAYGNAERRTQFWHQLVSA
NASA_KLEOX      ----------------------------------------------------------------------
NAPA_RALEJ      XXXXXXXXXXLPGYRNPANFIVVSDAYPTVTALSADLILPSAMWVEKE---GAYGNAERRTQFWHQLVDA
NAPA_HAES2      NMQANINEETYPGWRNPDNFIVVSDPYPTVSALSADLILPTAMWVEKE--GAYGNAERRTQFWRQQVKAP
NAPA_PASMU      QGGPNINQERFPGWRDEENFVIVSDPYPTVSALAADLILPTAMWVEKE---GAYGNAERRTQFWYQQVKA
NAPA_PARPN      P---NNDGEAWPGYRNPDNFIVVSDAYPTVTALAADLILPAAMWVEKEAYGNAERRTHVW----HQLVEA
NAPA_HAES1      NMQANINEETYPGWRNPDNFIVVSDPYPTVSALSADLILPTAMWVEKE--GAYGNAERRTQFWRQQVKAP
NAPA2_PHOPR     NLQANINEETLPGYRNPDNFIVVSEAYPTVTSQAADLVLPTAMWVEKE--GGF-GNAERRTQLWHQMVEA
NAPA_MAGMG      NMQTNMNEEGYPGYRNPANFIVVSDPYPTVTALAADLILPTAMWMEKEGAYG-----NAERRTQFWAPEG
NAPA_BRASO      P---NANEETYPGFRNPDNFIVVSDAYPSVTALAADLILPTAMWVEKE---GAYGNAERRTQFWHQLVSA
NARG_BACSU      ----------------------------------------------------------------------
NARB_SYNE7      ----------------------------------------------------------------------
NAPA_CUPTR      XXXXXLMEEGLPGYRNPANFIVVSDAYPTVTALAADLILPSAMWVEKE---GAYGNAERRTQFWHQLVDA
TORA_SHEMA      PWNHHQDRNRMKQAFHKLECVVTVDVNWTATCRFSDIVLPACTTYERNDIDVYGAYANRGILAMQKMVEP
NAPA_ACTAC      NMQGNINRETFPGWRNPDNFIVVSDPYPTVSCLAADLMLPTAMWVEKE--GAYGNAERRTQFWRQQVKAP
TORA_VIBCH      PWHHHQDRNKMKRAFQKLETVVTIDFSWTATCRFSDIVLPACTQWERNDIDSYGSYSGKGLIAMHRLVDP
TORA_SHEON      PWNHHQDRNRMKQAFQKLECVVSIDVNWTATCRFSDIVLPACTTYERNDIDVYGAYANRGILAMQKMVEP
NAPA_AERS4      NMQANMNEEALPGYRNPANFIVVSDPYPTVTAQAADLILPTAMWVEKE---GAYGNAERRTQFWHQQVKP
NAPA_SHEON      QAGPNINEEMYPGFRNPENFIVVSDPYPTVTAMAADLILPTAMWVEKEAYGNAERRTHMW----HQQVKA
NAPA_LARHH      P---NINEEMYPGWRNPETFIIVSDPYPTVSAMAADLILPTAMWVEKE---GAYGNAERRTQFWRQQVNA
NAPA_RHOS4      P---NIDQETYPGYRNPENFIVVSDAYPTVTGRCADLVLPAAMWVEKEAYGNAERRTH----FWHQLVEA
NAPA_SHEDO      P---NINEEGLPGYRNPANFIVVSDAYPTVTTQAADLILPTAMWVEKE---GAYGNAERRTQFWHQMVKA
NAPA_VIBCM      P---NINEERLPGYRNPENFIVVSDAYPTVTAQAADLVLPTAMWVEKEAYGNAERRTQVWYQQVKTV---
NAPA_VIBCH      P---NINEERLPGYRNPENFIVVSDAYPTVTAQAADLVLPTAMWVEKEAYGNAERRTQVWYQQVKTV---
NAPA_VIBC3      P---NINEERLPGYRNPENFIVVSDAYPTVTAQAADLVLPTAMWVEKEAYGNAERRTQVWYQQVKTV---
YJGC_BACSU      ----------------------------------------------------------------------
DMSA_RHOCA      ----------------------------------------------------------------------
NARB_SYNY3      ----------------------------------------------------------------------
NAPA_YERE8      NMQANINEERMPGWRDPRNFIVVSDPYPTISALAADLILPTAMWVEKE--GAYGNAERRTQFWRQQV--P
NAPA_RALEH      XXXXXLMEEGLPGYRNPANFIVVSDAYPTVTALAADLVLPSAMWVEKE---GAYGNAERRTQFWHQLVDA
TORZ_ECOL6      ----------------------------------------------------------------------
NAPA_LEPCP      NMQANINGEILPGWRNPKTFIVVSDPYPTASAMAADLVLPAAMWVEKE--GAFGNAERRTQVWRQQVSAP
NAPA_BRAJA      P---NANEETYPGFRNPDNFIVVSDAYPSVTALAADLILPTAMWVEKE---GAYGNAERRTQFWHQLV-P
NAPA_ACTPJ      NMQPNINEEIFPGWRNPENFIVVSDPYPSVSAVAADLILPTCMWVEKE--GAYGNAERRTQFWRQQVKGP
NAPA_ACTP7      NMQPNINEEIFPGWRNPENFIVVSDPYPSVSAVAADLILPTCMWVEKE--GAYGNAERRTQFWRQQVKGP
NAPA_ACTP2      NMQPNINEEIFPGWRNPENFIVVSDPYPSVSAVAADLILPTCMWVEKE--GAYGNAERRTQFWRQQVKGP
DMSA_RHOSH      ----------------------------------ADIVLPATTSYERNDIESVGDYSNRAILAMKKVVDP
TORZ_ECOLI      ----------------------------------------------------------------------
TORZ_ECO57      ----------------------------------------------------------------------
NAPA_NITSB      ----------------------------------------------------------------------
NARG_ECOLI      ----------------------------------------------------------------------
NAPA_HAEPS      NMQPNINQERMPGWRDERNFIVVSDPYPTVSALSADLILPTAMWVEKE----------------------
NAPA_BORPD      TTNNNINDEIYPGWRNPEAFVVVSDPYPTVSALSADLILPTAMWVEKE--GAYGNAERRTQFWRQQVRAP
NAPA_EDWI9      NMQANINADRMPGWRDPRNFIVVSDPYPTVSALSADLILPTAMWVEKE---GAYGNAERRTQFWHQQVKA
NARZ_ECOLI      ----------------------------------------------------------------------
NARB_SHEFN      ----------------------------------------------------------------------
NAPA_CAMFF      ----------------------------------------------------------------------
NAPA_HELHP      ----------------------------------------------------------------------
NAPA_SHEHH      QAGPNINDEMYPGFRNPENFIVVSDPYPTVTAMAADLILPTAMWVEKEAYGNAERRTHMW----HQQVKA
TORA_SALTY      ----------------------------------------------------------------------
TORA_SALTI      ----------------------------------------------------------------------
NAPA_RALPJ      ----------------------------------------------------------------------
NAPA_CAMJR      ----------------------------------------------------------------------
NAPA_CAMJJ      ----------------------------------------------------------------------
NAPA_CAMJE      ----------------------------------------------------------------------
NAPA_CAMJ8      ----------------------------------------------------------------------
NAPA_CAMLR      ----------------------------------------------------------------------
NAPA_NAUPA      ----------------------------------------------------------------------
NAPA_WOLSU      ----------------------------------------------------------------------
NAPA_CAMHC      ----------------------------------------------------------------------
TORZ_HAEIN      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           PPGVDARSAFWALMEIIRRAFPEKAKIVEYDEKYADYNAFEHYEKKFFEAALRKLAETWKLDFEEIKEAL
PHSA_SALTY      ---IGEARPSWQ----IWKELGEQLGLGQY-YPWQDMQTRQLYQLNGDHALAKELRQKGYLEWESVRQFT
YNFE_ECOLI      VTSFERKPIYWILSEVAKRLGPDVYQ--KFTEGRTQEQWLQHLYAKMLDPALPSYDELKKMGIYKRKDP-
YNFF_ECOLI      PAKFERKPIYWMLSEVAKRLGPDVYQTFTEGRSQHEWIKYLHAKTKERNPEMP--------DYEEMKTT-
DMSA_HAEIN      KPSFECRPIYDMLSDL--------AEKMGVKEKFTEGRTQEEWLRHIYEQSREKLPEL--PTFEEFRQKV
PSRA_WOLSU      ----------------------------------------------------------------------
DMSA_ECOLI      DQVIKPRFECKTIYEMT----SELAKRLGVEQQFTEGRTQEEWMRHLYAQSREAIPEL--PTFEEFRKQK
DDHA_RHOSU      VPPIGEAKSDWEIMEILTRKIQERA---------------------------------------------
SERA_THASE      IKPMYDRRTDWQISVGLARKIQERARFIDFDKVYDEFTMNGAVEKD--EDALRFVMEKSKLGPGSYEEVL
CLRA_IDEDE      ----------------------------------------------------------------------
YOAE_BACSU      -------------------RYGESKSNTEVFRLLAEAMGFTDQELKDSDEVLIRQA----LDHPDNPHLA
NAPA_DESDA      PG--QCRPTVNTLVEFARRA--------------------------------------------------
NAPA_SYMTH      EPKGEARPDVWILLEI--------AKRLGYGEYFSHYTSNEVIWEEF-----RKMGGGGTYDYAPYERYK
FDHL_STAAB      ----------------------------------------------------------------------
FDHL_STAAW      ----------------------------------------------------------------------
FDHL_STAAS      ----------------------------------------------------------------------
FDHL_STAAN      ----------------------------------------------------------------------
FDHL_STAAM      ----------------------------------------------------------------------
TORA_PASMU      L--YDSRSDFEIFKDLCRRFGKEKEYCRNMDEKHL-YEACRQENQGKFD--MPPFAEFWQKGY-----VL
FDHL_STAAR      ----------------------------------------------------------------------
FDHA_METJA      ----------------------------------------------------------------------
FDOG_ECOLI      ----------------------------------------------------------------------
FDHL_STAAC      ----------------------------------------------------------------------
FDHL_STAA8      ----------------------------------------------------------------------
FDHL_STAA3      ----------------------------------------------------------------------
TORA_VIBPA      L--FQSKPDFQIMSELTQRF----GRREEYTRGMSE---MEWIESLYNDC---KKANEGKFEMPEFNEFW
NAPA_VIBHB      ---GDAKSDLWQVMEFAKRFKMEEVWPEELLAKAPEYRGKTMYDMLF------KNGQVDKFPIEEAREMA
FDHA_METFO      ----------------------------------------------------------------------
FDHL_STAS1      ----------------------------------------------------------------------
NAPA_SACD2      PG--DARSDLWQLVEFSKYFKVEEVWPADLIAKMPEAKGKTLFDILYKNGKVNKLAQVSK-DYEN-KEA-
FDHF_ECOLI      K--WDLKTDWQIISEIATRGYP-----MHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWRDTSDA-
BISC_ECOLI      PPRYEARNDFDVFAELSERW--EKGGYARFTEGKSELQWLETFRGASQQVELPPFAEFWQAN-QLIEMPE
NAPA_PSYIN      PEG--AKSDLWQLVEFSKRFKIEEVWTEDLIAKMPEVRGETLFDVLYKNGQVDAFGLDEVAD-ERLNDEA
FDNG_ECOLI      ----------------------------------------------------------------------
FDXG_HAEIN      ----------------------------------------------------------------------
TORA_VIBVY      L--FQSKPDFQIMKELTERSEEYSRGMSEMDWIRSLYNDCKKSNEGKFE--MPEFDEFWELDFGQ-----
TORA_VIBVU      L--FQSKPDFQIMKELTERSEEYSRGMSEMDWIRSLYNDCKKSNEGKFE--MPEFDEFWELDFGQ-----
NAPA_RHIME      PG--EARSDLWQMVEFSKRFTTDEVWSTDILDANPGYRGKTLYDVLFKNGNVDSFPAS-EINKEYANREA
NAPA_BORPA      PG--QARSDLWQLVEFSKRFKVEEVWPADLLAKKPEYRGKTLYDVLFANGKVNQFPNT-ELDPEYANQEA
NAPA_BORBR      PG--QARSDLWQLVEFSKRFKVEEVWPADLLAKKPEYRGKTLYDVLFANGKVNQFPNT-ELDAEYANQEA
TORA_ECOLI      PPQFEARNDFDIFRELCRRFNREEAFTEGLDEM--------GWLKRIWQEGVRGVHLPAFDDFWNNKEYV
TORA_ECO57      PPQFEARNDFDIFRELCRRFNREEAFTEGLDEM--------GWLKRIWQEGVRGVHLPAFDDFWNNKEYV
NAPA_VIBPA      ---GDAKSDLWQVMEFSKRFKMEEVWPEELLAKAPQYRGKTMYDMLF------KNGQVDKFPLEEARELN
BISC_RHOSH      GQAIEARSDFDIFNALVAAAFNEGRDEMGYEESRNHAQRHHHFEMPDFET-------FWAQGHAPC--PV
TORA_ECOL6      PPQFEARNDFDIFRELCRRFNREEAFTEGLDEM--------GWLKRIWQEGVRGVHLPAFNDFWNNKEYV
NAPA_VIBSL      ---GEAKSDLWQIMEFSKRFTVEEVWGEELLAKAPEYRGKTMYDVLYKNGNVDAFPLS---EAQELNDDA
NAPA1_PHOPR     KSQGDSKSDLWQLMEFSKRFKIEEVWGEDLLAQMPEYRGKTMYEVLFRNGQVDKFPLS---EAQELNDDA
NAPA_VIBFM      QAKGEAKSDLWQIMEFSKRFKVEEVWGEELVAKAPEYRGKTMYDILFKNGQVDAFPLS---EAQELNDDA
NAPA_VIBF1      QAKGEAKSDLWQIMEFSKRFKVEEVWGEELVAKAPEYRGKTMYDILFKNGQVDAFPLS---EAQELNDDA
NAPA_METS4      APG-DARSDLWQLMEFSKRFTTDEVWAQEILVAHPDYKGKSLFDVLWRNGSVDRFGDEIAADHENFES--
TORZ_HAEIN      PPQFEAKNDYDIFVELAKRAGVEKTEMEWLEEFYXXXXXXXXXXXXXMPRFDKFWAENKPLSFEAGEAAK
NAPA_COLP3      PEG--AKSDMWQLVEFSKRFKVEDVWPEELIAKKPEVRG-----KTLFD-VLYKDASVGKFPLSEIPEDR
FDHL_STAHJ      ----------------------------------------------------------------------
NAPA_DINSH      G---EAKSDLWQLMEFSKRFTIEEVWGEELLAKMPEHRGKTMYDVLFANGKVDKLSETAE-GFD--NDES
NAPA_PSEU5      PG--EARSDLWQLVEFSKRFRVDEVWPAELLSK-----APEFKDKTLFD-VLFKNGQVDRFSNDEIAEGA
NAPA_PSEST      PG--EARSDLWQLVEFSKRFRVDEVWPAELLSK-----APEFKDKTLFD-VLFKNGQVDRFSNDEIAEGA
NAPA_PSEAE      PG--EAKSDLWQLVEFSKRFTTDEVWPAELLAKAPELKGKTLYDVLFRNGQVDRFPAS-DLAKGYANDEV
NAPA_AERHH      PEG--AKSDLWQLMEFSKRFKVEEVWPAELIAKMPEVKGKTLFDVLYANGQVNQFPK------EQSKGAL
FDHA_DESGI      ----------------------------------------------------------------------
NAPA_PSEAB      PG--EAKSDLWQLVEFSKRFTTDEVWPAELLAKAPELKGKTLYDVLFRNGQVDRFPAS-DLAKGYANDEV
NAPA_VIBVU      ---GEAKSDLWQVMEFSKRFKMEEVWPEELLAKAPQYRGKTMYDMLFANGQVDKFPLS---EARQLNDDS
NAPA_BURXL      PAG--ARSDLWQLVEFSKRFKVEEVWPADLLAKKPEYRGKTLYDVLYRNGQVDRFALT-ETDSHYRNDEA
YYAE_BACSU      QG--EAKSDSWIWSELAKRGFGE---------------LFEYSTQEFLEMGLSSL-EAEDVTLERLKE--
NAPA_VIBVY      ---GEAKSDLWQVMEFSKRFKMEEVWPEELLAKAPQYRGKTMYDMLFANGQVDKFPLS---EARQLNDDS
NAPA_PSEA8      PG--EAKSDLWQLVEFSKRFTTDEVWPAELLAKAPELKGKTLYDVLFRNGQVDRFPAS-DLAKGYANDEV
NAPA_MAGSA      G---EAKSDLWQIME-----FSKRFKIEEVWPEELLAKKPELRGKTLFD-VLYKNGQVDKFPATDIQAGF
NAPA_AGRT5      -ASGEARSDLWQLVEFSKRFTTDEAEILDANPAYRGKTLYE---------VLYKDSDVGKFPLSEINADY
NAPA_PSEMY      PG--EAKSDLWQLVEFSKRFTTDEVWPAELLAKAPDYKGKTLYQVLFANGQVDQFPSE-QIEAGYANDEA
FDHL_BACSU      ----------------------------------------------------------------------
NASC_BACSU      ----------------------------------------------------------------------
NAPA_PSEA7      PG--EAKSDLWQLVEFSKRFTTDEVWPAELLAKAPELKGKTLYEVLFRNGQVDRFPAS-DLAKGYANDEV
NAPA_BRASB      PG--EARSDLWQLMEFSKRFKIEEVWPEELIAKKPDVRG-----KTLFD-VLYKNGQVDKFPLDQIEAGY
NASA_KLEOX      ----------------------------------------------------------------------
NAPA_RALEJ      PG--DARSDLWQLMEFSKRFKVEEVWPAELVAKKPEYKG-----KTLFDVLYRN-GQVDKFPIKEVNAEA
NAPA_HAES2      G---EAKSDLWQLVEFSKYFTTDEVWPAEILAKNPAYQGKTLYEVLYLNGQVNQYSN------DELKGRL
NAPA_PASMU      PG--ESKSDVWQLVEFSKYFTTDEMWPAEVLAANPEYKGKTLYEVLFRNGQVDKFVPTDKPGY--MNDEA
NAPA_PARPN      PG--EARSDLWQMMEFSTRVWPE--EILAANPNYRGQSLFD---------VLFRNGSVDRFDLSELNPVT
NAPA_HAES1      G---EAKSDLWQLVEFSKYFTTDEVWPAEILAKNPAYQGKTLYEVLYLNGQVNQYSN------DELKGRL
NAPA2_PHOPR     PG--ESKPDLWQLMEFSKRFKTDEVWPKELLDSNPDYKGKTLFDVLFINGNVNKLAEGTLNDFEEYAEFG
NAPA_MAGMG      QGSGRGRSDLWQIME-----FSKRFKIEEVWPEELIAKKPELRGKTLFE-VLYKNGQVDKFPLTELQAGF
NAPA_BRASO      PG--EARSDLWQLMEFSKRFKIEDVWPEELIAKKPDVRG-----KTLFD-VLYKNGQVDKFPLDQIEPGY
NARG_BACSU      ----------------------------------------------------------------------
NARB_SYNE7      ----------------------------------------------------------------------
NAPA_CUPTR      PG--EARSDLWQLMEFSKRFKVEDVWPADLIAKKPEYRG-----KTLFDVLYRN-GQVDKFPLKEVNAEY
TORA_SHEMA      L--FDSLSDF----EIFTRFAAVLGKEKEYTRNMGEMEWLEYNECKAANAGMPDFATFWKQGYVHFG---
NAPA_ACTAC      G---EAKSDVWQLVEFSKYFTTDEMWPAEILDKNPEYKGKTLYD------VLYRNGQVDKFPLSELAEGQ
TORA_VIBCH      L--FQSRTDFEIMTELTRRFGREKEYTRGMDEMEWVRSLYDECKKKF---AMPEFEEFWEKGFLDF----
TORA_SHEON      L--FESLSDF----EIFTRFAALLGKEKEYTRNMSEMEWIEYNECKAANAGKYEMATFWKQGYVHFGE--
NAPA_AERS4      PEG--AKSDLWQLMEFAKRFKVEEVWPAELIAKQPELKGKTLFDVLYANGQVDQFKEQSKGEFNDESESF
NAPA_SHEON      PEG--AKSDLWQLVEFSKRFKVAEVWPAELIAKKPEYADKTLYEVLFANGVINKFPTT---DCKDLNDES
NAPA_LARHH      PG--EAKSDLWQVVEFSKRFKVEEVWPAELVAKKPEYRGKTLYDVLFANGQVNK----YKLDTAYHNEEA
NAPA_RHOS4      PG--EARSDLWQLMEFSKRFTTDEVWPEEILSAAPAYRGKTLFEVLFANGSVDRFASDVNPDHANHEAAL
NAPA_SHEDO      PG--ESKSDLWQLMEFSKRFTTDEVAVLDANPKYKGKTLFE-----------------------------
NAPA_VIBCM      ---GESHSDSWQVIEFSKRFKVEDVWPEELLAKAPQYRGKTLYDVLFKNGQVDKFPLS---EARELNDDA
NAPA_VIBCH      ---GESHSDSWQVIEFSKRFKVEDVWPEELLAKAPQYRGKTLYDVLFKNGQVDKFPLS---EARELNDDA
NAPA_VIBC3      ---GESHSDSWQVIEFSKRFKVEDVWPEELLAKAPQYRGKTLYDVLFKNGQVDKFPLS---EARELNDDA
YJGC_BACSU      ----------------------------------------------------------------------
DMSA_RHOCA      ----------------------------------------------------------------------
NARB_SYNY3      ----------------------------------------------------------------------
NAPA_YERE8      APG-EAKSDLWQMVEFAKRFKVEEVWPDELINKKPEYRGKTLYDVLFANNVVNKYPLS-EIPADQLNDEA
NAPA_RALEH      PG--EARSDLWQLVEFAKRFKVEEVWPPELIAKKPEYKGKTLYD--------------------------
TORZ_ECOL6      ----------------------------------------------------------------------
NAPA_LEPCP      G---EARSDLWQMMEFSKRFKIEDVWTAELIAKKPAVKGKTLFDVLFRNGKVDKLADLTKVNAKYIKDYT
NAPA_BRAJA      APG-ESKSDLWQLME-----FSKRFKIEEVWPEELIAKKPEVRGKTLFD-VLYKNGQVDKFPVSDIEQGY
NAPA_ACTPJ      G---ESKSDLWQIVEF--------SKYFKTDEVWALLAQMPEYRGKTLYEVLYKNGQVDKFDTPTINDEA
NAPA_ACTP7      G---ESKSDLWQIVEF--------SKYFKTDEVWALLAQMPEYRGKTLYEVLYKNGQVDKFDTPTINDEA
NAPA_ACTP2      G---ESKSDLWQIVEF--------SKYFKTDEVWALLAQMPEYRGKTLYEVLYKNGQVDKFDTPTINDEA
DMSA_RHOSH      L--YEARSDYDIFAALAER-LGKGAEFTEGRDEMGWISSF--YEAAVKQAEFKNVAMPSFEDFEGIVEFP
TORZ_ECOLI      ----------------------------------------------------------------------
TORZ_ECO57      ----------------------------------------------------------------------
NAPA_NITSB      ----------------------------------------------------------------------
NARG_ECOLI      ----------------------------------------------------------------------
NAPA_HAEPS      ----------------------------------------------------------------------
NAPA_BORPD      G---ESRSDLWQYLEFAKRFKIEEVWPAELLDKKPEYRGKTLYDVLYANGVVNRLADVGVVNKHAINDES
NAPA_EDWI9      PG--EAKSDLWQLMEFSKR---------------------------------------------------
NARZ_ECOLI      ----------------------------------------------------------------------
NARB_SHEFN      ----------------------------------------------------------------------
NAPA_CAMFF      ----------------------------------------------------------------------
NAPA_HELHP      ----------------------------------------------------------------------
NAPA_SHEHH      PEG--AKSDLWQLMEFSKRFKVSEAELIAKQPELADKTLFD-----------------------------
TORA_SALTY      ----------------------------------------------------------------------
TORA_SALTI      ----------------------------------------------------------------------
NAPA_RALPJ      ----------------------------------------------------------------------
NAPA_CAMJR      ----------------------------------------------------------------------
NAPA_CAMJJ      ----------------------------------------------------------------------
NAPA_CAMJE      ----------------------------------------------------------------------
NAPA_CAMJ8      ----------------------------------------------------------------------
NAPA_CAMLR      ----------------------------------------------------------------------
NAPA_NAUPA      ----------------------------------------------------------------------
NAPA_WOLSU      ----------------------------------------------------------------------
NAPA_CAMHC      ----------------------------------------------------------------------
TORZ_HAEIN      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           ERDGFYILKKKTYETRPYKTPLGTPSGKVEIYTLRALKYGIDPLPDWIPPVYKIPQASDEFYLVNGKDNF
PHSA_SALTY      ARYPGAIATDSD-NTYGEQLRFKSPSGKIELYTLEELGYGVPRVRDF------ALKKENELYFIQGKTNG
YNFE_ECOLI      --NGHFV-AYKAFRDDPEANPLKTPSGKIEIYSSRLAEIAISPLPGWNSPERRTFPLQLFGFHYKSRTHS
YNFF_ECOLI      -----GIFKKKAFREDPQANPLKTPSGKIEIYSERLAKIAIHPLPGWDDPLRKTYPLQLTGFHYKARTHS
DMSA_HAEIN      DPNGFKV-AYKDFRDNPEAHPLKTPSGKIEIYSSRLAEIAIHPLPIHAPLMEKYPQLSGFHYKARTHSTY
PSRA_WOLSU      ----------------------------------------------------------DELYFVQGKTPV
DMSA_ECOLI      KRDGHHV-AYKAFREDPQANPLTTPSGKIEIYSQALADIAIDPLPIYTPESYQDPLNKQYPLQLTGFHYK
DDHA_RHOSU      ----------------------------------------------------------------------
SERA_THASE      KR-GFVGVGPSAGKTKPYKVPYKTLTGRLQFYTVPKPQYGGGVLPKKYPFVYNTPHTRW------GVHSF
CLRA_IDEDE      ----------------------------------------------------------------------
YOAE_BACSU      EIDYDSLTKKAKREKPLFPGELPTPSGKIELYSEKMKQDGFPALPTYTPPFMYVPGPNHNF--LNSTFSN
NAPA_DESDA      ----------------------------------------------------------------------
NAPA_SYMTH      QERG---LRWPVNDKQPAGTTLGKPDGKAVIYA----RPHRDPA--------EVPDAEYPFYLSTGRILE
FDHL_STAAB      ----------------------------------------------------------------------
FDHL_STAAW      ----------------------------------------------------------------------
FDHL_STAAS      ----------------------------------------------------------------------
FDHL_STAAN      ----------------------------------------------------------------------
FDHL_STAAM      ----------------------------------------------------------------------
TORA_PASMU      FPEGEPWVRHADFREDPELHALGTPSGFIEIFSNKIASYGYADCPMWFEKAERSPKSDKYPFWLQSAHPD
FDHL_STAAR      ----------------------------------------------------------------------
FDHA_METJA      ----------------------------------------------------------------------
FDOG_ECOLI      ----------------------------------------------------------------------
FDHL_STAAC      ----------------------------------------------------------------------
FDHL_STAA8      ----------------------------------------------------------------------
FDHL_STAA3      ----------------------------------------------------------------------
TORA_VIBPA      EKEGKPWVRHADFRKDPELNPLGTPSGFIEITSRKIGRYGYEHCPMWF-------EKSERSHGGPGSDKY
NAPA_VIBHB      HHFGYYVQKGLFEEYATFGRGHGHDLAPYDVYTVRGLRW---PVVDGKETQWRFKEGSDDFYNADGKAKI
FDHA_METFO      ----------------------------------------------------------------------
FDHL_STAS1      ----------------------------------------------------------------------
NAPA_SACD2      DAFGFYIQKGLFEEYAEFGRGHGHDLADFDRYTLWRYREGSDPYPDYEPPA-ESPNKEYPFWLCTGREHW
FDHF_ECOLI      DQGTSYLFKEK----------FDTPNGLAQFFTC-----------DWVAPIDKL---TDEYPMVLSTVRE
BISC_ECOLI      NPDSERFIRFADFCRDPLAHPLKTASGKIEIFSQRIADYGYPDCPGWLEPDEWQGNAEPEQLQVLSAHPA
NAPA_PSYIN      RDFGFYIQKGLFEEYASFGRGHGHDLAPFDQYTLWRFREGYDPYPDKKAVIFALPESPDQEYLSTGREHW
FDNG_ECOLI      ----------------------------------------------------------------------
FDXG_HAEIN      ----------------------------------------------------------------------
TORA_VIBVY      ---GQPWVRHADFRQDPEINPLGTPSGFIEITSRKIGRYGYEHCPMWFEKSERSPGSDKHPFWLQSCHPD
TORA_VIBVU      ---GQPWVRHADFRQDPEINPLGTPSGFIEITSRKIGRYGYEHCPMWFEKSERSPGSDKHPFWLQSCHPD
NAPA_RHIME      EAFGFYIQKGLFEEYASFGRGHGHDLAPYDRYTLWRYREGYDPYPDGKAVILAVPSPDDEYWLVTGREHW
NAPA_BORPA      QAFGFYLQKGLFEEYAEFGRGHGHDLAPFDVYKARGLRW---PVVDGKETLWRYREGSDPY---------
NAPA_BORBR      QAFGFYLQKGLFEEYAEFGRGHGHDLAPFDVYKARGLRW---PVVDGKETLWRYREGSDPY---------
TORA_ECOLI      EFDPQMFVRHQAFREDPDLEPLGTPSGLIEIYSKTIADMNYDDCPMWFPGSQKYPLHLQSVHPDFRLHSQ
TORA_ECO57      EFDPQMFVRHQAFREDPDLEPLGTPSGLIEIYSKTIADMNYDDCPMWFEKIERSGSQTYPLHLQSVHPDF
NAPA_VIBPA      DDSGFYVQKGLFEEYATFGRGHGHDLAPYDVYTVRGLRW---PVVDGKETQWRFKEGSDPY---------
BISC_RHOSH      QRDHTYL---AAFREDPGAHPLDTESGLIVLATLARLGYACGPHPAWIEPAEWLGKAAGELHLISHQPKG
TORA_ECOL6      EFDPQMFVRHQAFREDPDLEPLGTPSGLIEIYSKTIADMNYDDCPMWFPGSQKYPLHLQSVHPDFRLHSQ
NAPA_VIBSL      QAQGFYVQKGLFEEYAAFGRDHGHDLAPYDTYTLWRFKEGSDPAPYEAPP--EVPSDEYDMWLCTGREHW
NAPA1_PHOPR     KAQGFYLQKGLFEEYAAFGRGHGHDLAPYDVYQVRGLRW---PVVDGKETLWRFVEGSDRFYKPDGKANI
NAPA_VIBFM      KAQGFYVQKGLFEEYASFGRGHGHDLAPYDTYTLWRFKEGSDPYADWISAPYEAPPENDEFWLCTGREHW
NAPA_VIBF1      KAQGFYVQKGLFEEYASFGRGHGHDLAPYDTYTLWRFKEGSDPYADWISAPYEAPPENDEFWLCTGREHW
NAPA_METS4      KQFGFYVQK-------------------------------------------------------------
TORZ_HAEIN      KW-----VRYGEFREDPLLNPLGTPSGKIEIFSDVVEKMNYNDCPSWMEPEEFAGNVTEEYPLALVTPHY
NAPA_COLP3      LNDGFYIQKGHAHDLAPYERGLRWPNGK---ETKWRFKEGSDPYSDWYEPAAESPDEEYDLWLSTGREHW
FDHL_STAHJ      ----------------------------------------------------------------------
NAPA_DINSH      EHFGYYVQKGLFEEYAGFGRGKAHDLASFETYTLYRFREGYDPVPEYAPPAPEVPDAEFDLWLCTGREHW
NAPA_PSEU5      EAFGFYLQKKETWRYREGYDPYVEAGSGVQFYGNADKKAIIFALPYEVPA--EVPDEEYPFWLSTGREHW
NAPA_PSEST      EAFGFYLQKKETWRYREGYDPYVEAGSGVQFYGNADKKAIIFALPYEVPA--EVPDEEYPFWLSTGREHW
NAPA_PSEAE      DAFGFYIQKGLFEEYAAFGRGHGHDLAPFDAYEARGLRWGYDPYPDKKAIVFALPEAPDQFWLATGREHW
NAPA_AERHH      EHFGFYVQKGLFEEYATFGRGHGHDLAPFDQYTLWRYREGFDPYPDGKAVIFALPEAPDKEYDMWLSTGR
FDHA_DESGI      ----------------------------------------------------------------------
NAPA_PSEAB      DAFGFYIQKGLFEEYAAFGRGHGHDLAPFDAYEARGLRWGYDPYPDKKAIVFALPEAPDQFWLATGREHW
NAPA_VIBVU      HHFGFYVQKGLFEEYAEFGRGHGHDLAPYDVYTVRGLRW---PVVDGKETLWRYKEGSDPY---------
NAPA_BURXL      KAFGFYIQKGLFEEYASFGRGHGHDLAPFDAYTRWRYKEGSDPYPDGRAVIYEVPDKEYPFWLATGREHW
YYAE_BACSU      --KGHLPLPVKQVPWDDYQ--FLTPSGKFEFTSSLAEQKG------------------------------
NAPA_VIBVY      HHFGFYVQKGLFEEYAEFGRGHGHDLAPYDVYTVRGLRW---PVVDGKETLWRYKEGSDPY---------
NAPA_PSEA8      DAFGFYIQKGLFEEYAAFGRGHGHDLAPFDAYEARGLRWGYDPYPDKKAIAFALPEAPDQFWLATGREHW
NAPA_MAGSA      ENDGFYPQKGLFEEYASFGRGHAHDLAPFEAYTLWRFREGYDPYPDWIQPAAESPDKEFDLWLSTGREHW
NAPA_AGRT5      KNQGFYLQKGLFEEYAAFGRGHGHDLAPYDAYTLWRYREGYDPAVPYEPPA-ESPDQEFDTWLVTGREHW
NAPA_PSEMY      EAFGFYLQK-------------------------------------------------------------
FDHL_BACSU      ----------------------------------------------------------------------
NASC_BACSU      ----------------------------------------------------------------------
NAPA_PSEA7      DAFGFYIQKGLFEEYAAFGRGHGHDLAPFDAYEARGLRWGYDPYPDKKAIVFALPEAPDRFWLATGREHW
NAPA_BRASB      ANDGFYVHKGLFEEYAAFGRGHGHDLAPFEAYTRWRFREGSDPFPDGKARIFALPESPDKFWLSTGREHW
NASA_KLEOX      ----------------------------------------------------------------------
NAPA_RALEJ      QAFGFYVQK-------------------------------------------------------------
NAPA_HAES2      NDEGFYIQKGLFEEYASFGRGHGHDLADFDTYTLWRYREGYDPLAVPYEPPAEVPDRKYDLWLTTGREHW
NAPA_PASMU      EHFGFYLQKGLFEEYAVFGRGHGHDLADFETYTLWRYREGYDPYPDKKAIILAVPYXXXDLWLTTGREHW
NAPA_PARPN      NAFGFYVQKGLFEEYAPFGRGHGHDLAPYDTYTLWRYREGLDP--------YVEPGAGVQFYLVTGREHW
NAPA_HAES1      NDEGFYIQKGLFEEYASFGRGHGHDLADFDTYTLWRYREGYDPLAVPYEPPAEVPDREYDLWLTTGREHW
NAPA2_PHOPR     RGHGHDLAPFDMYETRGLRWPV--VDGKETLWRYRE---GSDPYPDGKAIIFALPESPDEEYLSTGREHW
NAPA_MAGMG      ENDGFYPQKGLFEEYASFGRGHAHDLAPFESYTLWRFREGYDPYPDWIAPAAESPDKDFDLWLSTGREHW
NAPA_BRASO      ANDGFYVHKGLFEEYASFGRGHGHDLAPFEAYTRWRFREGSDPFPDGKARIFALPESPDKFWLSTGREHW
NARG_BACSU      ----------------------------------------------------------------------
NARB_SYNE7      ----------------------------------------------------------------------
NAPA_CUPTR      HNAGFYVQK-------------------------------------------------------------
TORA_SHEMA      --DGEVWTRHADFRNDPEINPLGTPSGLIEIFSRKIDQFGYDDCPTWMEKTERSPGSDKHPIWLQSCHPD
NAPA_ACTAC      LNDGFYLQKGLFEEYASFGRGHGHDLASFDTYTLWRYREGYDPYPDKKAIILAVPESPDEEYLCTGREHW
TORA_VIBCH      -GTGTPWVRHADFRKDPEINALGTPSGFIEITSRKIGRYGYEHCPMWFEKTERSPGSDKHPFWLQSCHPD
TORA_SHEON      ---GELWTRHADFRNDPEINPLGTPSGLIEIFSRKIEQFGYDDCPMWMEKAERSPGSNKYPMWLQSCHPD
NAPA_AERS4      ---GFYVQKGLFEEYATFGRGHGHDLAPFDQYTLWRYREGFDPYPDGRAVIFALPEAPDKEYDMWLSTGR
NAPA_SHEON      EHFSFYVQKDRYHETRGLRWPVVN-----DKETLRRFVEGSDPYPDGYEPAAEEPNSEYDLWMSTGREHW
NAPA_LARHH      RHVGFYLQKGLFEEYAAFGRGHGHDLALFDTYTLWRYREGFDPLP--FEPAAEVPDREYNMWLCTGREHW
NAPA_RHOS4      --FGFYPQKGLFEEYAAFGRGHGHDLAPFDTYEVRGLRWGFDPYPDGRAVILGVPESPDEFWLVTGREHW
NAPA_SHEDO      ----------------------------------------------------------------------
NAPA_VIBCM      HHFGFYIQKGLFEEYAEFGRGHGHDLAPYDVYQVRGLRW---PVVDGKETKWRFKEGSDPY---------
NAPA_VIBCH      HHFGFYIQKGLFEEYAEFGRGHGHDLAPYDVYQVRGLRW---PVVDGKETKWRFKEGSDPY---------
NAPA_VIBC3      HHFGFYIQKGLFEEYAEFGRGHGHDLAPYDVYQVRGLRW---PVVDGKETKWRFKEGSDPY---------
YJGC_BACSU      ----------------------------------------------------------------------
DMSA_RHOCA      ----------------------------------------------------------------------
NARB_SYNY3      ----------------------------------------------------------------------
NAPA_YERE8      RDFGFYIQK-------------------------------------------------------------
NAPA_RALEH      ----------------------------------------------------------------------
TORZ_ECOL6      ------------FRADPVKNALGTPSGKIEIYSRTLEKFGYKDCPTWLPDEWKGTADEKQLQLLTAHPAH
NAPA_LEPCP      NDEGFYVQKGLFEEYAEFGRGHGHDLAPFDVYTLWRFREGYDPLP--YQPAAESPDKEYDLWLCTGREHW
NAPA_BRAJA      LNDGFYVHK-------------------------------------------------------------
NAPA_ACTPJ      EHFGYYLQKGLFEEYAAFGRGHGHDLADFDTYTLWRYREGFDPYPDKKAIILGVPESPDEEYLCTGREHW
NAPA_ACTP7      EHFGYYLQKGLFEEYAAFGRGHGHDLADFDTYTLWRYREGFDPYPDKKAIILGVPESPDEEYLCTGREHW
NAPA_ACTP2      EHFGYYLQKGLFEEYAAFGRGHGHDLADFDTYTLWRYREGFDPYPDKKAIILGVPESPDEEYLCTGREHW
DMSA_RHOSH      ITEGANFVRYADFREDPLFNPLGTPSGLIEIYSKNIEKMGYDDCPTWMEPAERLGGAGAKYPL-------
TORZ_ECOLI      ------------FRADPVKNALGTPSGKIEIYSKTLEKFGYKDCPTWLPDEWKGTADEKQLQLLTAHPAH
TORZ_ECO57      ------------FRADPVKNALGTPSGKIEIYSKTLEKFGYKDCPTWLPDEWKGTADEKQLQLLTAHPAH
NAPA_NITSB      ----------------------------------------------------------------------
NARG_ECOLI      ----------------------------------------------------------------------
NAPA_HAEPS      ----------------------------------------------------------------------
NAPA_BORPD      QHFGFYVQK-------------------------------------------------------------
NAPA_EDWI9      ----------------------------------------------------------------------
NARZ_ECOLI      ----------------------------------------------------------------------
NARB_SHEFN      ----------------------------------------------------------------------
NAPA_CAMFF      ----------------------------------------------------------------------
NAPA_HELHP      ----------------------------------------------------------------------
NAPA_SHEHH      ----------------------------------------------------------------------
TORA_SALTY      ----------------------------------------------------------------------
TORA_SALTI      ----------------------------------------------------------------------
NAPA_RALPJ      ----------------------------------------------------------------------
NAPA_CAMJR      ----------------------------------------------------------------------
NAPA_CAMJJ      ----------------------------------------------------------------------
NAPA_CAMJE      ----------------------------------------------------------------------
NAPA_CAMJ8      ----------------------------------------------------------------------
NAPA_CAMLR      ----------------------------------------------------------------------
NAPA_NAUPA      ----------------------------------------------------------------------
NAPA_WOLSU      ----------------------------------------------------------------------
NAPA_CAMHC      ----------------------------------------------------------------------
TORZ_HAEIN      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           VSAHMVMVKNAKWIADRTVWMNPADAERLGIKDGDVVELEGLDNGFKAMAVVKVTNRVKPGVLFTYAFVG
PHSA_SALTY      ATQYVPLLSELMW--DNAVWVHPQTAQEKGIKTGDEIWLENATGKEKGKAL--VTPGIRPDTLFVY----
YNFE_ECOLI      TYGNIDLLKAA---CRQEVWINPIDAQKRGIANGDMVRV--FNHRGEVRLPAKVTPRILPGV--------
YNFF_ECOLI      SYGNIDVLQQA---CPQEVWINPIDAQARGIRHGDTVRV--FNNNGEMLIAAKVTPRILPGV--------
DMSA_HAEIN      GNVDVLKAAN-----PQEVWMNPIDAEPRNIKNGDMIRIFN-DRG-EVHINVKITPRIIPGVV-------
PSRA_WOLSU      RSSH---TGNVPWLNNLAIWIHPKTASKLGIKNGDAIELYNKFSSQKSKAL--ITEGVREDTLFGY-FGF
DMSA_ECOLI      SRVHSTYVDVLKAACRQEMWINPLDAQKRGIHNGDKVRIFN-DRG-EVHIEAKVTPRMMPGVV-------
DDHA_RHOSU      ----------------------------------------------------------------------
SERA_THASE      ARTDQWMLRHQRGEPD--VRLNPAAMARKGIKDGDQVRIFNSSGEFFAMA--------------------
CLRA_IDEDE      ----------------------------------------------------------------------
YOAE_BACSU      NEKHIKLEKTPK------LFINTKDAEKHGIVDGAPVRI--WNSRGECELTAAVGEQVLPGVV-------
NAPA_DESDA      ----------------------------------------------------------------------
NAPA_SYMTH      HWHTITMTKRVKGAGEFYCEIHEEDAARLGIQNGDLVKL-------------------------------
FDHL_STAAB      ----------------------------------------------------------------------
FDHL_STAAW      ----------------------------------------------------------------------
FDHL_STAAS      ----------------------------------------------------------------------
FDHL_STAAN      ----------------------------------------------------------------------
FDHL_STAAM      ----------------------------------------------------------------------
TORA_PASMU      KRLHSQLLRETYAIQDRPLFINPEDAKRLGIVHGDLVRVYN-DRG-QAIVGAHVSDNFPQGVL-------
FDHL_STAAR      ----------------------------------------------------------------------
FDHA_METJA      ----------------------------------------------------------------------
FDOG_ECOLI      ----------------------------------------------------------------------
FDHL_STAAC      ----------------------------------------------------------------------
FDHL_STAA8      ----------------------------------------------------------------------
FDHL_STAA3      ----------------------------------------------------------------------
TORA_VIBPA      PRLHSQMCESEEFRATEPVYINPIDAKAKGIKDGDLVRV-------------------------------
NAPA_VIBHB      ISAPYTMTRRVKAVPDAVVYMHPADAKKRNVRRGEEV---------------------------------
FDHA_METFO      ----------------------------------------------------------------------
FDHL_STAS1      ----------------------------------------------------------------------
NAPA_SACD2      HSGSMTVPELYKAFPDAVCFMHPEDARSAGLRRGDKVKLQSIRGHIITRIETRGRNKPPKGLVF------
FDHF_ECOLI      VGHYSCMTGNCAALAALAAQINTEDAKRLGIEDEALVWVHSRKG--KIITRAQVSDRPNKGAIYTYQWWI
BISC_ECOLI      HRLHSQLLRELYAVANRPVTIHPDDAQERGIQDGDTVRLWNARGQILAGAV--ISEGIKPGVI-------
NAPA_PSYIN      HSGSMTVPELYKAFPDAVVFMHPDDATARGVRRGDEIVLASRRGELTSRVETRGRNRPPRGLVF------
FDNG_ECOLI      ----------------------------------------------------------------------
FDXG_HAEIN      ----------------------------------------------------------------------
TORA_VIBVY      KRLHSQMCESEEFRATEPVYINPLDAKAKGIKEGDLVRV-------------------------------
TORA_VIBVU      KRLHSQMCESEEFRATEPVYINPLDAKAKGIKEGDLVRV-------------------------------
NAPA_RHIME      HSGSMTMPELYKAFPGAVCFMNAGDARDRGINQGAEVRIVSRRGEIRARVETRGRNRMPPGVIFVPWFDA
NAPA_BORPA      ----------------------------------------------------------------------
NAPA_BORBR      ----------------------------------------------------------------------
TORA_ECOLI      LCESETLRQQYTVAGKEPVFINPQDASARGIRNGDVVRVFNARGQVLAGAV--VSDRYAPGV--------
TORA_ECO57      -RLHSQLCESETLRQQYTVFINPQDASARGIRNGDVVRVFNARGQVLAGAV--VSDRYAPGV--------
NAPA_VIBPA      ----------------------------------------------------------------------
BISC_RHOSH      RLHSQLETAEASLAGKREVMLHPDDASVRGIADGQTVRLWNARGA--CLATAQVTDSVAAGV--------
TORA_ECOL6      LCESETLRQQYTVAGKEPVFISPKDASARGIRHGDVVRVFNVRGQVLAGAV--VSDRYAPGV--------
NAPA_VIBSL      HTGTMTVPELYKAVPDALCYIHPADAKARGLRRGDEVLIE------------------------------
NAPA1_PHOPR     IXXXXTMTRRVKAVPDALCFIHPDDAQKRGLRRGDEVLLESRRGEVRCRVETRGRNRPPVGLVFVPFF--
NAPA_VIBFM      HTGTMTVPELYKAVPDALCYIHPADAKKRNLRRGDEV---------------------------------
NAPA_VIBF1      HTGTMTVPELYKAVPDALCYIHPADAKKRNLRRGDEV---------------------------------
NAPA_METS4      ----------------------------------------------------------------------
TORZ_HAEIN      YRLHSQLLRQKYAVNDRPVMIHPEDAAARGIKDGDIVRIHSKRG--QVLAGAAVTENIIKGTV-------
NAPA_COLP3      HSGSMTVPELYKAMPDALVYMHPDDAKKRNMRRGDLVKL--ISRRGEVQTRVETRGRNKPPVGLVY----
FDHL_STAHJ      ----------------------------------------------------------------------
NAPA_DINSH      HSGSMTVPELHRAYPAAVVYMHPEDAKARGLRRGQEINISTRRGDMLSRVETRGRNKVPQGLVFVPWFDE
NAPA_PSEU5      HTGSMTQRVDEKAVPDALVYMHPEDARKLNVRRGSVVKIVSRRGEMQGRVETRGRNKPPMGLVYVPFF--
NAPA_PSEST      HTGSMTQRVDEKAVPDALVYMHPEDARKLNVRRGSVVKIVSRRGEMQGRVETRGRNKPPMGLVYVPFF--
NAPA_PSEAE      HTGSMTVPELYKAVPDALVYMHPEDARQLKLRRGSEVKVVSRRGEIRARVETRGRNKPPQGLVFVPFF--
NAPA_AERHH      VLEHWTMTRRVRAFPDAVLFMHPEDAKARGVRRGEEVIVSSRRGEVKTRVETRGRNRPPKGLVF------
FDHA_DESGI      ----------------------------------------------------------------------
NAPA_PSEAB      HTGSMTVPELYKAVPDALVYMHPEDARQLKLRRGSEVKVVSRRGEIRARVETRGRNKPPQGLVFVPFF--
NAPA_VIBVU      ----------------------------------------------------------------------
NAPA_BURXL      HSGSMTVPELYRAFPNAVCFMHPDDAKAMGVRRG--VEVKVMSRRGYILTRVETRGRDKPGLVF------
YYAE_BACSU      ----------------------------------------------------------------------
NAPA_VIBVY      ----------------------------------------------------------------------
NAPA_PSEA8      HTGSMTVPELYKAVPDALVYMHPEDARQLKLRRGSEVKVVSRRGEIRARVETRGRNKPPQGLVFVPFF--
NAPA_MAGSA      HSGSMTVPELHKSVPNAVLYMHPNDAAKRNLRNGDVVKVASRRGEVTTRIDTRGRNKPPEGLVF------
NAPA_AGRT5      HSGSMTMPELYKAFPGARCFMNADDARKRGLNQGAEIRIVSRRGEIRSRVETRGRNRMPPGVIF------
NAPA_PSEMY      ----------------------------------------------------------------------
FDHL_BACSU      ----------------------------------------------------------------------
NASC_BACSU      ----------------------------------------------------------------------
NAPA_PSEA7      HTGSMTVPELYKAVPDAVVYMHPDDARQLKLXXXXXXXXXXXXXXIRARVETRGRNKPPQGLVFVPFF--
NAPA_BRASB      HSGTMTVPELYKAFPEAVCFMHPDDAQEANLRRGDEVKVASRRGFIRARVETRGRDKPPRGLVFVPWF--
NASA_KLEOX      ----------------------------------------------------------------------
NAPA_RALEJ      ----------------------------------------------------------------------
NAPA_HAES2      HTGSMTVPELHRSFPNNLVWMNPNDAKKRGLKHGDKIKVISRRGEITSYIDTRGRNKCPEGLIYTTFFDA
NAPA_PASMU      HTGTMTVPELHRSFPNNLVWMHPLDAKKRGLRHGDKVKISSRRGEMISHLDTRGRNKVPQGLVYTTFFDA
NAPA_PARPN      HSGSMTMRVPELYRAGARCFMNPEDARDMGFNQGAEVRIVSRRGEIRSRVETRGRNRMPRGVVF------
NAPA_HAES1      HTGSMTVPELHRSFPNNLVWMNPNDAKKRGLKHGDKIKVISRRGEITSYIDTRGRNKCPEGLIYTTFFDA
NAPA2_PHOPR     HSGSMTVPELYKAYPDAQVFMHPDDAKSRGLRRGDAVKV--MSRRGEIITRVETRGRNKPPI--------
NAPA_MAGMG      HSGSMTVPELHKSVPNAVLYMHPNDAAKRNLRNGDVVKVASRRGEVTTRIDTRGRNKPPEGLVF------
NAPA_BRASO      HSGTMTVPELYKAFPEAVCFMHPDDAQEANLRRGDEVKVASRRGFIRARVETRGRDKPPRGLVFVPWF--
NARG_BACSU      ----------------------------------------------------------------------
NARB_SYNE7      ----------------------------------------------------------------------
NAPA_CUPTR      ----------------------------------------------------------------------
TORA_SHEMA      KRLHSQMCESREYNGREPVYISPVDAKARGIKDGDIVRV-------------------------------
NAPA_ACTAC      HTGTMTVPELHRSFPNNLVWMHPTDAQKRGLRHGDKVKVASRRGEIISFLDTRGRNKVPEGLIYTTFFDA
TORA_VIBCH      KRLHSQMCEAEAFRATEPVYINPLDAKAKGIKDGDLVRV-------------------------------
TORA_SHEON      HRLHSQMCESKEYRETYTVYISPEDAKTRGIKDGDIVRVFN-DRG-QLLAGAVVSDRFPKGVV-------
NAPA_AERS4      VLEHWTMTRRVRAFPDAVLFMHPEDAKARGVRRGEEVIVSSRRGEVKTRVETRGRNRPPKGLVF------
NAPA_SHEON      HTGSMTVPELYRAYPDAQIFMHPEDAKARGLQRGDEVLVASPRGEIKTRVETKGRNKPPRGVVF------
NAPA_LARHH      HTGSMTVPELYRAVPDAQVFMHPADAELRGLKRGQQVKVISRRGEITLTLETRGRNKPPQGLVFIPFFDE
NAPA_RHOS4      HSGSMTLPELYKAFPGAVCFMHPEDARSRGLNRGSEVRVISRRGEIRTRLETRGRNRMPRGVVF------
NAPA_SHEDO      ----------------------------------------------------------------------
NAPA_VIBCM      ----------------------------------------------------------------------
NAPA_VIBCH      ----------------------------------------------------------------------
NAPA_VIBC3      ----------------------------------------------------------------------
YJGC_BACSU      ----------------------------------------------------------------------
DMSA_RHOCA      ----------------------------------------------------------------------
NARB_SYNY3      ----------------------------------------------------------------------
NAPA_YERE8      ----------------------------------------------------------------------
NAPA_RALEH      ----------------------------------------------------------------------
TORZ_ECOL6      SQLNYAELRKKYAVADRPITIHTEDAARFGIANGDLVRVWNKRGQILTGAV--VTDGIKKGVV-------
NAPA_LEPCP      HTGTMTVPELHRAVPEAQLFMHPDDAKARGLQRGMKVKIASRRGEILLAVETKGRNKVPRGLVFVPFFDE
NAPA_BRAJA      ----------------------------------------------------------------------
NAPA_ACTPJ      HTGTMTVPELHRSFPNNLCWMHPDDAKARGLRHGDKVKLITRRGEIITHLDTRGRNKCPKGLIYTTFFDA
NAPA_ACTP7      HTGTMTVPELHRSFPNNLCWMHPDDAKARGLRHGDKVKLITRRGEIITHLDTRGRNKCPKGLIYTTFFDA
NAPA_ACTP2      HTGTMTVPELHRSFPNNLCWMHPDDAKARGLRHGDKVKLITRRGEIITHLDTRGRNKCPKGLIYTTFFDA
DMSA_RHOSH      ----------------------------------------------------------------------
TORZ_ECOLI      SQLNYAELRKKYAIADRPITIHTEDAARFGIANGDLVRVWNKRGQILTGAV--VTDGIKKGVV-------
TORZ_ECO57      SQLNYAQLRKKYAVADRPITIHTEDAARFGIANGDLVRVWNKRGQILTGAV--VTDGIKKGVV-------
NAPA_NITSB      ----------------------------------------------------------------------
NARG_ECOLI      ----------------------------------------------------------------------
NAPA_HAEPS      ----------------------------------------------------------------------
NAPA_BORPD      ----------------------------------------------------------------------
NAPA_EDWI9      ----------------------------------------------------------------------
NARZ_ECOLI      ----------------------------------------------------------------------
NARB_SHEFN      ----------------------------------------------------------------------
NAPA_CAMFF      ----------------------------------------------------------------------
NAPA_HELHP      ----------------------------------------------------------------------
NAPA_SHEHH      ----------------------------------------------------------------------
TORA_SALTY      ----------------------------------------------------------------------
TORA_SALTI      ----------------------------------------------------------------------
NAPA_RALPJ      ----------------------------------------------------------------------
NAPA_CAMJR      ----------------------------------------------------------------------
NAPA_CAMJJ      ----------------------------------------------------------------------
NAPA_CAMJE      ----------------------------------------------------------------------
NAPA_CAMJ8      ----------------------------------------------------------------------
NAPA_CAMLR      ----------------------------------------------------------------------
NAPA_NAUPA      ----------------------------------------------------------------------
NAPA_WOLSU      ----------------------------------------------------------------------
NAPA_CAMHC      ----------------------------------------------------------------------
TORZ_HAEIN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           GRTSKLISGEYQFLKEGINPQWFTTGKVEPVxxxxxxxxxxxxxxx
PHSA_SALTY      ----------------------------------------------
YNFE_ECOLI      ----------------------------------------------
YNFF_ECOLI      ----------------------------------------------
DMSA_HAEIN      ----------------------------------------------
PSRA_WOLSU      GHVSKDLKRAY-----------------------------------
DMSA_ECOLI      ----------------------------------------------
DDHA_RHOSU      ----------------------------------------------
SERA_THASE      ----------------------------------------------
CLRA_IDEDE      ----------------------------------------------
YOAE_BACSU      ----------------------------------------------
NAPA_DESDA      ----------------------------------------------
NAPA_SYMTH      ----------------------------------------------
FDHL_STAAB      ----------------------------------------------
FDHL_STAAW      ----------------------------------------------
FDHL_STAAS      ----------------------------------------------
FDHL_STAAN      ----------------------------------------------
FDHL_STAAM      ----------------------------------------------
TORA_PASMU      ----------------------------------------------
FDHL_STAAR      ----------------------------------------------
FDHA_METJA      ----------------------------------------------
FDOG_ECOLI      ----------------------------------------------
FDHL_STAAC      ----------------------------------------------
FDHL_STAA8      ----------------------------------------------
FDHL_STAA3      ----------------------------------------------
TORA_VIBPA      ----------------------------------------------
NAPA_VIBHB      ----------------------------------------------
FDHA_METFO      ----------------------------------------------
FDHL_STAS1      ----------------------------------------------
NAPA_SACD2      ----------------------------------------------
FDHF_ECOLI      GACNELVTENLSPITK--TPEYYCAVRVEPI---------------
BISC_ECOLI      ----------------------------------------------
NAPA_PSYIN      ----------------------------------------------
FDNG_ECOLI      ----------------------------------------------
FDXG_HAEIN      ----------------------------------------------
TORA_VIBVY      ----------------------------------------------
TORA_VIBVU      ----------------------------------------------
NAPA_RHIME      SR--------------------------------------------
NAPA_BORPA      ----------------------------------------------
NAPA_BORBR      ----------------------------------------------
TORA_ECOLI      ----------------------------------------------
TORA_ECO57      ----------------------------------------------
NAPA_VIBPA      ----------------------------------------------
BISC_RHOSH      ----------------------------------------------
TORA_ECOL6      ----------------------------------------------
NAPA_VIBSL      ----------------------------------------------
NAPA1_PHOPR     ----------------------------------------------
NAPA_VIBFM      ----------------------------------------------
NAPA_VIBF1      ----------------------------------------------
NAPA_METS4      ----------------------------------------------
TORZ_HAEIN      ----------------------------------------------
NAPA_COLP3      ----------------------------------------------
FDHL_STAHJ      ----------------------------------------------
NAPA_DINSH      GQ--------------------------------------------
NAPA_PSEU5      ----------------------------------------------
NAPA_PSEST      ----------------------------------------------
NAPA_PSEAE      ----------------------------------------------
NAPA_AERHH      ----------------------------------------------
FDHA_DESGI      ----------------------------------------------
NAPA_PSEAB      ----------------------------------------------
NAPA_VIBVU      ----------------------------------------------
NAPA_BURXL      ----------------------------------------------
YYAE_BACSU      ----------------------------------------------
NAPA_VIBVY      ----------------------------------------------
NAPA_PSEA8      ----------------------------------------------
NAPA_MAGSA      ----------------------------------------------
NAPA_AGRT5      ----------------------------------------------
NAPA_PSEMY      ----------------------------------------------
FDHL_BACSU      ----------------------------------------------
NASC_BACSU      ----------------------------------------------
NAPA_PSEA7      ----------------------------------------------
NAPA_BRASB      -DESKLIN--------------------------------------
NASA_KLEOX      ----------------------------------------------
NAPA_RALEJ      ----------------------------------------------
NAPA_HAES2      GQANKLI---------------------------------------
NAPA_PASMU      GQLANYLT--------------------------------------
NAPA_PARPN      ----------------------------------------------
NAPA_HAES1      GQANKLI---------------------------------------
NAPA2_PHOPR     ----------------------------------------------
NAPA_MAGMG      ----------------------------------------------
NAPA_BRASO      -DESKLIN--------------------------------------
NARG_BACSU      ----------------------------------------------
NARB_SYNE7      ----------------------------------------------
NAPA_CUPTR      ----------------------------------------------
TORA_SHEMA      ----------------------------------------------
NAPA_ACTAC      GQLANKLT--------------------------------------
TORA_VIBCH      ----------------------------------------------
TORA_SHEON      ----------------------------------------------
NAPA_AERS4      ----------------------------------------------
NAPA_SHEON      ----------------------------------------------
NAPA_LARHH      GR--------------------------------------------
NAPA_RHOS4      ----------------------------------------------
NAPA_SHEDO      ----------------------------------------------
NAPA_VIBCM      ----------------------------------------------
NAPA_VIBCH      ----------------------------------------------
NAPA_VIBC3      ----------------------------------------------
YJGC_BACSU      ----------------------------------------------
DMSA_RHOCA      ----------------------------------------------
NARB_SYNY3      ----------------------------------------------
NAPA_YERE8      ----------------------------------------------
NAPA_RALEH      ----------------------------------------------
TORZ_ECOL6      ----------------------------------------------
NAPA_LEPCP      GK--------------------------------------------
NAPA_BRAJA      ----------------------------------------------
NAPA_ACTPJ      GQANKLISGETDYKK-------------------------------
NAPA_ACTP7      GQANKLISGETDYKK-------------------------------
NAPA_ACTP2      GQANKLISGETDYKK-------------------------------
DMSA_RHOSH      ----------------------------------------------
TORZ_ECOLI      ----------------------------------------------
TORZ_ECO57      ----------------------------------------------
NAPA_NITSB      ----------------------------------------------
NARG_ECOLI      ----------------------------------------------
NAPA_HAEPS      ----------------------------------------------
NAPA_BORPD      ----------------------------------------------
NAPA_EDWI9      ----------------------------------------------
NARZ_ECOLI      ----------------------------------------------
NARB_SHEFN      ----------------------------------------------
NAPA_CAMFF      ----------------------------------------------
NAPA_HELHP      ----------------------------------------------
NAPA_SHEHH      ----------------------------------------------
TORA_SALTY      ----------------------------------------------
TORA_SALTI      ----------------------------------------------
NAPA_RALPJ      ----------------------------------------------
NAPA_CAMJR      ----------------------------------------------
NAPA_CAMJJ      ----------------------------------------------
NAPA_CAMJE      ----------------------------------------------
NAPA_CAMJ8      ----------------------------------------------
NAPA_CAMLR      ----------------------------------------------
NAPA_NAUPA      ----------------------------------------------
NAPA_WOLSU      ----------------------------------------------
NAPA_CAMHC      ----------------------------------------------
TORZ_HAEIN      ----------------------------------------------