[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL64528.1

[Show Plain Result]


## Summary of Sequence Search
    1::106
    1::106     3e-56 100%  106 aa  RS10_PYRAE RecName: Full=30S ribosomal protein S10P;
    1::106     4e-55  97%  106 aa  RS10_THENV RecName: Full=30S ribosomal protein S10P;
    1::106     7e-54  94%  106 aa  RS10_PYRCJ RecName: Full=30S ribosomal protein S10P;
    1::106     2e-46  85%  106 aa  RS10_PYRIL RecName: Full=30S ribosomal protein S10P;
    1::106     5e-46  84%  106 aa  RS10_PYRAR RecName: Full=30S ribosomal protein S10P;
    7::104     1e-29  54%  106 aa  RS10_ARCFU RecName: Full=30S ribosomal protein S10P;
    5::102     2e-29  55%  104 aa  RS10_THEAC RecName: Full=30S ribosomal protein S10P;
    2::100     2e-29  54%  102 aa  RS10_METTP RecName: Full=30S ribosomal protein S10P;
    5::102     6e-29  54%  104 aa  RS10_THEVO RecName: Full=30S ribosomal protein S10P;
    2::101     1e-28  53%  102 aa  RS10_PYRAB RecName: Full=30S ribosomal protein S10P;
    4::101     1e-28  55%  103 aa  RS10_PICTO RecName: Full=30S ribosomal protein S10P;
    2::101     2e-28  51%  102 aa  RS10_PYRWO RecName: Full=30S ribosomal protein S10P;
    2::101     2e-28  53%  102 aa  RS10_PYRHO RecName: Full=30S ribosomal protein S10P;
    2::101     2e-28  51%  102 aa  RS10_PYRFU RecName: Full=30S ribosomal protein S10P;
    3::101     3e-27  49%  103 aa  RS10_HALMA RecName: Full=30S ribosomal protein S10P;AltName:
    2::100     4e-27  51%  102 aa  RS10_HALSA RecName: Full=30S ribosomal protein S10P;
    2::100     4e-27  51%  102 aa  RS10_HALS3 RecName: Full=30S ribosomal protein S10P;
    2::100     6e-27  54%  102 aa  RS10_METB6 RecName: Full=30S ribosomal protein S10P;
    4::102     7e-27  54%  102 aa  RS10_SULTO RecName: Full=30S ribosomal protein S10P;
    2::100     7e-27  53%  102 aa  RS10_METLZ RecName: Full=30S ribosomal protein S10P;
    4::102     1e-26  53%  102 aa  RS10_SULAC RecName: Full=30S ribosomal protein S10P;
    2::100     1e-26  53%  102 aa  RS10_METPE RecName: Full=30S ribosomal protein S10P;
    2::100     2e-26  48%  102 aa  RS10_NATPD RecName: Full=30S ribosomal protein S10P;
    2::99      2e-26  50%  101 aa  RS10_METJA RecName: Full=30S ribosomal protein S10P;
    2::101     4e-26  49%  102 aa  RS10_THEON RecName: Full=30S ribosomal protein S10P;
    2::101     4e-26  49%  102 aa  RS10_THEGJ RecName: Full=30S ribosomal protein S10P;
    2::101     4e-26  49%  102 aa  RS10_PYRKO RecName: Full=30S ribosomal protein S10P;
    2::100     4e-26  47%  102 aa  RS10_HALLT RecName: Full=30S ribosomal protein S10P;
    4::102     6e-26  52%  102 aa  RS10_SULSO RecName: Full=30S ribosomal protein S10P;
    4::102     6e-26  52%  102 aa  RS10_SULIY RecName: Full=30S ribosomal protein S10P;
    4::102     6e-26  52%  102 aa  RS10_SULIN RecName: Full=30S ribosomal protein S10P;
    4::102     6e-26  52%  102 aa  RS10_SULIM RecName: Full=30S ribosomal protein S10P;
    4::102     6e-26  52%  102 aa  RS10_SULIL RecName: Full=30S ribosomal protein S10P;
    4::102     6e-26  52%  102 aa  RS10_SULIK RecName: Full=30S ribosomal protein S10P;
    4::102     6e-26  52%  102 aa  RS10_SULIA RecName: Full=30S ribosomal protein S10P;
    3::100     6e-26  49%  102 aa  RS10_METTH RecName: Full=30S ribosomal protein S10P;
    2::100     6e-26  51%  102 aa  RS10_METMJ RecName: Full=30S ribosomal protein S10P;
    3::101     6e-26  51%  102 aa  RS10_HYPBU RecName: Full=30S ribosomal protein S10P;
    3::100     8e-26  47%  102 aa  RS10_METST RecName: Full=30S ribosomal protein S10P;
    4::100     8e-26  52%  104 aa  RS10_AERPE RecName: Full=30S ribosomal protein S10P;
    4::102     2e-25  52%  102 aa  RS10_METS5 RecName: Full=30S ribosomal protein S10P;
    2::100     2e-25  47%  102 aa  RS10_METM5 RecName: Full=30S ribosomal protein S10P;
    2::100     4e-25  47%  102 aa  RS10_METMP RecName: Full=30S ribosomal protein S10P;
    2::100     4e-25  47%  102 aa  RS10_METM7 RecName: Full=30S ribosomal protein S10P;
    2::100     4e-25  47%  102 aa  RS10_METM6 RecName: Full=30S ribosomal protein S10P;
    2::100     9e-25  45%  102 aa  RS10_METVS RecName: Full=30S ribosomal protein S10P;
    2::100     3e-24  46%  102 aa  RS10_META3 RecName: Full=30S ribosomal protein S10P;
    3::100     2e-23  44%  102 aa  RS10_METS3 RecName: Full=30S ribosomal protein S10P;
    5::103     2e-23  51%  103 aa  RS10_KORCO RecName: Full=30S ribosomal protein S10P;
    2::100     1e-22  46%  102 aa  RS10_HALWD RecName: Full=30S ribosomal protein S10P;
    2::100     5e-22  45%  102 aa  RS10_METHJ RecName: Full=30S ribosomal protein S10P;
    3::87      2e-21  51%  102 aa  RS10_METKA RecName: Full=30S ribosomal protein S10P;
    3::101     3e-21  38%  102 aa  RS10_CENSY RecName: Full=30S ribosomal protein S10P;
    2::100     4e-21  44%  102 aa  RS10_METMA RecName: Full=30S ribosomal protein S10P;
    2::100     4e-21  44%  102 aa  RS10_METBF RecName: Full=30S ribosomal protein S10P;
    2::100     4e-21  44%  102 aa  RS10_METAC RecName: Full=30S ribosomal protein S10P;
    3::101     8e-21  44%  103 aa  RS10_METBU RecName: Full=30S ribosomal protein S10P;
   17::118     3e-18  33%  120 aa  RS20_DROME RecName: Full=40S ribosomal protein S20;
   19::116     3e-17  35%  118 aa  RS20_SCHPO RecName: Full=40S ribosomal protein S20;
   22::119     7e-17  36%  122 aa  RS202_ARATH RecName: Full=40S ribosomal protein S20-2;
   24::121     7e-17  36%  124 aa  RS201_ARATH RecName: Full=40S ribosomal protein S20-1;
   19::116     9e-17  33%  119 aa  RS20_XENLA RecName: Full=40S ribosomal protein S20;AltName:
   19::116     9e-17  33%  119 aa  RS20_RAT RecName: Full=40S ribosomal protein S20;
   19::116     9e-17  33%  119 aa  RS20_PIG RecName: Full=40S ribosomal protein S20;
   19::116     9e-17  33%  119 aa  RS20_MOUSE RecName: Full=40S ribosomal protein S20;
   19::116     9e-17  33%  119 aa  RS20_MACFA RecName: Full=40S ribosomal protein S20;
   19::116     9e-17  33%  119 aa  RS20_HUMAN RecName: Full=40S ribosomal protein S20;
   19::116     9e-17  33%  119 aa  RS20_BOVIN RecName: Full=40S ribosomal protein S20;
   20::115     2e-16  38%  124 aa  RS20_DICDI RecName: Full=40S ribosomal protein S20;
   26::125     2e-16  33%  128 aa  RS20_ORYSJ RecName: Full=40S ribosomal protein S20;
    2::101     3e-16  46%  102 aa  RS10_SULSY RecName: Full=30S ribosomal protein S10;
   19::116     6e-16  32%  119 aa  RS20_PONAB RecName: Full=40S ribosomal protein S20;
    3::102     1e-15  44%  103 aa  RS10_PERMH RecName: Full=30S ribosomal protein S10;
    4::102     1e-15  43%  102 aa  RS10_DESRM RecName: Full=30S ribosomal protein S10;
    3::102     2e-15  40%  102 aa  RS10_THETN RecName: Full=30S ribosomal protein S10;
    1::103     2e-15  44%  103 aa  RS10_NATTJ RecName: Full=30S ribosomal protein S10;
    2::102     2e-15  46%  102 aa  RS10_LACRJ RecName: Full=30S ribosomal protein S10;
    2::102     2e-15  46%  102 aa  RS10_LACRD RecName: Full=30S ribosomal protein S10;
    1::103     2e-15  40%  103 aa  RS10_CLOTH RecName: Full=30S ribosomal protein S10;
    3::102     3e-15  41%  102 aa  RS10_THEPX RecName: Full=30S ribosomal protein S10;
    3::102     3e-15  41%  102 aa  RS10_THEP3 RecName: Full=30S ribosomal protein S10;
    2::102     4e-15  42%  102 aa  RS10_DESHY RecName: Full=30S ribosomal protein S10;
    2::102     4e-15  42%  102 aa  RS10_DESHD RecName: Full=30S ribosomal protein S10;
    6::101     8e-15  34%  102 aa  RS10_NITMS RecName: Full=30S ribosomal protein S10P;
    1::103     8e-15  38%  103 aa  RS10_CLOCE RecName: Full=30S ribosomal protein S10;
    4::104     8e-15  46%  104 aa  RS10_ALKMQ RecName: Full=30S ribosomal protein S10;
    2::102     1e-14  42%  102 aa  RS10_OCEIH RecName: Full=30S ribosomal protein S10;
   23::116     1e-14  36%  121 aa  RS20_YEAST RecName: Full=40S ribosomal protein S20;
    2::102     1e-14  41%  102 aa  RS10_MOOTA RecName: Full=30S ribosomal protein S10;
    2::102     1e-14  38%  102 aa  RS10_LEUMM RecName: Full=30S ribosomal protein S10;
    2::102     1e-14  38%  102 aa  RS10_LEUCK RecName: Full=30S ribosomal protein S10;
    2::102     1e-14  45%  102 aa  RS10_LACPL RecName: Full=30S ribosomal protein S10;
    2::102     1e-14  45%  102 aa  RS10_LACF3 RecName: Full=30S ribosomal protein S10;
    1::102     2e-14  41%  106 aa  RS10_SOLUE RecName: Full=30S ribosomal protein S10;
    2::102     2e-14  45%  102 aa  RS10_LACBA RecName: Full=30S ribosomal protein S10;
    3::101     2e-14  39%  105 aa  RS10_THETH RecName: Full=30S ribosomal protein S10;
    3::101     2e-14  39%  105 aa  RS10_THET8 RecName: Full=30S ribosomal protein S10;
    3::101     2e-14  39%  105 aa  RS10_THET2 RecName: Full=30S ribosomal protein S10;
    4::102     2e-14  41%  102 aa  RS10_LEIXX RecName: Full=30S ribosomal protein S10;
    2::102     2e-14  40%  102 aa  RS10_LACSS RecName: Full=30S ribosomal protein S10;
    2::102     2e-14  38%  102 aa  RS10_LACDB RecName: Full=30S ribosomal protein S10;
    2::102     2e-14  38%  102 aa  RS10_LACDA RecName: Full=30S ribosomal protein S10;
    2::102     3e-14  40%  102 aa  RS10_OENOB RecName: Full=30S ribosomal protein S10;
    4::104     3e-14  40%  104 aa  RS10_ALKOO RecName: Full=30S ribosomal protein S10;
    4::102     4e-14  40%  103 aa  RS10_SHEWM RecName: Full=30S ribosomal protein S10;
    4::102     4e-14  40%  103 aa  RS10_SHESH RecName: Full=30S ribosomal protein S10;
    4::102     4e-14  40%  103 aa  RS10_SHEPA RecName: Full=30S ribosomal protein S10;
    4::102     4e-14  40%  103 aa  RS10_SHEHH RecName: Full=30S ribosomal protein S10;
    2::102     4e-14  40%  102 aa  RS10_LACCB RecName: Full=30S ribosomal protein S10;
    2::102     4e-14  40%  102 aa  RS10_LACC3 RecName: Full=30S ribosomal protein S10;
    3::102     4e-14  40%  102 aa  RS10_HELMI RecName: Full=30S ribosomal protein S10;
    2::102     4e-14  44%  102 aa  RS10_EXISA RecName: Full=30S ribosomal protein S10;
    2::102     4e-14  38%  102 aa  RS10_COPPD RecName: Full=30S ribosomal protein S10;
    2::102     4e-14  40%  103 aa  RS10_COLP3 RecName: Full=30S ribosomal protein S10;
    2::102     4e-14  39%  102 aa  RS10_CLOK5 RecName: Full=30S ribosomal protein S10;
    2::102     4e-14  39%  102 aa  RS10_CLOK1 RecName: Full=30S ribosomal protein S10;
    2::102     4e-14  41%  102 aa  RS10_CLOBM RecName: Full=30S ribosomal protein S10;
    2::102     4e-14  41%  102 aa  RS10_CLOBL RecName: Full=30S ribosomal protein S10;
    2::102     4e-14  41%  102 aa  RS10_CLOBK RecName: Full=30S ribosomal protein S10;
    2::102     4e-14  41%  102 aa  RS10_CLOBJ RecName: Full=30S ribosomal protein S10;
    2::102     4e-14  41%  102 aa  RS10_CLOBH RecName: Full=30S ribosomal protein S10;
    2::102     4e-14  41%  102 aa  RS10_CLOB6 RecName: Full=30S ribosomal protein S10;
    2::102     4e-14  41%  102 aa  RS10_CLOB1 RecName: Full=30S ribosomal protein S10;
    4::102     4e-14  42%  103 aa  RS10_CHRSD RecName: Full=30S ribosomal protein S10;
    2::102     5e-14  40%  102 aa  RS10_SYMTH RecName: Full=30S ribosomal protein S10;
    4::102     5e-14  41%  103 aa  RS10_SHESR RecName: Full=30S ribosomal protein S10;
    4::102     5e-14  41%  103 aa  RS10_SHESM RecName: Full=30S ribosomal protein S10;
    4::102     5e-14  41%  103 aa  RS10_SHESA RecName: Full=30S ribosomal protein S10;
    4::102     5e-14  41%  103 aa  RS10_SHEON RecName: Full=30S ribosomal protein S10;
    4::102     5e-14  41%  103 aa  RS10_SHELP RecName: Full=30S ribosomal protein S10;
    4::102     5e-14  41%  103 aa  RS10_SHEAM RecName: Full=30S ribosomal protein S10;
    4::102     5e-14  42%  103 aa  RS10_MARAV RecName: Full=30S ribosomal protein S10;
    2::102     5e-14  40%  102 aa  RS10_LACS1 RecName: Full=30S ribosomal protein S10;
    2::102     5e-14  39%  102 aa  RS10_CLOAB RecName: Full=30S ribosomal protein S10;
    4::102     5e-14  39%  102 aa  RS10_CLAMS RecName: Full=30S ribosomal protein S10;
    4::102     5e-14  39%  102 aa  RS10_CLAM3 RecName: Full=30S ribosomal protein S10;
    2::102     5e-14  40%  102 aa  RS10_BREBN RecName: Full=30S ribosomal protein S10;
    4::102     7e-14  39%  102 aa  RS10_THESQ RecName: Full=30S ribosomal protein S10;
    4::102     7e-14  39%  102 aa  RS10_THEP1 RecName: Full=30S ribosomal protein S10;
    4::102     7e-14  39%  102 aa  RS10_THEMA RecName: Full=30S ribosomal protein S10;
    4::102     7e-14  40%  103 aa  RS10_SHESW RecName: Full=30S ribosomal protein S10;
    4::102     7e-14  40%  103 aa  RS10_SHEPC RecName: Full=30S ribosomal protein S10;
    4::102     7e-14  41%  103 aa  RS10_SHEFN RecName: Full=30S ribosomal protein S10;
    4::102     7e-14  41%  103 aa  RS10_SHEDO RecName: Full=30S ribosomal protein S10;
    4::102     7e-14  40%  103 aa  RS10_SHEB9 RecName: Full=30S ribosomal protein S10;
    4::102     7e-14  40%  103 aa  RS10_SHEB8 RecName: Full=30S ribosomal protein S10;
    4::102     7e-14  40%  103 aa  RS10_SHEB5 RecName: Full=30S ribosomal protein S10;
    4::102     7e-14  40%  103 aa  RS10_SHEB2 RecName: Full=30S ribosomal protein S10;
    4::102     7e-14  40%  103 aa  RS10_PROAC RecName: Full=30S ribosomal protein S10;
    4::102     7e-14  40%  102 aa  RS10_PELTS RecName: Full=30S ribosomal protein S10;
    1::103     7e-14  39%  104 aa  RS10_NITOC RecName: Full=30S ribosomal protein S10;
    2::102     7e-14  40%  102 aa  RS10_GEOTN RecName: Full=30S ribosomal protein S10;
    2::102     7e-14  40%  102 aa  RS10_GEOSW RecName: Full=30S ribosomal protein S10;
    2::102     7e-14  40%  102 aa  RS10_GEOKA RecName: Full=30S ribosomal protein S10;
    1::103     7e-14  36%  106 aa  RS10_CALS8 RecName: Full=30S ribosomal protein S10;
    1::103     7e-14  36%  106 aa  RS10_ANATD RecName: Full=30S ribosomal protein S10;
    2::102     9e-14  43%  102 aa  RS10_PEDPA RecName: Full=30S ribosomal protein S10;
    2::102     9e-14  41%  102 aa  RS10_ENTFA RecName: Full=30S ribosomal protein S10;
    1::103     9e-14  40%  103 aa  RS10_CLOD6 RecName: Full=30S ribosomal protein S10;
    4::102     9e-14  40%  102 aa  RS10_BEUC1 RecName: Full=30S ribosomal protein S10;
    4::102     1e-13  38%  102 aa  RS10_THELT RecName: Full=30S ribosomal protein S10;
    4::102     1e-13  40%  102 aa  RS10_THEAB RecName: Full=30S ribosomal protein S10;
    2::102     1e-13  40%  102 aa  RS10_STAS1 RecName: Full=30S ribosomal protein S10;
    2::102     1e-13  41%  102 aa  RS10_LISW6 RecName: Full=30S ribosomal protein S10;
    2::102     1e-13  41%  102 aa  RS10_LISMO RecName: Full=30S ribosomal protein S10;
    2::102     1e-13  41%  102 aa  RS10_LISMH RecName: Full=30S ribosomal protein S10;
    2::102     1e-13  41%  102 aa  RS10_LISMF RecName: Full=30S ribosomal protein S10;
    2::102     1e-13  41%  102 aa  RS10_LISMC RecName: Full=30S ribosomal protein S10;
    2::102     1e-13  41%  102 aa  RS10_LISIN RecName: Full=30S ribosomal protein S10;
    4::102     1e-13  41%  102 aa  RS10_LACLS RecName: Full=30S ribosomal protein S10;
    4::102     1e-13  41%  102 aa  RS10_LACLM RecName: Full=30S ribosomal protein S10;
    4::102     1e-13  41%  102 aa  RS10_LACLA RecName: Full=30S ribosomal protein S10;
    4::102     1e-13  41%  103 aa  RS10_HAHCH RecName: Full=30S ribosomal protein S10;
    4::102     1e-13  40%  102 aa  RS10_FRASC RecName: Full=30S ribosomal protein S10;
    4::102     1e-13  40%  102 aa  RS10_FRAAA RecName: Full=30S ribosomal protein S10;
    2::102     1e-13  44%  102 aa  RS10_EXIS2 RecName: Full=30S ribosomal protein S10;
    3::102     1e-13  38%  102 aa  RS10_DESAP RecName: Full=30S ribosomal protein S10;
    2::102     1e-13  39%  102 aa  RS10_CLOPS RecName: Full=30S ribosomal protein S10;
    2::102     1e-13  39%  102 aa  RS10_CLOPE RecName: Full=30S ribosomal protein S10;
    2::102     1e-13  39%  102 aa  RS10_CLOP1 RecName: Full=30S ribosomal protein S10;
    2::102     1e-13  40%  102 aa  RS10_CLOBB RecName: Full=30S ribosomal protein S10;
    2::102     1e-13  40%  102 aa  RS10_CLOBA RecName: Full=30S ribosomal protein S10;
    2::102     1e-13  40%  102 aa  RS10_CLOB8 RecName: Full=30S ribosomal protein S10;
    4::102     1e-13  39%  102 aa  RS10_ACIC1 RecName: Full=30S ribosomal protein S10;
    4::102     2e-13  38%  102 aa  RS10_THENN RecName: Full=30S ribosomal protein S10;
    4::102     2e-13  39%  102 aa  RS10_THEFY RecName: Full=30S ribosomal protein S10;
    1::103     2e-13  37%  104 aa  RS10_RHOFD RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  38%  102 aa  RS10_MACCJ RecName: Full=30S ribosomal protein S10;
    4::102     2e-13  39%  102 aa  RS10_FRASN RecName: Full=30S ribosomal protein S10;
    1::103     2e-13  37%  104 aa  RS10_VARPS RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  38%  102 aa  RS10_STRZT RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  38%  102 aa  RS10_STRZP RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  38%  102 aa  RS10_STRZJ RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  38%  102 aa  RS10_STRR6 RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  38%  102 aa  RS10_STRPS RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  38%  102 aa  RS10_STRPN RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  38%  102 aa  RS10_STRPJ RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  38%  102 aa  RS10_STRPI RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  38%  102 aa  RS10_STRP7 RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  38%  102 aa  RS10_STRP4 RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  38%  102 aa  RS10_STRP2 RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  41%  102 aa  RS10_STAHJ RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  38%  102 aa  RS10_STACT RecName: Full=30S ribosomal protein S10;
    1::103     2e-13  37%  104 aa  RS10_POLSJ RecName: Full=30S ribosomal protein S10;
    1::103     2e-13  37%  104 aa  RS10_POLNA RecName: Full=30S ribosomal protein S10;
    4::102     2e-13  39%  102 aa  RS10_NOCSJ RecName: Full=30S ribosomal protein S10;
    4::102     2e-13  39%  102 aa  RS10_KINRD RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  38%  103 aa  RS10_DIAST RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  38%  103 aa  RS10_DELAS RecName: Full=30S ribosomal protein S10;
    5::103     2e-13  38%  107 aa  RS10_DEIRA RecName: Full=30S ribosomal protein S10;
    5::103     2e-13  38%  107 aa  RS10_DEIGD RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  40%  102 aa  RS10_BACWK RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  39%  102 aa  RS10_BACSU RecName: Full=30S ribosomal protein S10;AltName:
    2::102     2e-13  39%  102 aa  RS10_BACSK RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  39%  102 aa  RS10_BACP2 RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  39%  102 aa  RS10_BACLD RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  39%  102 aa  RS10_BACHD RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  40%  102 aa  RS10_BACC2 RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  39%  102 aa  RS10_BACA2 RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  39%  103 aa  RS10_ALCBS RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  38%  103 aa  RS10_ACISJ RecName: Full=30S ribosomal protein S10;
    2::102     2e-13  38%  103 aa  RS10_ACIAC RecName: Full=30S ribosomal protein S10;
    4::102     3e-13  40%  103 aa  RS10_MARMS RecName: Full=30S ribosomal protein S10;
    1::104     3e-13  41%  104 aa  RS10_DICNV RecName: Full=30S ribosomal protein S10;
    4::102     3e-13  39%  102 aa  RS10_BIFAA RecName: Full=30S ribosomal protein S10;
    2::102     3e-13  39%  102 aa  RS10_BACHK RecName: Full=30S ribosomal protein S10;
    2::102     3e-13  39%  102 aa  RS10_BACCZ RecName: Full=30S ribosomal protein S10;
    2::102     3e-13  39%  102 aa  RS10_BACCR RecName: Full=30S ribosomal protein S10;
    2::102     3e-13  39%  102 aa  RS10_BACCQ RecName: Full=30S ribosomal protein S10;
    2::102     3e-13  39%  102 aa  RS10_BACCN RecName: Full=30S ribosomal protein S10;
    2::102     3e-13  39%  102 aa  RS10_BACC7 RecName: Full=30S ribosomal protein S10;
    2::102     3e-13  39%  102 aa  RS10_BACC4 RecName: Full=30S ribosomal protein S10;
    2::102     3e-13  39%  102 aa  RS10_BACC3 RecName: Full=30S ribosomal protein S10;
    2::102     3e-13  39%  102 aa  RS10_BACC0 RecName: Full=30S ribosomal protein S10;
    2::102     3e-13  39%  102 aa  RS10_BACAH RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_YERPY RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_YERPS RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_YERPP RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_YERPN RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_YERPG RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_YERPE RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_YERPB RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_YERPA RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_YERP3 RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_YERE8 RecName: Full=30S ribosomal protein S10;
    2::102     4e-13  37%  102 aa  RS10_STRSV RecName: Full=30S ribosomal protein S10;
    2::102     4e-13  37%  102 aa  RS10_STRS2 RecName: Full=30S ribosomal protein S10;
    2::102     4e-13  37%  102 aa  RS10_STRGC RecName: Full=30S ribosomal protein S10;
    2::102     4e-13  38%  102 aa  RS10_STAES RecName: Full=30S ribosomal protein S10;
    2::102     4e-13  38%  102 aa  RS10_STAEQ RecName: Full=30S ribosomal protein S10;
    2::102     4e-13  38%  102 aa  RS10_STAAW RecName: Full=30S ribosomal protein S10;
    2::102     4e-13  38%  102 aa  RS10_STAAS RecName: Full=30S ribosomal protein S10;
    2::102     4e-13  38%  102 aa  RS10_STAAR RecName: Full=30S ribosomal protein S10;
    2::102     4e-13  38%  102 aa  RS10_STAAN RecName: Full=30S ribosomal protein S10;
    2::102     4e-13  41%  102 aa  RS10_STAAM RecName: Full=30S ribosomal protein S10;
    2::102     4e-13  38%  102 aa  RS10_STAAE RecName: Full=30S ribosomal protein S10;
    2::102     4e-13  41%  102 aa  RS10_STAAC RecName: Full=30S ribosomal protein S10;
    2::102     4e-13  38%  102 aa  RS10_STAAB RecName: Full=30S ribosomal protein S10;
    2::102     4e-13  38%  102 aa  RS10_STAA9 RecName: Full=30S ribosomal protein S10;
    2::102     4e-13  38%  102 aa  RS10_STAA3 RecName: Full=30S ribosomal protein S10;
    2::102     4e-13  38%  102 aa  RS10_STAA2 RecName: Full=30S ribosomal protein S10;
    2::102     4e-13  41%  102 aa  RS10_STAA1 RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_SERP5 RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_SALTY RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_SALTI RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_SALSV RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_SALPK RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_SALPC RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_SALPB RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_SALPA RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_SALNS RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_SALHS RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_SALG2 RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_SALEP RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_SALDC RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_SALCH RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_SALAR RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_SALA4 RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_PSYIN RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_PROMH RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_PHOLL RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_PECCP RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_PASMU RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_MANSM RecName: Full=30S ribosomal protein S10;
    3::102     4e-13  37%  103 aa  RS10_LEPCP RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_KLEP7 RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_KLEP3 RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_HAES2 RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_HAES1 RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_HAEPS RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_HAEIN RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_HAEIG RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_HAEIE RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_HAEI8 RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_HAEDU RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  38%  102 aa  RS10_FERNB RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_ESCF3 RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_ERWT9 RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_ENTS8 RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_EDWI9 RecName: Full=30S ribosomal protein S10;
    2::102     4e-13  39%  102 aa  RS10_CLONN RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_CITK8 RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_BUCAT RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_BUCAP RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_BUCAI RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_BUCA5 RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_ACTSZ RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_ACTPJ RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_ACTP7 RecName: Full=30S ribosomal protein S10;
    4::102     4e-13  40%  103 aa  RS10_ACTP2 RecName: Full=30S ribosomal protein S10;
    4::102     5e-13  40%  103 aa  RS10_VIBFM RecName: Full=30S ribosomal protein S10;
    4::102     5e-13  40%  103 aa  RS10_VIBF1 RecName: Full=30S ribosomal protein S10;
    2::102     5e-13  38%  103 aa  RS10_VEREI RecName: Full=30S ribosomal protein S10;
    4::102     5e-13  37%  102 aa  RS10_THEM4 RecName: Full=30S ribosomal protein S10;
    2::102     5e-13  37%  102 aa  RS10_STRMU RecName: Full=30S ribosomal protein S10;
    4::102     5e-13  39%  103 aa  RS10_SODGM RecName: Full=30S ribosomal protein S10;
    4::101     5e-13  38%  101 aa  RS10_SACEN RecName: Full=30S ribosomal protein S10;
    2::102     5e-13  40%  103 aa  RS10_PSEHT RecName: Full=30S ribosomal protein S10;
    4::102     5e-13  39%  102 aa  RS10_MICLC RecName: Full=30S ribosomal protein S10;
    6::102     5e-13  39%  102 aa  RS10_LACH4 RecName: Full=30S ribosomal protein S10;
    6::102     5e-13  39%  102 aa  RS10_LACAC RecName: Full=30S ribosomal protein S10;
    4::102     5e-13  39%  103 aa  RS10_ERWCT RecName: Full=30S ribosomal protein S10;
    4::102     5e-13  39%  103 aa  RS10_ENT38 RecName: Full=30S ribosomal protein S10;
    2::102     5e-13  39%  102 aa  RS10_BACAN RecName: Full=30S ribosomal protein S10;
    2::102     5e-13  39%  102 aa  RS10_BACAC RecName: Full=30S ribosomal protein S10;
    2::102     5e-13  39%  102 aa  RS10_BACAA RecName: Full=30S ribosomal protein S10;
    4::102     5e-13  40%  103 aa  RS10_ALISL RecName: Full=30S ribosomal protein S10;
    2::101     6e-13  39%  102 aa  RS10_TREPS RecName: Full=30S ribosomal protein S10;
    2::101     6e-13  39%  102 aa  RS10_TREPA RecName: Full=30S ribosomal protein S10;
    2::102     6e-13  35%  102 aa  RS10_STRPC RecName: Full=30S ribosomal protein S10;
    2::102     6e-13  35%  102 aa  RS10_STRPB RecName: Full=30S ribosomal protein S10;
    3::102     6e-13  37%  103 aa  RS10_METPP RecName: Full=30S ribosomal protein S10;
    2::102     6e-13  38%  102 aa  RS10_FINM2 RecName: Full=30S ribosomal protein S10;
    4::102     6e-13  40%  103 aa  RS10_BORPD RecName: Full=30S ribosomal protein S10;
    4::102     6e-13  39%  102 aa  RS10_BIFLO RecName: Full=30S ribosomal protein S10;
    4::102     6e-13  39%  102 aa  RS10_BIFLD RecName: Full=30S ribosomal protein S10;
    4::102     6e-13  39%  102 aa  RS10_BIFA0 RecName: Full=30S ribosomal protein S10;
    1::105     6e-13  35%  105 aa  RR10_GRATL RecName: Full=30S ribosomal protein S10, chloroplastic;
    4::102     8e-13  39%  103 aa  RS10_TOLAT RecName: Full=30S ribosomal protein S10;
    2::102     8e-13  36%  102 aa  RS10_STRU0 RecName: Full=30S ribosomal protein S10;
    2::102     8e-13  36%  102 aa  RS10_STRT2 RecName: Full=30S ribosomal protein S10;
    2::102     8e-13  36%  102 aa  RS10_STRS7 RecName: Full=30S ribosomal protein S10;
    2::102     8e-13  36%  102 aa  RS10_STRE4 RecName: Full=30S ribosomal protein S10;
    2::102     8e-13  38%  102 aa  RS10_ROSCS RecName: Full=30S ribosomal protein S10;
    4::102     8e-13  39%  103 aa  RS10_PHOPR RecName: Full=30S ribosomal protein S10;
    4::101     8e-13  37%  101 aa  RS10_CORGL RecName: Full=30S ribosomal protein S10;
    4::101     8e-13  37%  101 aa  RS10_CORGB RecName: Full=30S ribosomal protein S10;
    4::101     8e-13  37%  101 aa  RS10_COREF RecName: Full=30S ribosomal protein S10;
    4::102     8e-13  39%  103 aa  RS10_CELJU RecName: Full=30S ribosomal protein S10;
    1::103     8e-13  38%  104 aa  RS10_BUCBP RecName: Full=30S ribosomal protein S10;
    4::102     8e-13  40%  103 aa  RS10_BORPE RecName: Full=30S ribosomal protein S10;
    4::102     8e-13  40%  103 aa  RS10_BORBR RecName: Full=30S ribosomal protein S10;
    4::102     8e-13  40%  103 aa  RS10_BORA1 RecName: Full=30S ribosomal protein S10;
    4::102     8e-13  39%  102 aa  RS10_BIFLI RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  38%  103 aa  RS10_WIGBR RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  38%  103 aa  RS10_THICR RecName: Full=30S ribosomal protein S10;
    2::102     1e-12  35%  102 aa  RS10_STRPZ RecName: Full=30S ribosomal protein S10;
    2::102     1e-12  35%  102 aa  RS10_STRPM RecName: Full=30S ribosomal protein S10;
    2::102     1e-12  35%  102 aa  RS10_STRPG RecName: Full=30S ribosomal protein S10;
    2::102     1e-12  35%  102 aa  RS10_STRPF RecName: Full=30S ribosomal protein S10;
    2::102     1e-12  35%  102 aa  RS10_STRPD RecName: Full=30S ribosomal protein S10;
    2::102     1e-12  35%  102 aa  RS10_STRP8 RecName: Full=30S ribosomal protein S10;
    2::102     1e-12  35%  102 aa  RS10_STRP6 RecName: Full=30S ribosomal protein S10;
    2::102     1e-12  35%  102 aa  RS10_STRP3 RecName: Full=30S ribosomal protein S10;
    2::102     1e-12  35%  102 aa  RS10_STRP1 RecName: Full=30S ribosomal protein S10;
    2::102     1e-12  35%  102 aa  RS10_STRA5 RecName: Full=30S ribosomal protein S10;
    2::102     1e-12  35%  102 aa  RS10_STRA3 RecName: Full=30S ribosomal protein S10;
    2::102     1e-12  35%  102 aa  RS10_STRA1 RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_SACD2 RecName: Full=30S ribosomal protein S10;
    4::101     1e-12  37%  101 aa  RS10_RHOSR RecName: Full=30S ribosomal protein S10;
    4::101     1e-12  37%  101 aa  RS10_RHOOB RecName: Full=30S ribosomal protein S10;
    4::101     1e-12  37%  101 aa  RS10_RHOE4 RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  38%  103 aa  RS10_PSEU2 RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  38%  103 aa  RS10_PSESM RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  38%  103 aa  RS10_PSE14 RecName: Full=30S ribosomal protein S10;
    4::101     1e-12  37%  101 aa  RS10_NOCFA RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  37%  102 aa  RS10_LACJO RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  37%  102 aa  RS10_LACGA RecName: Full=30S ribosomal protein S10;
    2::102     1e-12  38%  103 aa  RS10_IDILO RecName: Full=30S ribosomal protein S10;
    2::102     1e-12  37%  103 aa  RS10_DECAR RecName: Full=30S ribosomal protein S10;
    5::103     1e-12  37%  105 aa  RS10_CHLTR RecName: Full=30S ribosomal protein S10;
    5::103     1e-12  37%  105 aa  RS10_CHLTB RecName: Full=30S ribosomal protein S10;
    5::103     1e-12  37%  105 aa  RS10_CHLTA RecName: Full=30S ribosomal protein S10;
    5::103     1e-12  37%  105 aa  RS10_CHLT2 RecName: Full=30S ribosomal protein S10;
    5::103     1e-12  37%  105 aa  RS10_CHLMU RecName: Full=30S ribosomal protein S10;
    2::102     1e-12  36%  102 aa  RS10_STRTD RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_SHISS RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_SHIFL RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_SHIF8 RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_SHIDS RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_SHIBS RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_SHIB3 RecName: Full=30S ribosomal protein S10;
    2::102     1e-12  38%  102 aa  RS10_ROSS1 RecName: Full=30S ribosomal protein S10;
    4::101     1e-12  37%  101 aa  RS10_MYCVP RecName: Full=30S ribosomal protein S10;
    4::101     1e-12  37%  101 aa  RS10_MYCSS RecName: Full=30S ribosomal protein S10;
    4::101     1e-12  37%  101 aa  RS10_MYCSK RecName: Full=30S ribosomal protein S10;
    4::101     1e-12  37%  101 aa  RS10_MYCSJ RecName: Full=30S ribosomal protein S10;
    4::101     1e-12  37%  101 aa  RS10_MYCS2 RecName: Full=30S ribosomal protein S10;
    4::101     1e-12  37%  101 aa  RS10_MYCGI RecName: Full=30S ribosomal protein S10;
    4::101     1e-12  37%  101 aa  RS10_MYCA9 RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  38%  102 aa  RS10_KOCRD RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_ECOUT RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_ECOSM RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_ECOSE RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_ECOLU RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_ECOLI RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_ECOLC RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_ECOL6 RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_ECOL5 RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_ECOK1 RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_ECOHS RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_ECODH RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_ECOBW RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_ECO8A RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_ECO81 RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_ECO7I RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_ECO5E RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_ECO57 RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_ECO55 RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_ECO45 RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_ECO27 RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  39%  103 aa  RS10_ECO24 RecName: Full=30S ribosomal protein S10;
    5::103     1e-12  37%  107 aa  RS10_DEIDV RecName: Full=30S ribosomal protein S10;
    4::101     1e-12  36%  101 aa  RS10_CORU7 RecName: Full=30S ribosomal protein S10;
    3::102     1e-12  38%  103 aa  RS10_BURVG RecName: Full=30S ribosomal protein S10;
    3::102     1e-12  38%  103 aa  RS10_BURTA RecName: Full=30S ribosomal protein S10;
    3::102     1e-12  38%  103 aa  RS10_BURS3 RecName: Full=30S ribosomal protein S10;
    3::102     1e-12  38%  103 aa  RS10_BURPS RecName: Full=30S ribosomal protein S10;
    3::102     1e-12  38%  103 aa  RS10_BURP6 RecName: Full=30S ribosomal protein S10;
    3::102     1e-12  38%  103 aa  RS10_BURP1 RecName: Full=30S ribosomal protein S10;
    3::102     1e-12  38%  103 aa  RS10_BURP0 RecName: Full=30S ribosomal protein S10;
    3::102     1e-12  38%  103 aa  RS10_BURMS RecName: Full=30S ribosomal protein S10;
    3::102     1e-12  38%  103 aa  RS10_BURMA RecName: Full=30S ribosomal protein S10;
    3::102     1e-12  38%  103 aa  RS10_BURM9 RecName: Full=30S ribosomal protein S10;
    3::102     1e-12  38%  103 aa  RS10_BURM7 RecName: Full=30S ribosomal protein S10;
    3::102     1e-12  38%  103 aa  RS10_BURM1 RecName: Full=30S ribosomal protein S10;
    3::102     1e-12  38%  103 aa  RS10_BURCM RecName: Full=30S ribosomal protein S10;
    3::102     1e-12  38%  103 aa  RS10_BURCJ RecName: Full=30S ribosomal protein S10;
    3::102     1e-12  38%  103 aa  RS10_BURCH RecName: Full=30S ribosomal protein S10;
    3::102     1e-12  38%  103 aa  RS10_BURCC RecName: Full=30S ribosomal protein S10;
    3::102     1e-12  38%  103 aa  RS10_BURCA RecName: Full=30S ribosomal protein S10;
    3::102     1e-12  38%  103 aa  RS10_BURA4 RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  38%  102 aa  RS10_ARTS2 RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  38%  102 aa  RS10_ARTCA RecName: Full=30S ribosomal protein S10;
    4::102     1e-12  38%  102 aa  RS10_ARTAT RecName: Full=30S ribosomal protein S10;
    1::105     1e-12  36%  105 aa  RR10_PORPU RecName: Full=30S ribosomal protein S10, chloroplastic;
    4::102     2e-12  35%  102 aa  RS10_TROWT RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  35%  102 aa  RS10_TROW8 RecName: Full=30S ribosomal protein S10;
    1::105     2e-12  37%  105 aa  RS10_SPIPL RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  40%  102 aa  RS10_RHOPB RecName: Full=30S ribosomal protein S10;
    4::101     2e-12  37%  101 aa  RS10_MYCUA RecName: Full=30S ribosomal protein S10;
    4::101     2e-12  37%  101 aa  RS10_MYCTU RecName: Full=30S ribosomal protein S10;
    4::101     2e-12  37%  101 aa  RS10_MYCTA RecName: Full=30S ribosomal protein S10;
    4::101     2e-12  37%  101 aa  RS10_MYCPA RecName: Full=30S ribosomal protein S10;
    4::101     2e-12  37%  101 aa  RS10_MYCMM RecName: Full=30S ribosomal protein S10;
    4::101     2e-12  37%  101 aa  RS10_MYCLE RecName: Full=30S ribosomal protein S10;
    4::101     2e-12  37%  101 aa  RS10_MYCLB RecName: Full=30S ribosomal protein S10;
    4::101     2e-12  37%  101 aa  RS10_MYCBT RecName: Full=30S ribosomal protein S10;
    4::101     2e-12  37%  101 aa  RS10_MYCBP RecName: Full=30S ribosomal protein S10;
    4::101     2e-12  37%  101 aa  RS10_MYCBO RecName: Full=30S ribosomal protein S10;
    4::101     2e-12  37%  101 aa  RS10_MYCA1 RecName: Full=30S ribosomal protein S10;
    2::102     2e-12  37%  103 aa  RS10_METCA RecName: Full=30S ribosomal protein S10;
    4::101     2e-12  36%  102 aa  RS10_LEPIN RecName: Full=30S ribosomal protein S10;
    4::101     2e-12  36%  102 aa  RS10_LEPIC RecName: Full=30S ribosomal protein S10;
    4::101     2e-12  36%  102 aa  RS10_LEPBJ RecName: Full=30S ribosomal protein S10;
    4::101     2e-12  36%  101 aa  RS10_CORDI RecName: Full=30S ribosomal protein S10;
    4::101     2e-12  36%  101 aa  RS10_CORA7 RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  39%  103 aa  RS10_BURXL RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  39%  103 aa  RS10_BURPP RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  39%  103 aa  RS10_BURP8 RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  39%  103 aa  RS10_AZOSE RecName: Full=30S ribosomal protein S10;
    2::101     2e-12  38%  102 aa  RS10_TREDE RecName: Full=30S ribosomal protein S10;
    2::102     2e-12  35%  102 aa  RS10_STREM RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  40%  102 aa  RS10_SALTO RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  40%  102 aa  RS10_SALAI RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  40%  102 aa  RS10_RHORT RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  40%  102 aa  RS10_RHOPT RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  40%  102 aa  RS10_RHOPS RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  40%  102 aa  RS10_RHOPA RecName: Full=30S ribosomal protein S10;AltName:
    4::102     2e-12  40%  102 aa  RS10_RHOP5 RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  40%  102 aa  RS10_RHOP2 RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  37%  103 aa  RS10_PSEU5 RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  37%  103 aa  RS10_PSEPW RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  37%  103 aa  RS10_PSEPK RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  37%  103 aa  RS10_PSEPG RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  37%  103 aa  RS10_PSEPF RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  37%  103 aa  RS10_PSEP1 RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  37%  103 aa  RS10_PSEMY RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  37%  103 aa  RS10_PSEFS RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  37%  103 aa  RS10_PSEF5 RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  37%  103 aa  RS10_PSEE4 RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  37%  103 aa  RS10_PSEAE RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  37%  103 aa  RS10_PSEAB RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  37%  103 aa  RS10_PSEA8 RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  37%  103 aa  RS10_PSEA7 RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  36%  102 aa  RS10_PLARO RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  40%  102 aa  RS10_OLICO RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  40%  102 aa  RS10_NITWN RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  40%  102 aa  RS10_NITHX RecName: Full=30S ribosomal protein S10;
    4::101     2e-12  37%  102 aa  RS10_LEPBP RecName: Full=30S ribosomal protein S10;
    4::101     2e-12  37%  102 aa  RS10_LEPBA RecName: Full=30S ribosomal protein S10;
    4::104     2e-12  37%  105 aa  RS10_FRATW RecName: Full=30S ribosomal protein S10;
    4::104     2e-12  37%  105 aa  RS10_FRATT RecName: Full=30S ribosomal protein S10;
    4::104     2e-12  37%  105 aa  RS10_FRATO RecName: Full=30S ribosomal protein S10;
    4::104     2e-12  37%  105 aa  RS10_FRATN RecName: Full=30S ribosomal protein S10;
    4::104     2e-12  37%  105 aa  RS10_FRATM RecName: Full=30S ribosomal protein S10;
    4::104     2e-12  37%  105 aa  RS10_FRATH RecName: Full=30S ribosomal protein S10;
    4::104     2e-12  37%  105 aa  RS10_FRATF RecName: Full=30S ribosomal protein S10;
    4::104     2e-12  37%  105 aa  RS10_FRAT1 RecName: Full=30S ribosomal protein S10;
    4::104     2e-12  37%  105 aa  RS10_FRAP2 RecName: Full=30S ribosomal protein S10;
    1::105     2e-12  38%  105 aa  RS10_CYAP4 RecName: Full=30S ribosomal protein S10;
    4::101     2e-12  36%  101 aa  RS10_CORJK RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  40%  102 aa  RS10_BRASO RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  40%  102 aa  RS10_BRASB RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  40%  102 aa  RS10_BRAJA RecName: Full=30S ribosomal protein S10;
    2::102     2e-12  38%  102 aa  RS10_BACC1 RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  37%  103 aa  RS10_AZOVD RecName: Full=30S ribosomal protein S10;
    4::102     2e-12  39%  103 aa  RS10_AZOSB RecName: Full=30S ribosomal protein S10;
    4::102     3e-12  36%  102 aa  RS10_STRGG RecName: Full=30S ribosomal protein S10;
    4::102     3e-12  36%  102 aa  RS10_STRCO RecName: Full=30S ribosomal protein S10;
    4::102     3e-12  36%  102 aa  RS10_STRAW RecName: Full=30S ribosomal protein S10;
    1::103     3e-12  36%  104 aa  RS10_RALSO RecName: Full=30S ribosomal protein S10;
    4::102     3e-12  37%  103 aa  RS10_PSEA6 RecName: Full=30S ribosomal protein S10;
    4::102     3e-12  38%  102 aa  RS10_OPITP RecName: Full=30S ribosomal protein S10;
    2::102     3e-12  40%  102 aa  RS10_MYCCT RecName: Full=30S ribosomal protein S10;
    4::102     3e-12  39%  103 aa  RS10_BORPA RecName: Full=30S ribosomal protein S10;
    4::102     3e-12  39%  103 aa  RS10_BLOPB RecName: Full=30S ribosomal protein S10;
    1::103     4e-12  34%  104 aa  RS10_XANOR RecName: Full=30S ribosomal protein S10;
    1::103     4e-12  34%  104 aa  RS10_XANOP RecName: Full=30S ribosomal protein S10;
    1::103     4e-12  34%  104 aa  RS10_XANOM RecName: Full=30S ribosomal protein S10;
    2::102     4e-12  36%  103 aa  RS10_XANAC RecName: Full=30S ribosomal protein S10;
    4::102     4e-12  39%  103 aa  RS10_VIBVY RecName: Full=30S ribosomal protein S10;
    4::102     4e-12  39%  103 aa  RS10_VIBVU RecName: Full=30S ribosomal protein S10;
    4::102     4e-12  39%  103 aa  RS10_VIBPA RecName: Full=30S ribosomal protein S10;
    4::102     4e-12  39%  103 aa  RS10_VIBHB RecName: Full=30S ribosomal protein S10;
    4::102     4e-12  39%  103 aa  RS10_VIBCM RecName: Full=30S ribosomal protein S10;
    4::102     4e-12  39%  103 aa  RS10_VIBCH RecName: Full=30S ribosomal protein S10;
    4::102     4e-12  39%  103 aa  RS10_VIBC3 RecName: Full=30S ribosomal protein S10;
    4::102     4e-12  38%  103 aa  RS10_RALPJ RecName: Full=30S ribosomal protein S10;
    4::102     4e-12  37%  102 aa  RS10_RALME RecName: Full=30S ribosomal protein S10;
    4::102     4e-12  37%  102 aa  RS10_RALEJ RecName: Full=30S ribosomal protein S10;
    4::102     4e-12  37%  102 aa  RS10_RALEH RecName: Full=30S ribosomal protein S10;
    4::102     4e-12  39%  103 aa  RS10_POLSQ RecName: Full=30S ribosomal protein S10;
    3::102     4e-12  39%  102 aa  RS10_PARL1 RecName: Full=30S ribosomal protein S10;
    4::101     4e-12  40%  102 aa  RS10_MYXXD RecName: Full=30S ribosomal protein S10;
    2::65      4e-12  39%   65 aa  RS10_DESMO RecName: Full=30S ribosomal protein S10P;Flags:
    4::102     4e-12  37%  102 aa  RS10_CUPTR RecName: Full=30S ribosomal protein S10;
    8::103     4e-12  37%  105 aa  RS10_CHLFF RecName: Full=30S ribosomal protein S10;
    8::103     4e-12  37%  105 aa  RS10_CHLCV RecName: Full=30S ribosomal protein S10;
    8::103     4e-12  37%  105 aa  RS10_CHLAB RecName: Full=30S ribosomal protein S10;
    1::102     4e-12  35%  103 aa  RS10_BORT9 RecName: Full=30S ribosomal protein S10;
    1::102     4e-12  35%  103 aa  RS10_BORRA RecName: Full=30S ribosomal protein S10;
    1::102     4e-12  35%  103 aa  RS10_BORHD RecName: Full=30S ribosomal protein S10;
    1::102     4e-12  35%  103 aa  RS10_BORDL RecName: Full=30S ribosomal protein S10;
    3::102     4e-12  39%  104 aa  RS10_AQUPY RecName: Full=30S ribosomal protein S10;
    4::102     4e-12  38%  103 aa  RS10_ALTMD RecName: Full=30S ribosomal protein S10;
    4::102     5e-12  39%  103 aa  RS10_POLNS RecName: Full=30S ribosomal protein S10;
    1::105     5e-12  36%  105 aa  RS10_NOSP7 RecName: Full=30S ribosomal protein S10;
    2::102     5e-12  35%  102 aa  RS10_MESFL RecName: Full=30S ribosomal protein S10;
    4::102     5e-12  39%  102 aa  RS10_MAGSA RecName: Full=30S ribosomal protein S10;
    5::102     5e-12  41%  104 aa  RS10_HYDS0 RecName: Full=30S ribosomal protein S10;
    6::103     5e-12  36%  104 aa  RS10_EUBE2 RecName: Full=30S ribosomal protein S10;
    2::102     5e-12  39%  102 aa  RS10_CHLSY RecName: Full=30S ribosomal protein S10;
    2::102     5e-12  39%  102 aa  RS10_CHLAD RecName: Full=30S ribosomal protein S10;
    2::102     5e-12  39%  102 aa  RS10_CHLAA RecName: Full=30S ribosomal protein S10;
    1::105     5e-12  36%  105 aa  RS10_ANAVT RecName: Full=30S ribosomal protein S10;
    1::105     5e-12  36%  105 aa  RS10_ANASP RecName: Full=30S ribosomal protein S10;
    4::102     7e-12  40%  102 aa  RS10_XANP2 RecName: Full=30S ribosomal protein S10;
    1::105     7e-12  35%  105 aa  RS10_TRIEI RecName: Full=30S ribosomal protein S10;
    4::102     7e-12  39%  102 aa  RS10_METS4 RecName: Full=30S ribosomal protein S10;
    4::102     7e-12  39%  102 aa  RS10_METNO RecName: Full=30S ribosomal protein S10;
    4::102     7e-12  37%  102 aa  RS10_METFK RecName: Full=30S ribosomal protein S10;
    1::105     7e-12  36%  105 aa  RS10_CYAA5 RecName: Full=30S ribosomal protein S10;
    4::102     7e-12  37%  103 aa  RS10_BAUCH RecName: Full=30S ribosomal protein S10;
    4::102     7e-12  40%  102 aa  RS10_AZOC5 RecName: Full=30S ribosomal protein S10;
    1::105     7e-12  35%  105 aa  RR10_PORYE RecName: Full=30S ribosomal protein S10, chloroplastic;
    1::103     9e-12  37%  103 aa  RS10_SYNFM RecName: Full=30S ribosomal protein S10;
    8::103     9e-12  36%  105 aa  RS10_CHLPN RecName: Full=30S ribosomal protein S10;
    4::102     9e-12  37%  105 aa  RS10_BDEBA RecName: Full=30S ribosomal protein S10;
    4::102     1e-11  36%  103 aa  RS10_XANCP RecName: Full=30S ribosomal protein S10;
    4::102     1e-11  36%  103 aa  RS10_XANCB RecName: Full=30S ribosomal protein S10;
    4::102     1e-11  36%  103 aa  RS10_XANC8 RecName: Full=30S ribosomal protein S10;
   12::110     1e-11  36%  111 aa  RS10_XANC5 RecName: Full=30S ribosomal protein S10;
    1::105     1e-11  36%  105 aa  RS10_SYNP2 RecName: Full=30S ribosomal protein S10;
    5::101     1e-11  36%  103 aa  RS10_RUBXD RecName: Full=30S ribosomal protein S10;
    1::104     1e-11  34%  105 aa  RS10_PHYAS RecName: Full=30S ribosomal protein S10;
    1::105     1e-11  36%  105 aa  RS10_MICAN RecName: Full=30S ribosomal protein S10;
    1::103     1e-11  35%  105 aa  RS10_LEGPL RecName: Full=30S ribosomal protein S10;
    1::103     1e-11  35%  105 aa  RS10_LEGPH RecName: Full=30S ribosomal protein S10;
    1::103     1e-11  35%  105 aa  RS10_LEGPC RecName: Full=30S ribosomal protein S10;
    1::103     1e-11  35%  105 aa  RS10_LEGPA RecName: Full=30S ribosomal protein S10;
    1::103     1e-11  36%  103 aa  RS10_JANSC RecName: Full=30S ribosomal protein S10;
   21::104     1e-11  39%  105 aa  RS10_AYWBP RecName: Full=30S ribosomal protein S10;
    2::102     1e-11  34%  103 aa  RS10_ALHEH RecName: Full=30S ribosomal protein S10;
    2::102     1e-11  35%  103 aa  RS10_THISH RecName: Full=30S ribosomal protein S10;
    4::102     1e-11  37%  102 aa  RS10_THIDA RecName: Full=30S ribosomal protein S10;
    4::102     1e-11  38%  102 aa  RS10_SINMW RecName: Full=30S ribosomal protein S10;
    4::102     1e-11  38%  102 aa  RS10_RHISN RecName: Full=30S ribosomal protein S10;
    4::102     1e-11  38%  102 aa  RS10_RHIME RecName: Full=30S ribosomal protein S10;
    4::102     1e-11  39%  102 aa  RS10_OCHA4 RecName: Full=30S ribosomal protein S10;
    3::102     1e-11  38%  104 aa  RS10_MARMM RecName: Full=30S ribosomal protein S10;
    3::102     1e-11  36%  106 aa  RS10_HYPNA RecName: Full=30S ribosomal protein S10;
    1::105     1e-11  35%  105 aa  RS10_CYAP7 RecName: Full=30S ribosomal protein S10;
    4::102     1e-11  39%  102 aa  RS10_BRUSU RecName: Full=30S ribosomal protein S10;
    4::102     1e-11  39%  102 aa  RS10_BRUSI RecName: Full=30S ribosomal protein S10;
    4::102     1e-11  39%  102 aa  RS10_BRUO2 RecName: Full=30S ribosomal protein S10;
    4::102     1e-11  39%  102 aa  RS10_BRUME RecName: Full=30S ribosomal protein S10;
    4::102     1e-11  39%  102 aa  RS10_BRUMB RecName: Full=30S ribosomal protein S10;
    4::102     1e-11  39%  102 aa  RS10_BRUC2 RecName: Full=30S ribosomal protein S10;
    4::102     1e-11  39%  102 aa  RS10_BRUAB RecName: Full=30S ribosomal protein S10;
    4::102     1e-11  39%  102 aa  RS10_BRUA2 RecName: Full=30S ribosomal protein S10;
    4::102     1e-11  39%  102 aa  RS10_BRUA1 RecName: Full=30S ribosomal protein S10;
    4::101     1e-11  40%  101 aa  RS10_ANASK RecName: Full=30S ribosomal protein S10;
    4::101     1e-11  40%  101 aa  RS10_ANADF RecName: Full=30S ribosomal protein S10;
    4::101     1e-11  40%  101 aa  RS10_ANADE RecName: Full=30S ribosomal protein S10;
    4::101     1e-11  40%  101 aa  RS10_ANAD2 RecName: Full=30S ribosomal protein S10;
    4::102     1e-11  38%  102 aa  RS10_AGRVS RecName: Full=30S ribosomal protein S10;
    4::102     1e-11  38%  102 aa  RS10_AGRT5 RecName: Full=30S ribosomal protein S10;
    1::105     1e-11  36%  105 aa  RS10_ACAM1 RecName: Full=30S ribosomal protein S10;
    1::105     2e-11  36%  105 aa  RS10_SYNY3 RecName: Full=30S ribosomal protein S10;
    1::105     2e-11  36%  105 aa  RS10_SYNJA RecName: Full=30S ribosomal protein S10;
    2::102     2e-11  35%  102 aa  RS10_STRT1 RecName: Full=30S ribosomal protein S10;
    4::102     2e-11  37%  103 aa  RS10_STRMK RecName: Full=30S ribosomal protein S10;
    4::102     2e-11  37%  103 aa  RS10_STRM5 RecName: Full=30S ribosomal protein S10;
    4::102     2e-11  38%  102 aa  RS10_RHILW RecName: Full=30S ribosomal protein S10;
    4::102     2e-11  38%  102 aa  RS10_RHIL3 RecName: Full=30S ribosomal protein S10;
    4::102     2e-11  38%  102 aa  RS10_RHIEC RecName: Full=30S ribosomal protein S10;
    4::102     2e-11  38%  102 aa  RS10_RHIE6 RecName: Full=30S ribosomal protein S10;
    2::102     2e-11  35%  103 aa  RS10_PSYCK RecName: Full=30S ribosomal protein S10;
    2::102     2e-11  35%  103 aa  RS10_PSYA2 RecName: Full=30S ribosomal protein S10;
    3::102     2e-11  37%  102 aa  RS10_PHEZH RecName: Full=30S ribosomal protein S10;
    5::102     2e-11  36%  102 aa  RS10_MYCMS RecName: Full=30S ribosomal protein S10;
    4::102     2e-11  36%  103 aa  RS10_LARHH RecName: Full=30S ribosomal protein S10;
    4::102     2e-11  39%  102 aa  RS10_BART1 RecName: Full=30S ribosomal protein S10;
    4::102     2e-11  39%  102 aa  RS10_BARQU RecName: Full=30S ribosomal protein S10;
    4::102     2e-11  39%  102 aa  RS10_BARHE RecName: Full=30S ribosomal protein S10;
    2::102     2e-11  37%  103 aa  RS10_ACIBT RecName: Full=30S ribosomal protein S10;
    2::102     2e-11  37%  103 aa  RS10_ACIBC RecName: Full=30S ribosomal protein S10;
    2::102     2e-11  37%  103 aa  RS10_ACIB5 RecName: Full=30S ribosomal protein S10;
    2::102     2e-11  37%  103 aa  RS10_ACIB3 RecName: Full=30S ribosomal protein S10;
    4::101     3e-11  38%  101 aa  RS10_TREHY RecName: Full=30S ribosomal protein S10;
    4::102     3e-11  38%  102 aa  RS10_RHILO RecName: Full=30S ribosomal protein S10;
    2::102     3e-11  35%  103 aa  RS10_PSYWF RecName: Full=30S ribosomal protein S10;
    3::101     3e-11  36%  101 aa  RS10_FLAPJ RecName: Full=30S ribosomal protein S10;
    4::101     3e-11  38%  101 aa  RS10_BRAHW RecName: Full=30S ribosomal protein S10;
    3::104     3e-11  38%  104 aa  RS10_THEEB RecName: Full=30S ribosomal protein S10;
    1::105     3e-11  36%  105 aa  RS10_SYNP6 RecName: Full=30S ribosomal protein S10;
    1::105     3e-11  36%  105 aa  RS10_SYNE7 RecName: Full=30S ribosomal protein S10;
    4::102     3e-11  37%  102 aa  RS10_PARDP RecName: Full=30S ribosomal protein S10;
    4::102     3e-11  37%  102 aa  RS10_NITMU RecName: Full=30S ribosomal protein S10;
    2::102     3e-11  36%  103 aa  RS10_CHRVO RecName: Full=30S ribosomal protein S10;
    4::102     3e-11  37%  103 aa  RS10_BUCCC RecName: Full=30S ribosomal protein S10;
    4::101     3e-11  37%  101 aa  RS10_BRAPL RecName: Full=30S ribosomal protein S10;
    4::102     3e-11  37%  102 aa  RS10_ACICJ RecName: Full=30S ribosomal protein S10;
    1::102     3e-11  35%  109 aa  RS10_ACIBL RecName: Full=30S ribosomal protein S10;
    1::105     4e-11  37%  105 aa  RS10_SYNJB RecName: Full=30S ribosomal protein S10;
   10::110     4e-11  35%  111 aa  RS10_PARUW RecName: Full=30S ribosomal protein S10;
    4::102     4e-11  37%  102 aa  RS10_NITEU RecName: Full=30S ribosomal protein S10;
    4::102     4e-11  37%  102 aa  RS10_NITEC RecName: Full=30S ribosomal protein S10;
    2::102     4e-11  35%  102 aa  RS10_DEHSC RecName: Full=30S ribosomal protein S10;
    2::102     4e-11  35%  102 aa  RS10_DEHSB RecName: Full=30S ribosomal protein S10;
    3::102     4e-11  37%  104 aa  RS10_AQUAE RecName: Full=30S ribosomal protein S10;
    2::102     4e-11  36%  103 aa  RS10_ACIAD RecName: Full=30S ribosomal protein S10;
    1::59      6e-11  42%   60 aa  RS20_MAIZE RecName: Full=40S ribosomal protein S20;AltName:
    1::103     6e-11  33%  103 aa  RS10_SALRD RecName: Full=30S ribosomal protein S10;
    4::101     6e-11  38%  105 aa  RS10_ACIC5 RecName: Full=30S ribosomal protein S10;
    3::102     6e-11  35%  102 aa  RR10_GUITH RecName: Full=30S ribosomal protein S10, chloroplastic;
    6::102     7e-11  38%  102 aa  RS10_RHOSK RecName: Full=30S ribosomal protein S10;
    6::102     7e-11  38%  102 aa  RS10_RHOS5 RecName: Full=30S ribosomal protein S10;
    6::102     7e-11  38%  102 aa  RS10_RHOS4 RecName: Full=30S ribosomal protein S10;
    6::102     7e-11  38%  102 aa  RS10_RHOS1 RecName: Full=30S ribosomal protein S10;
    6::102     7e-11  35%  105 aa  RS10_EUBR3 RecName: Full=30S ribosomal protein S10;
   21::104     1e-10  37%  107 aa  RS10_ONYPE RecName: Full=30S ribosomal protein S10;
    2::102     1e-10  34%  103 aa  RS10_NEIG2 RecName: Full=30S ribosomal protein S10;
    4::102     1e-10  38%  102 aa  RS10_MESSB RecName: Full=30S ribosomal protein S10;
    1::105     1e-10  35%  105 aa  RS10_LAWIP RecName: Full=30S ribosomal protein S10;
    6::103     1e-10  37%  103 aa  RS10_DESAA RecName: Full=30S ribosomal protein S10;
    2::102     1e-10  34%  102 aa  RS10_DEHE1 RecName: Full=30S ribosomal protein S10;
    1::101     1e-10  32%  102 aa  RS10_CHLPB RecName: Full=30S ribosomal protein S10;
    3::102     1e-10  36%  102 aa  RS10_CAUSK RecName: Full=30S ribosomal protein S10;
    3::102     1e-10  36%  102 aa  RS10_CAUCR RecName: Full=30S ribosomal protein S10;
    3::102     1e-10  36%  102 aa  RS10_CAUCN RecName: Full=30S ribosomal protein S10;
    2::102     1e-10  36%  102 aa  RS10_CARHZ RecName: Full=30S ribosomal protein S10;
    4::102     1e-10  36%  102 aa  RS10_BEII9 RecName: Full=30S ribosomal protein S10;
    4::102     1e-10  36%  102 aa  RS10_RHOCS RecName: Full=30S ribosomal protein S10;
    4::102     1e-10  36%  102 aa  RS10_GRABC RecName: Full=30S ribosomal protein S10;
    4::102     1e-10  36%  102 aa  RS10_GLUOX RecName: Full=30S ribosomal protein S10;
    4::102     1e-10  36%  102 aa  RS10_GLUDA RecName: Full=30S ribosomal protein S10;
    4::104     1e-10  36%  104 aa  RS10_GLOVI RecName: Full=30S ribosomal protein S10;
    1::105     1e-10  36%  105 aa  RS10_DESVV RecName: Full=30S ribosomal protein S10;
    1::105     1e-10  36%  105 aa  RS10_DESVM RecName: Full=30S ribosomal protein S10;
    1::105     1e-10  36%  105 aa  RS10_DESVH RecName: Full=30S ribosomal protein S10;
    1::105     1e-10  36%  105 aa  RS10_DESDG RecName: Full=30S ribosomal protein S10;
    1::105     1e-10  35%  105 aa  RS10_DESDA RecName: Full=30S ribosomal protein S10;
    4::102     1e-10  34%  103 aa  RS10_BLOFL RecName: Full=30S ribosomal protein S10;
    5::102     1e-10  35%  102 aa  RS10_AKKM8 RecName: Full=30S ribosomal protein S10;
    4::102     2e-10  37%  104 aa  RS10_SILST RecName: Full=30S ribosomal protein S10;
    4::102     2e-10  37%  104 aa  RS10_SILPO RecName: Full=30S ribosomal protein S10;
    1::103     2e-10  35%  105 aa  RS10_ROSDO RecName: Full=30S ribosomal protein S10;
    1::104     2e-10  37%  108 aa  RS10_RHOBA RecName: Full=30S ribosomal protein S10;
    3::101     2e-10  35%  101 aa  RS10_PORGI RecName: Full=30S ribosomal protein S10;
    3::101     2e-10  35%  101 aa  RS10_PORG3 RecName: Full=30S ribosomal protein S10;
    3::101     2e-10  36%  101 aa  RS10_PARD8 RecName: Full=30S ribosomal protein S10;
    4::102     2e-10  35%  103 aa  RS10_NEIGO RecName: Full=30S ribosomal protein S10;
    5::103     2e-10  36%  103 aa  RS10_MAGSM RecName: Full=30S ribosomal protein S10;
    2::102     2e-10  33%  102 aa  RS10_KOSOT RecName: Full=30S ribosomal protein S10;
   95::197     2e-10  32%  197 aa  RR10_MESCR RecName: Full=30S ribosomal protein S10,
    2::102     2e-10  34%  103 aa  RS10_NEIMB RecName: Full=30S ribosomal protein S10;
    2::102     2e-10  34%  103 aa  RS10_NEIMA RecName: Full=30S ribosomal protein S10;
    2::102     2e-10  34%  103 aa  RS10_NEIM0 RecName: Full=30S ribosomal protein S10;
    2::102     2e-10  34%  103 aa  RS10_NEIG1 RecName: Full=30S ribosomal protein S10;
    4::102     2e-10  35%  102 aa  RS10_METPB RecName: Full=30S ribosomal protein S10;
    4::102     2e-10  35%  102 aa  RS10_METEP RecName: Full=30S ribosomal protein S10;
    4::102     2e-10  35%  102 aa  RS10_METC4 RecName: Full=30S ribosomal protein S10;
    8::105     2e-10  34%  105 aa  RS10_DESAD RecName: Full=30S ribosomal protein S10;
    3::101     2e-10  35%  101 aa  RS10_CYTH3 RecName: Full=30S ribosomal protein S10;
    1::104     2e-10  32%  110 aa  RS10_COXBU RecName: Full=30S ribosomal protein S10;
    1::104     2e-10  32%  110 aa  RS10_COXBR RecName: Full=30S ribosomal protein S10;
    1::104     2e-10  32%  110 aa  RS10_COXBN RecName: Full=30S ribosomal protein S10;
   89::191     2e-10  31%  191 aa  RR10_ARATH RecName: Full=30S ribosomal protein S10,
    6::106     3e-10  34%  106 aa  RS10_SYNSC RecName: Full=30S ribosomal protein S10;
    6::106     3e-10  35%  106 aa  RS10_SYNR3 RecName: Full=30S ribosomal protein S10;
    6::106     3e-10  35%  106 aa  RS10_PROM9 RecName: Full=30S ribosomal protein S10;
    4::102     3e-10  38%  102 aa  RS10_PELCD RecName: Full=30S ribosomal protein S10;
    4::102     3e-10  35%  102 aa  RS10_METRJ RecName: Full=30S ribosomal protein S10;
    4::102     3e-10  38%  102 aa  RS10_GEOSL RecName: Full=30S ribosomal protein S10;
    4::102     3e-10  38%  102 aa  RS10_GEOMG RecName: Full=30S ribosomal protein S10;
    8::105     3e-10  36%  105 aa  RS10_DESMR RecName: Full=30S ribosomal protein S10;
    1::102     3e-10  32%  103 aa  RS10_CHLPD RecName: Full=30S ribosomal protein S10;
    1::105     3e-10  31%  105 aa  RR10_CYAPA RecName: Full=Cyanelle 30S ribosomal protein S10;
    6::106     4e-10  34%  106 aa  RS10_SYNPX RecName: Full=30S ribosomal protein S10;
    3::101     4e-10  32%  102 aa  RS10_NAUPA RecName: Full=30S ribosomal protein S10;
    4::104     4e-10  32%  109 aa  RS10_NANEQ RecName: Full=30S ribosomal protein S10P;
    4::102     4e-10  35%  102 aa  RS10_METSB RecName: Full=30S ribosomal protein S10;
    3::101     4e-10  36%  101 aa  RS10_BACV8 RecName: Full=30S ribosomal protein S10;
    3::101     4e-10  36%  101 aa  RS10_BACTN RecName: Full=30S ribosomal protein S10;
    3::101     4e-10  36%  101 aa  RS10_BACFR RecName: Full=30S ribosomal protein S10;
    3::101     4e-10  36%  101 aa  RS10_BACFN RecName: Full=30S ribosomal protein S10;
    6::106     5e-10  34%  106 aa  RS10_SYNS9 RecName: Full=30S ribosomal protein S10;
    6::106     5e-10  34%  106 aa  RS10_SYNS3 RecName: Full=30S ribosomal protein S10;
    2::102     5e-10  34%  103 aa  RS10_RUTMC RecName: Full=30S ribosomal protein S10;
    6::106     5e-10  34%  106 aa  RS10_PROMT RecName: Full=30S ribosomal protein S10;
    6::106     5e-10  34%  106 aa  RS10_PROMA RecName: Full=30S ribosomal protein S10;
    6::106     5e-10  34%  106 aa  RS10_PROM4 RecName: Full=30S ribosomal protein S10;
    6::106     5e-10  34%  106 aa  RS10_PROM1 RecName: Full=30S ribosomal protein S10;
    4::102     5e-10  38%  102 aa  RS10_PELPD RecName: Full=30S ribosomal protein S10;
    5::102     5e-10  36%  102 aa  RS10_ACIF5 RecName: Full=30S ribosomal protein S10;
    5::102     5e-10  36%  102 aa  RS10_ACIF2 RecName: Full=30S ribosomal protein S10;
    2::102     6e-10  34%  103 aa  RS10_VESOH RecName: Full=30S ribosomal protein S10;
    1::102     6e-10  32%  103 aa  RS10_PROVI RecName: Full=30S ribosomal protein S10;
    1::102     6e-10  32%  103 aa  RS10_PELPB RecName: Full=30S ribosomal protein S10;
    1::102     6e-10  32%  103 aa  RS10_PELLD RecName: Full=30S ribosomal protein S10;
    4::102     6e-10  38%  102 aa  RS10_GEOSM RecName: Full=30S ribosomal protein S10;
    4::102     6e-10  38%  102 aa  RS10_GEOBB RecName: Full=30S ribosomal protein S10;
    1::102     6e-10  33%  103 aa  RS10_CHLL2 RecName: Full=30S ribosomal protein S10;
    1::102     6e-10  32%  103 aa  RS10_CHLCH RecName: Full=30S ribosomal protein S10;
    6::106     8e-10  34%  106 aa  RS10_PROMS RecName: Full=30S ribosomal protein S10;
    6::106     8e-10  34%  106 aa  RS10_PROMP RecName: Full=30S ribosomal protein S10;
    6::106     8e-10  34%  106 aa  RS10_PROM5 RecName: Full=30S ribosomal protein S10;
    6::106     8e-10  34%  106 aa  RS10_PROM0 RecName: Full=30S ribosomal protein S10;
    4::102     8e-10  38%  102 aa  RS10_GEOSF RecName: Full=30S ribosomal protein S10;
    1::102     8e-10  32%  103 aa  RS10_CHLP8 RecName: Full=30S ribosomal protein S10;
    3::101     1e-09  32%  101 aa  RS10_UREU1 RecName: Full=30S ribosomal protein S10;
    4::102     1e-09  35%  103 aa  RS10_NOVAD RecName: Full=30S ribosomal protein S10;
    7::104     1e-09  36%  105 aa  RS10_DESPS RecName: Full=30S ribosomal protein S10;
    6::102     1e-09  35%  105 aa  RS10_CLOPH RecName: Full=30S ribosomal protein S10;
    1::102     1e-09  32%  103 aa  RS10_CHLTE RecName: Full=30S ribosomal protein S10;
    2::102     2e-09  33%  103 aa  RS10_NEIMF RecName: Full=30S ribosomal protein S10;
    4::102     2e-09  37%  102 aa  RS10_GEOLS RecName: Full=30S ribosomal protein S10;
    1::102     2e-09  31%  103 aa  RS10_CHLT3 RecName: Full=30S ribosomal protein S10;
    3::99      2e-09  30%  103 aa  RS10_SULNB RecName: Full=30S ribosomal protein S10;
    1::102     2e-09  31%  103 aa  RS10_PROA2 RecName: Full=30S ribosomal protein S10;
    3::102     2e-09  32%  102 aa  RS10_PELUB RecName: Full=30S ribosomal protein S10;
    4::101     3e-09  33%  102 aa  RS10_SYNAS RecName: Full=30S ribosomal protein S10;
    3::99      3e-09  33%  103 aa  RS10_NITSB RecName: Full=30S ribosomal protein S10;
    2::101     3e-09  30%  102 aa  RS10_MYCPE RecName: Full=30S ribosomal protein S10;
    3::101     4e-09  31%  101 aa  RS10_UREPA RecName: Full=30S ribosomal protein S10;
    3::101     4e-09  31%  101 aa  RS10_UREP2 RecName: Full=30S ribosomal protein S10;
    6::106     4e-09  33%  106 aa  RS10_PROMM RecName: Full=30S ribosomal protein S10;
    6::106     4e-09  33%  106 aa  RS10_PROM3 RecName: Full=30S ribosomal protein S10;
    3::98      4e-09  33%  104 aa  RS10_HELPY RecName: Full=30S ribosomal protein S10;
    3::98      4e-09  33%  104 aa  RS10_HELPS RecName: Full=30S ribosomal protein S10;
    3::98      4e-09  33%  104 aa  RS10_HELPJ RecName: Full=30S ribosomal protein S10;
    3::98      4e-09  33%  104 aa  RS10_HELPH RecName: Full=30S ribosomal protein S10;
    3::98      4e-09  33%  104 aa  RS10_HELPG RecName: Full=30S ribosomal protein S10;
    3::98      4e-09  33%  104 aa  RS10_HELAH RecName: Full=30S ribosomal protein S10;
    6::106     5e-09  33%  106 aa  RS10_SYNPW RecName: Full=30S ribosomal protein S10;
    3::98      5e-09  31%  103 aa  RS10_HELHP RecName: Full=30S ribosomal protein S10;
    3::100     5e-09  33%  101 aa  RS10_AMOA5 RecName: Full=30S ribosomal protein S10;
    5::103     7e-09  31%  103 aa  RS10_FUSNN RecName: Full=30S ribosomal protein S10;
    3::98      9e-09  33%  104 aa  RS10_HELP2 RecName: Full=30S ribosomal protein S10;
    4::101     1e-08  31%  103 aa  RR10_EMIHU RecName: Full=30S ribosomal protein S10, chloroplastic;
    1::102     2e-08  31%  103 aa  RS10_BORGA RecName: Full=30S ribosomal protein S10;
    1::102     2e-08  31%  103 aa  RS10_BORBZ RecName: Full=30S ribosomal protein S10;
    1::102     2e-08  31%  103 aa  RS10_BORBU RecName: Full=30S ribosomal protein S10;
    1::102     2e-08  31%  103 aa  RS10_BORAP RecName: Full=30S ribosomal protein S10;
    4::102     3e-08  32%  103 aa  RS10_XYLFT RecName: Full=30S ribosomal protein S10;
    4::102     3e-08  32%  103 aa  RS10_XYLFM RecName: Full=30S ribosomal protein S10;
    4::102     3e-08  32%  103 aa  RS10_XYLFA RecName: Full=30S ribosomal protein S10;
    4::102     3e-08  32%  103 aa  RS10_XYLF2 RecName: Full=30S ribosomal protein S10;
    3::99      4e-08  30%  104 aa  RS10_ARCB4 RecName: Full=30S ribosomal protein S10;
    3::99      6e-08  30%  103 aa  RS10_SULDN RecName: Full=30S ribosomal protein S10;
    3::77      8e-08  32%  103 aa  RS10_CAMFF RecName: Full=30S ribosomal protein S10;
   24::121     1e-07  28%  121 aa  RS10_MYCGA RecName: Full=30S ribosomal protein S10;
    3::101     1e-07  31%  101 aa  RS10_GRAFK RecName: Full=30S ribosomal protein S10;
    2::77      1e-07  32%  103 aa  RS10_CAMHC RecName: Full=30S ribosomal protein S10;
    2::76      1e-07  33%  105 aa  RS10_RICBR RecName: Full=30S ribosomal protein S10;
    2::76      1e-07  33%  105 aa  RS10_RICB8 RecName: Full=30S ribosomal protein S10;
    3::101     1e-07  31%  101 aa  RS10_FLAJ1 RecName: Full=30S ribosomal protein S10;
    3::77      1e-07  31%  103 aa  RS10_CAMLR RecName: Full=30S ribosomal protein S10;
   12::86      2e-07  35%  131 aa  RT10_DICDI RecName: Full=Probable 28S ribosomal protein S10,
    2::100     2e-07  29%  103 aa  RS10_NEOSM RecName: Full=30S ribosomal protein S10;
   13::99      2e-07  24%  108 aa  RS10_MYCPN RecName: Full=30S ribosomal protein S10;
    4::103     2e-07  28%  108 aa  RS10_EHRCR RecName: Full=30S ribosomal protein S10;
    4::103     3e-07  28%  108 aa  RS10_EHRCJ RecName: Full=30S ribosomal protein S10;
    3::77      3e-07  31%  103 aa  RS10_CAMJR RecName: Full=30S ribosomal protein S10;
    3::77      3e-07  31%  103 aa  RS10_CAMJJ RecName: Full=30S ribosomal protein S10;
    3::77      3e-07  31%  103 aa  RS10_CAMJE RecName: Full=30S ribosomal protein S10;
    3::77      3e-07  31%  103 aa  RS10_CAMJ8 RecName: Full=30S ribosomal protein S10;
    2::76      4e-07  33%  105 aa  RS10_RICPU RecName: Full=30S ribosomal protein S10;
    3::101     4e-07  30%  102 aa  RS10_MYCMO RecName: Full=30S ribosomal protein S10;
    6::105     4e-07  29%  111 aa  RS10_EHRRW RecName: Full=30S ribosomal protein S10;
    6::105     4e-07  29%  110 aa  RS10_EHRRG RecName: Full=30S ribosomal protein S10;
    3::77      4e-07  31%  103 aa  RS10_CAMJD RecName: Full=30S ribosomal protein S10;
    2::76      5e-07  33%  105 aa  RS10_RICFE RecName: Full=30S ribosomal protein S10;
   37::108     5e-07  37%  109 aa  RR10_CYACA RecName: Full=30S ribosomal protein S10, chloroplastic;
    2::76      6e-07  33%  105 aa  RS10_RICTY RecName: Full=30S ribosomal protein S10;
    2::101     6e-07  29%  105 aa  RS10_RICRS RecName: Full=30S ribosomal protein S10;
    2::101     6e-07  29%  105 aa  RS10_RICRO RecName: Full=30S ribosomal protein S10;
    2::76      6e-07  33%  105 aa  RS10_RICPR RecName: Full=30S ribosomal protein S10;
    2::76      6e-07  33%  105 aa  RS10_RICAH RecName: Full=30S ribosomal protein S10;
    2::101     6e-07  29%  105 aa  RS10_RICAE RecName: Full=30S ribosomal protein S10;
    3::99      6e-07  29%  101 aa  RS10_MYCS5 RecName: Full=30S ribosomal protein S10;
    4::93      6e-07  33%  105 aa  RS10_ANAPZ RecName: Full=30S ribosomal protein S10;
    2::101     8e-07  28%  106 aa  RS10_WOLPP RecName: Full=30S ribosomal protein S10;
    2::101     8e-07  29%  105 aa  RS10_RICM5 RecName: Full=30S ribosomal protein S10;
    2::101     8e-07  29%  105 aa  RS10_RICCN RecName: Full=30S ribosomal protein S10;
   11::97      8e-07  27%  106 aa  RS10_MYCGE RecName: Full=30S ribosomal protein S10;
    2::76      1e-06  33%  105 aa  RS10_RICCK RecName: Full=30S ribosomal protein S10;
    4::102     3e-06  31%  103 aa  RS10_SPHAL RecName: Full=30S ribosomal protein S10;
    4::93      7e-06  28%  105 aa  RS10_ANAMM RecName: Full=30S ribosomal protein S10;
    4::93      7e-06  28%  105 aa  RS10_ANAMF RecName: Full=30S ribosomal protein S10;
    1::91      2e-05  27%  103 aa  RR10_ODOSI RecName: Full=30S ribosomal protein S10,
    1::85      2e-05  27%  107 aa  RR10_THAPS RecName: Full=30S ribosomal protein S10,
    1::85      2e-05  29%  107 aa  RR10_PHATR RecName: Full=30S ribosomal protein S10,
    6::105     4e-05  24%  106 aa  RS10_MYCHJ RecName: Full=30S ribosomal protein S10;
    6::105     4e-05  24%  106 aa  RS10_MYCH7 RecName: Full=30S ribosomal protein S10;
    6::105     4e-05  24%  106 aa  RS10_MYCH2 RecName: Full=30S ribosomal protein S10;
   18::102     1e-04  29%  103 aa  RS10_MYCPU RecName: Full=30S ribosomal protein S10;
   17::87      2e-04  30%  106 aa  RS10_WOLWR RecName: Full=30S ribosomal protein S10;
   17::87      3e-04  28%  109 aa  RS10_WOLPM RecName: Full=30S ribosomal protein S10;
    1::106

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSLASRRKVRIRLYGTNPADVEQVAREIVDLAKKMGVQVRGPIPLPTRRLIVTVRRAPSGQGYHTFDHWE
RS10_PYRAE      MSLASRRKVRIRLYGTNPADVEQVAREIVDLAKKMGVQVRGPIPLPTRRLIVTVRRAPSGQGYHTFDHWE
RS10_THENV      MSLASRRKVRIRLYGTNPTDVDQVAREIVDLAKKMGVQVRGPIPLPTRRLMVTVRRAPSGQGYHTFDHWE
RS10_PYRCJ      MSLASRRKVRIRLYGTNPADLDQVAREIVDLAKKMGVAVRGPIPLPTKRLMVTVRRAPSGQGYHTFDHWE
RS10_PYRIL      MSLAARRKVRIRLYGTNPADVEQVAREIVDLAKKMGVQVKGPIXXXXXXXXXXXXXAPSGQGYHTFDHWE
RS10_PYRAR      MALAARRKVRIRLYGTNPADVDQVAREIVDLAKKMGVQVRGPIXXXXXXXXXXXXXAPSGQGYHTYDHWE
RS10_ARCFU      -------KARIKLSGLNPRELDRICSQIKEIANKTGVELSGPVPLPTRRMVVPVRKAPDGEGSETWDHWE
RS10_THEAC      -------KARISLSGTEHRVVDRVCNEIKEIASRTGVEIHGPMPLPTKRLVVPVRKSPDGEGTNTWDHWE
RS10_METTP      ------QKARIRLSGTNPATLDEICNQVRGIAQRTGVHMAGPIPLPTKRLVVPCRKSPDGEGSATWDHWE
RS10_THEVO      -------KARISLSGTEHKIVDMVCSEIKEIASRTGVEIHGPMPLPTKKLVVPVRKSPDGEGTNTWDHWE
RS10_PYRAB      ------QKARIKLASTNVRSLEEVANQIKQIAERTGVRMSGPIPLPTKRIRIVTRKSPDGEGSATFDRWE
RS10_PICTO      -------KARISLSGTENKIVDVVCEEIKGIAKRTGVEIHGPIPLPTKRLVVPVRKSPDGEGSPTWDRWE
RS10_PYRWO      ------QKARIKIASTNVRSLDEVANQIKQIAERTGVRMSGPIPLPTKRIRITTRKSPDGEGSATFDRWE
RS10_PYRHO      ------QKARIKLASTNVRSLEEVANQIRQIAERTGVRMSGPIPLPTKRIRIVTRKSPDGEGSATFDRWE
RS10_PYRFU      ------QKARIKIASTNVRSLDEVANQIKQIAERTGVRMSGPIPLPTKRIRITTRKSPDGEGSATFDRWE
RS10_HALMA      ------QQARVRLAGTSPEDLDDICADVREIANKTGVELSGPVPLPTKTLEVPSRKSPDGEGTATWEHWE
RS10_HALSA      ------QQARVRLAGVDPDDLDNICGEVQEIADKTGVKVSGPVPLPTKTLEVPSRKSPDGEGTATWEHWE
RS10_HALS3      ------QQARVRLAGVDPDDLDNICGEVQEIADKTGVKVSGPVPLPTKTLEVPSRKSPDGEGTATWEHWE
RS10_METB6      ------QKARIRLTGTDFNKVETVCDRIREIAERTGVNLAGPIPLPTKRLVVPIRKSPDGEGTATFDRWQ
RS10_SULTO      -------KARIRLWSTNIENLNFVVNQIKTLAQKTGVEISGPIPLPTSRMEVPVMRLPHGEGKKKWEHWE
RS10_METLZ      ------QKARIRLTGTDYEKVETVCTRIREIAERTGVNMAGPIPLPTKRLIVPIRKSPDGEGTATWDRWQ
RS10_SULAC      -------KARIRLWSSNIDSLNFVVNQIRNMAQKTGIQVSGPIPLPTTRMEVPVMRLPHGEGKKKWEHWE
RS10_METPE      ------QKARIRLTGTDFNKVEMVCDKIREIAERTGVNLAGPIPLPTKRLVVPIRKSPDGEGTATWDRWQ
RS10_NATPD      ------QQARVRLAGTAPEDLDDICDDVREIADKTGVTLSGPVPLPTKTLEIPARKSPDGEGTATWEHWE
RS10_METJA      ------QRARIKLSSTDHKVLDEICRQIKEIAEKTGVDISGPIPLPTKVLRVVTRKSPDGEGSSTFDRWT
RS10_THEON      ------QKARIKLASTNIKALNEVTDQIKQIAERTGVRMSGPIPLPTKRIRITTRKSPDGEGTATFDRFE
RS10_THEGJ      ------QKARIKLASTNIKALNEVTDQIKQIAERTGVRMSGPIPLPTKRIRITTRKSPDGEGTATFDRFE
RS10_PYRKO      ------QKARIKLASTNIKALNEVTDQIKQIAERTGVRMSGPIPLPTKRIRITTRKSPDGEGSATFDRFE
RS10_HALLT      ------QQARVRLAGTSPEDLDDICADVREIADSTGVALSGPIPLPTKTLEIPSRKSPDGEGTATWEHWE
RS10_SULSO      -------KARIRLWSTNVENLNYVITQIRGIVEKTGIEMRGPIPLPTSKLEVPIMRLPHGEGRKKWEKWE
RS10_SULIY      -------KARIRLWSTNVENLNYVITQIRGIVEKTGIEMRGPIPLPTSKLEVPIMRLPHGEGRKKWEKWE
RS10_SULIN      -------KARIRLWSTNVENLNYVITQIRGIVEKTGIEMRGPIPLPTSKLEVPIMRLPHGEGRKKWEKWE
RS10_SULIM      -------KARIRLWSTNVENLNYVITQIRGIVEKTGIEMRGPIPLPTSKLEVPIMRLPHGEGRKKWEKWE
RS10_SULIL      -------KARIRLWSTNVENLNYVITQIRGIVEKTGIEMRGPIPLPTSKLEVPIMRLPHGEGRKKWEKWE
RS10_SULIK      -------KARIRLWSTNVENLNYVITQIRGIVEKTGIEMRGPIPLPTSKLEVPIMRLPHGEGRKKWEKWE
RS10_SULIA      -------KARIRLWSTNVENLNYVITQIRGIVEKTGIEMRGPIPLPTSKLEVPIMRLPHGEGRKKWEKWE
RS10_METTH      -------KARIKLTGTDPEKLAYVCDQLKKIAERTGVDMSGPIPLPTKRLVVPTRKSPDGEGTATWEKWE
RS10_METMJ      ------QKARIRLSGTDFEKIEMVCDRIKEIAERTGVNLAGPIPLPTKKLVVPTRKSPDGEGTATWDRWQ
RS10_HYPBU      ------QKAEIKLWSTNVESLNQVVEQIKAIAKKTGVRMRGPIPLPTRRLIVPTLKLPHGEGSKKWDKWE
RS10_METST      -------KARIKLTGTDPEKIADVCNQLKKIAERTGVDLSGPIPLPTKKLVVPTRKSPDGEGKATWEKWE
RS10_AERPE      -------KLRIWLWSTNVRSLENVVEQIRNIANKTGIRMRGPVPLPVKRLEVPVFRLPHGEGSKYWEHWE
RS10_METS5      -------KARIRLWSTNVNNLNYVVNQIKGIVDKTGVSMRGPIPLPTRRMEVPVMRLPHGEGRKKWEKWE
RS10_METM5      ------QKARIKLSSTQHTELDGVCNQIKAIAEKTGVDMAGPIPLPTKALKVTTRKSTDGEGSSSFDRWT
RS10_METMP      ------QKARIKLSSTQHTELDGVCDQIKAIAEKTGVDMSGPIPLPTKALKVTTRKSTDGEGSSSFDRWT
RS10_METM7      ------QKARIKLSSTQHTELDGVCDQIKAIAEKTGVDMAGPIPLPTKALKVTTRKSTDGEGSSSFDRWT
RS10_METM6      ------QKARIKLSSTQHVELDGVCDQIKAIAEKTGVDMAGPIPLPTKALKVTTRKSTDGEGSSSFDRWT
RS10_METVS      ------QKARIKLSSTKHEELDSVCNQIKAIAEKTGVDMAGPIPLPTKSLKITTRKSTDGEGSSSFDRWT
RS10_META3      ------QKARIKLSSTSYQELDGVCNNIKTIAEKTGVDMAGPIPLPTKTLKVTTRKSTDGEGSSSFDRWT
RS10_METS3      -------QARIKLTGTDPEKLAYVCDQLKKIAERTGVDLSGPIPLPTKKLVVPTRKSPDGEGKASWEKWE
RS10_KORCO      --------LRIELVSVNPESLEKVSRMFKEIADKMGVRVKGPIPLPTKRLRVTALRNPSGEGTNRYDKYE
RS10_HALWD      ------QQARVRLAGTSPXXXXXXXXXXXXXXXTTGVNLSGPIPLPTKTLEIPTRKSPDGEGTATWEHWE
RS10_METHJ      ------QKARIRLTGTDYQXXXXXXXXXXXXXXRTGVNLAGPIPLPTRKLVVPIRKSPDGEGTATWDRWQ
RS10_METKA      ------QEVRLRLSSTDHYKLEEVCERIKKVVEETGAQMSGPIPLPTKRLLVPTRKSPDGEGKATWDKWE
RS10_CENSY      ------QSARVKLTSINLLKLDGVCGIIMDIGKRTGVRIKGPTPLPVKKLHIATRKSPCGSGTETYEKWE
RS10_METMA      ------QKARIRLSGISPKDLDGVCNQVKSIAERTGVNISGXXXXXXXXXXXXXRKSPSGDGTATWDHWE
RS10_METBF      ------QKARIRLSGISPKDLDGVCNQVKSIAERTGVNISGXXXXXXXXXXXXXRKSPSGDGTATWDHWE
RS10_METAC      ------QKARIRLSGISPKDLDGVCNQVKSIAERTGVNISGXXXXXXXXXXXXXRKSPSGDGTATWDHWE
RS10_METBU      ------QKARIRLSGTSPVNLDGVCDQVKAIANRTGVSISGXXXXXXXXXXXXXRKSPSGDGTATWDHWE
RS20_DROME      ---ASVHRIRITLTSRNVRSLENVCRDLINGAKNQNLRVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQ
RS20_SCHPO      -------RIRITLTSRNVRNLEKVCSDLVNRAKDKQLRVKGPVRLPTKILKITTRKTPNGEGSKTWETYE
RS202_ARATH     -------KIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTRKAPCGEGTNTWDRFE
RS201_ARATH     -------KIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTRKAPCGEGTNTWDRFE
RS20_XENLA      -------RIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQ
RS20_RAT        -------RIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQ
RS20_PIG        -------RIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQ
RS20_MOUSE      -------RIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQ
RS20_MACFA      -------RIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQ
RS20_HUMAN      -------RIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQ
RS20_BOVIN      -------RIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQ
RS20_DICDI      -------KISITLTSRNPKSLEKVCADIITLAKNKKVKAKGPIRIPNKVLKITTRKSPCGEGTNTWDRFE
RS20_ORYSJ      -----QHRIRITLSSKSVKNLEKVCGDLVKGAKDKSLKVKGPVRMPTKVLHITTRKSPCGEGTNTWDRFE
RS10_SULSY      -----QEKIRIKLKAFDHKVLDQSVKQIVDTVKRGGGLVKGPIPLPTRRRVWCVHRSP-----HKFEHFE
RS20_PONAB      -------RIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTGKTPCGEGSKTWDRFQ
RS10_PERMH      -----QEKIRIKLKAFDHKVLDQSVKQIIDTVKRSGGVIKGPIPLPTQRKVWCVLRSP-----HKFEHFE
RS10_DESRM      ------QKIRIRLKAFDHQMLDQSATKIVDTAKRTGAQVAGPVPLPTEKSIYTILRSPH-VNKDSREQFE
RS10_THETN      -----KQKIRIRLKAFDHAILDQSAQKIVETAKRTGAEVSGPIPLPTKREVITILRAPH-KYKDSREQFE
RS10_NATTJ      --MANKQKIRIRLKAFDHMILDQSAEKIVETAKRTGANVSGPVPLPTDKNVYTVIRAP-----HKFEQFE
RS10_LACRJ      ----AKQKIRIRLKAYEHRILDQSADKIVETAKRTGAQISGPIPLPTERTIYTVIRSP-----HKFEQFE
RS10_LACRD      ----AKQKIRIRLKAYEHRILDQSADKIVETAKRTGAQISGPIPLPTERTIYTVIRSP-----HKFEQFE
RS10_CLOTH      --MANKQKIRIRLKAFDHQVLDQSAEKIVETAKRTGAKVSGPVPLPTEREVITILRAPH-KYKDSREQFE
RS10_THEPX      -----KQKIRIRLKAFDHAILDQSAQKIVETAKRTGAEVSGPIPLPTEKDIITILRAPH-KYKDSREQFE
RS10_THEP3      -----KQKIRIRLKAFDHAILDQSAQKIVETAKRTGAEVSGPIPLPTEKDIITILRAPH-KYKDSREQFE
RS10_DESHY      ----SSQKIRIRLKAFDHKTLDQSAEKIVETAKRTGARVSGPIPLPTEKSIYTILRSPH-VNKDSREQFE
RS10_DESHD      ----SSQKIRIRLKAFDHKTLDQSAEKIVETAKRTGARVSGPIPLPTEKSIYTILRSPH-VNKDSREQFE
RS10_NITMS      ---------RVKLTSTSLPKLDGVCGEIMXXXXXXXXXXXXXXXLPVKRLHVATRKSPCGNGTETYEKWE
RS10_CLOCE      --MSNKQKIRIRLKAFDHQVLDQSAEKIVETAKRTGAKVSGPVPLPTEKEIITILRAPH-KYKDSREQFE
RS10_ALKMQ      ----ANQKIRIRLKGYDHKAVDQSAEKIVATAKKSGAEVSGPIPLPTEKQIITILRA-----VHKYEQFE
RS10_OCEIH      ----AKEKIRIRLKAYDHRILDQSAEKIVDTAKRSGAKVSGPIPLPTEKSVYTVLRAVH-KYKDSREQFE
RS20_YEAST      ---------RITLTSTKVKQLENVSSNIVKNAEQHNLVKKGPVRLPTKVLKISTRKTPNGEGSKTWETYE
RS10_MOOTA      ----ARQKIRIRLKAFDHRVLDQSSQKIVDTARRTGAVVSGPIPLPTEKNIFTILRSPH-VNKDSREQFE
RS10_LEUMM      ----AQKKIRIRLKAYEHRILDQSAEKIVETAKRTGAEIAGPIPLPTERTLYTILRSPH-KHKDSREQFE
RS10_LEUCK      ----AQKKIRIRLKAYEHRILDQSAEKIVETAKRTGAEIAGPIPLPTERTLYTILRSPH-KHKDSREQFE
RS10_LACPL      ----AKQKIRIRLKAYEHRILDQSADKIVETAKRTGATISGPIPLPTERTIYTVLRSP-----HKFEQFE
RS10_LACF3      ----ANQKIRIRLKAYEHRVLDESADKIVESAKRTGAQVSGPIPLPTERTLYTVIRSP-----HKFEQFE
RS10_SOLUE      --MALRERIRIRLKAYDHRILDQSTTEIVDTAKRTGATVAGPIPLPTSRSITTVLRSPH-VDKKSREQFE
RS10_LACBA      ----AKQKIRIRLKAYEHRILDQSADKIVETAKRTGAGISGPIPLPTERTIYTVLRSP-----HKFEQFE
RS10_THETH      -------KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPF-KHKDSREHFE
RS10_THET8      -------KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPF-KHKDSREHFE
RS10_THET2      -------KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPF-KHKDSREHFE
RS10_LEIXX      ------QKIRIRLKSYDHAGLDTSARKIVDTVTRAGATVVGPVPLPTEKNVVCVIRSPH-KYKDSREHFE
RS10_LACSS      ----AKQKIRIRLKAFEHRILDQSADKIVETAKRTGASISGPIPLPTERTLYTVLRSPH-KHKDSREQFE
RS10_LACDB      ----ANEKIRIRLKSYEHSILDESGAKIVDTAKRTGAEISGPVPLPTERTLFTVLRSPH-KNKDSREQFE
RS10_LACDA      ----ANEKIRIRLKSYEHSILDESGAKIVDTAKRTGAEISGPVPLPTERTLFTVLRSPH-KNKDSREQFE
RS10_OENOB      ----AERKIRIRLKAYEYRTIDASAAKIVETAKRTGAQVVGPIPLPTERTIYTILRSPH-KHKDSREQFE
RS10_ALKOO      ----NNQKIRIRLKAYDHMALDQSAEKIVETAKKSGAEVSGPVPLPTEKQIITILRAVH-KYKDSREQFE
RS10_SHEWM      ------QRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERYTILTSPH-VNKDARDQYE
RS10_SHESH      ------QRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERYTILTSPH-VNKDARDQYE
RS10_SHEPA      ------QRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERYTILTSPH-VNKDARDQYE
RS10_SHEHH      ------QRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTILTSPH-VNKDARDQYE
RS10_LACCB      ----AKQKIRIRLKAYEHRILDQSADKIVETAKRTGATISGPIPLPTERTLYTVLRSPH-KYKDSREQFE
RS10_LACC3      ----AKQKIRIRLKAYEHRILDQSADKIVETAKRTGATISGPIPLPTERTLYTVLRSPH-KYKDSREQFE
RS10_HELMI      -----KQKIRIRLKAFDHRILDQSSEKIVETAKRTGAAVSGPIPLPTEKSIYTILRSPH-VNKDSREQFE
RS10_EXISA      ----ANEKIRIRLKAYDHRVLDQSAEKIVDTAKRSGAKVSGPIPLPTEKSIYTILRA-----VHKYEQFE
RS10_COPPD      ----SAQRIRIKLRSYDHRLLDQSAKRIVEVAKRTGAKVAGPIPLPTDRRVYCVTRSPH-IDKDSREHFE
RS10_COLP3      ----SNQRIRIRLKAFDHRLIDQSTAEIVDTAKRTGAQVRGPIPLPTRKERYTILTSPH-VNKDARDQYE
RS10_CLOK5      ----AKQKIRIRLKAFDHTILDQSSEKIVETAKSTGAKVAGPVPLPTEKDVVTILRAPH-KYKDSREQFE
RS10_CLOK1      ----AKQKIRIRLKAFDHTILDQSSEKIVETAKSTGAKVAGPVPLPTEKDVVTILRAPH-KYKDSREQFE
RS10_CLOBM      ----AKQKIRIRLKAFDHSLLDQSALKIVETAKTTGAKVAGPVPLPTEKDIVTILRAPH-KYKDAREQFE
RS10_CLOBL      ----AKQKIRIRLKAFDHSLLDQSALKIVETAKTTGAKVAGPVPLPTEKDIVTILRAPH-KYKDAREQFE
RS10_CLOBK      ----AKQKIRIRLKAFDHSLLDQSALKIVETAKTTGAKVAGPVPLPTEKDIVTILRAPH-KYKDAREQFE
RS10_CLOBJ      ----AKQKIRIRLKAFDHSLLDQSALKIVETAKTTGAKVAGPVPLPTEKDIVTILRAPH-KYKDAREQFE
RS10_CLOBH      ----AKQKIRIRLKAFDHSLLDQSALKIVETAKTTGAKVAGPVPLPTEKDIVTILRAPH-KYKDAREQFE
RS10_CLOB6      ----AKQKIRIRLKAFDHSLLDQSALKIVETAKTTGAKVAGPVPLPTEKDIVTILRAPH-KYKDAREQFE
RS10_CLOB1      ----AKQKIRIRLKAFDHSLLDQSALKIVETAKTTGAKVAGPVPLPTEKDIVTILRAPH-KYKDAREQFE
RS10_CHRSD      ------QKIRIRLKAFDHRLIDQSAQEIVDTAKRTGAQVRGPIPLPTNRERYTVLISPH-VNKDARDQYE
RS10_SYMTH      ----AKQKIRIRLRAFDHKILDSSAAKIVETAIRTGATVSGPIPLPTEKSIYTILTAPNGE-KDIREQFE
RS10_SHESR      ------QRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERYTVLISPH-VNKDARDQYE
RS10_SHESM      ------QRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERYTVLISPH-VNKDARDQYE
RS10_SHESA      ------QRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERYTVLISPH-VNKDARDQYE
RS10_SHEON      ------QRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERYTVLISPH-VNKDARDQYE
RS10_SHELP      ------QRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERYTVLISPH-VNKDARDQYE
RS10_SHEAM      ------QRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_MARAV      ------QKIRIRLKAFDYRLIDQSTQEIVDTAKRTGAQVRGPIPLPTRKEKYTVLISPH-VNKDARDQYE
RS10_LACS1      ----AKQKIRIRLKAYEHRILDQSADKIVETAKRTGATISGPIPLPTERTLYTVIRSPH-KYKDSREQFE
RS10_CLOAB      ----AKQKIRIRLKAFDHTILDQSAEKIVETAKTTGAKVAGPVPLPTEKDVVTILRSPH-KYKDSREQFE
RS10_CLAMS      ------QKIRIRLKSYDHSVIDSSARKIVDTVTRAGATVVGPVPLPTEKNVICVIRSPH-KYKDSREHFE
RS10_CLAM3      ------QKIRIRLKSYDHSVIDSSARKIVDTVTRAGATVVGPVPLPTEKNVICVIRSPH-KYKDSREHFE
RS10_BREBN      ----AKQKIRIRLKAYDHKILDQSAEKIVDTAKRSGANVSGPIPLPTEKAVYTILRAVH-KYKDSREQFE
RS10_THESQ      ------QKIRIKLKAYDHELLDESAKKIVEVAKSTNSKVSGPIPLPTERTLYCVLRSPM-KHKDSREHFE
RS10_THEP1      ------QKIRIKLKAYDHELLDESAKKIVEVAKSTNSKVSGPIPLPTERTLYCVLRSPM-KHKDSREHFE
RS10_THEMA      ------QKIRIKLKAYDHELLDESAKKIVEVAKSTNSKVSGPIPLPTERTLYCVLRSPM-KHKDSREHFE
RS10_SHESW      ------QRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERYTILISPH-VNKDARDQYE
RS10_SHEPC      ------QRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERYTILISPH-VNKDARDQYE
RS10_SHEFN      ------QRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERYTVLISPH-VNKDARDQYE
RS10_SHEDO      ------QRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_SHEB9      ------QRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERYTILISPH-VNKDARDQYE
RS10_SHEB8      ------QRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERYTILISPH-VNKDARDQYE
RS10_SHEB5      ------QRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERYTILISPH-VNKDARDQYE
RS10_SHEB2      ------QRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERYTILISPH-VNKDARDQYE
RS10_PROAC      ------QKIRIRLRAYDHEVIDSSARKIVDTVTRTGAKVAGPVPLPTEKNVFCVIRSPH-KYKDSREHFE
RS10_PELTS      ------QKIRIRLKAFDHHMLDQSAQKIVETARRTGASVAGPVPLPTEKSIYTILRSPH-VNKDSREQFE
RS10_NITOC      --MAKQQIIRIRLKAFDHRLIDQSAREIVDTAKRTGAHVRGPIPLPTRKERFTILISPH-VNKDARDQYE
RS10_GEOTN      ----AKEKIRIRLKAYDHRILDQSAEKIVETAKRSGAKVSGPIPLPTERTVYTILRAVH-KYKDSREQFE
RS10_GEOSW      ----AKEKIRIRLKAYDHRILDQSAEKIVETAKRSGAKVSGPIPLPTERTVYTILRAVH-KYKDSREQFE
RS10_GEOKA      ----AKEKIRIRLKAYDHRILDQSAEKIVETAKRSGAKVSGPIPLPTERTVYTILRAVH-KYKDSREQFE
RS10_CALS8      --MSKAQRMRIKLKSFDYKLLDQSARKIVETAKSTGAEVSGPVPLPTDREVITIIRAPH-KYKDSREQFE
RS10_ANATD      --MSKAQRMRIKLKSFDYKLLEQSAKKIVETAKNTGAEVSGPVPLPTDREVITIIRAPH-KYKDSREQFE
RS10_PEDPA      ----AKQKIRIRLKAYEHRILDQSADKIVETAKRTGATISGPIPLPTERTVYTVLSSP-----HKFEQFE
RS10_ENTFA      ----AKQKIRIRLKAYEHRILDQSADKIVETAKRTGADVSGPIPLPTERSLYTVIRA-THKYKDSREQFE
RS10_CLOD6      --MAKNEKIRIRLKSYDHKLLDFSAGKIVETAKKAGSQVSGPVPLPTEKQVVTILRAVHKYKY-SREQFE
RS10_BEUC1      ------QKIRIRLKSYDHEVIDSSARKIVDTVTRAGATVVGPVPLPTEKNVFCVIRSPH-KYKDSRDHFE
RS10_THELT      ------QKIRIKLKAYDHEVLDESAKKIVEVAKSTNAKISGPIPLPTERALYVVLRSPH-KHKDSREQFE
RS10_THEAB      ------QKIRIRLKAYDHKLLDESAKKIVEIVKQTNAKVSGPIPLPTERTLYVVLRSPL-KHKDSREQFE
RS10_STAS1      ----AKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTERSVYTVIRAVH-KYKDSREQFE
RS10_LISW6      ----AKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSIYTVLRAVH-KYKDSREQFE
RS10_LISMO      ----AKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSIYTVLRAVH-KYKDSREQFE
RS10_LISMH      ----AKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSIYTVLRAVH-KYKDSREQFE
RS10_LISMF      ----AKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSIYTVLRAVH-KYKDSREQFE
RS10_LISMC      ----AKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSIYTVLRAVH-KYKDSREQFE
RS10_LISIN      ----AKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSIYTVLRAVH-KYKDSREQFE
RS10_LACLS      ------KKIRIRLKAYEHRILDAAAEKIVETAKRTNAEVSGPIPLPTDRSVYTVIRA-THKYKDSREQFE
RS10_LACLM      ------KKIRIRLKAYEHRILDAAAEKIVETAKRTNAEVSGPIPLPTDRSVYTVIRA-THKYKDSREQFE
RS10_LACLA      ------KKIRIRLKAYEHRILDAAAEKIVETAKRTNAEVSGPIPLPTDRSVYTVIRA-THKYKDSREQFE
RS10_HAHCH      ------QKIRIRLKAFDYRLIDQSTQEIVDTAKRTGAQVRGPIPLPTKKERFTVLISPH-VNKDARDQYE
RS10_FRASC      ------QKIRIRLKAYDHEVIDSSARKIVETVTRTGAQVAGPVPLPTEKNIYCVIRSPH-KYKDSREHFE
RS10_FRAAA      ------QKIRIRLKAYDHEVIDSSARKIVETVTRTGAQVAGPVPLPTEKNIYCVIRSPH-KYKDSREHFE
RS10_EXIS2      ----ANEKIRIRLKAYDHRVLDQSAEKIVETAKRSGATVSGPIPLPTEKAIYTVLRA-----VHKYEQFE
RS10_DESAP      -----RQKIRIRLKAFDHHMLDQSAQKIVETVRRTGADVAGPVPLPTEKEIYTILRSPH-KDKDSREQFE
RS10_CLOPS      ----SKQKIRIRLKAFDHTILDQSAEKIVETAKSTGAKVVGPVPLPTEKDVITILRAVH-KYKDSREQFE
RS10_CLOPE      ----SKQKIRIRLKAFDHTILDQSAEKIVETAKSTGAKVVGPVPLPTEKDVITILRAVH-KYKDSREQFE
RS10_CLOP1      ----SKQKIRIRLKAFDHTILDQSAEKIVETAKSTGAKVVGPVPLPTEKDVITILRAVH-KYKDSREQFE
RS10_CLOBB      ----SKQKIRIRLKAFDHTILDQSAEKIVETAKTSGAKVVGPVPLPTEKDVVTILRAVH-KYKDSREQFE
RS10_CLOBA      ----SKQKIRIRLKAFDHTILDQSAEKIVETAKTSGAKVVGPVPLPTEKDVVTILRAVH-KYKDSREQFE
RS10_CLOB8      ----SKQKIRIRLKAFDHTILDQSAEKIVETAKTSGAKVVGPVPLPTEKDVVTILRAVH-KYKDSREQFE
RS10_ACIC1      ------QKIRIRLKAYDHEVIDSSARKIVETVTRTGARVAGPVPLPTEKNVYCVIRSPH-KDKDSREHFE
RS10_THENN      ------QRIRIKLKAYDHELLDESAKKIVEVAKSTNSKVSGPIPLPTERTLYCVLRSPM-KHKDSREHFE
RS10_THEFY      ------QKIRIRLKAYDHEVIDKSARRIVETVTRTGAQVAGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_RHOFD      --MATKQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPTRFKRFDILRSPH-VNKTSRDQFE
RS10_MACCJ      ----AKQKIRIRLKAYDHRIIDQSAEKIVETAKRSGAEVSGPIPLPTEKTVYTIIRAVH-KYKDSREQFE
RS10_FRASN      ------QKIRIRLKAYDHEVIDSSARKIVETVTRTGAQVAGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_VARPS      --MATKQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPTRMKRFDILRSPH-VNKTSRDQLE
RS10_STRZT      ----ANKKIRIRLKAYKHRTLDTAAAKIVESATRTGAQVAGPIPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRZP      ----ANKKIRIRLKAYEHRTLDTAAAKIVESATRTGAQVAGPIPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRZJ      ----ANKKIRIRLKAYEHRTLDTAAAKIVESATRTGAQVAGPIPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRR6      ----ANKKIRIRLKAYEHRTLDTAAAKIVESATRTGAQVAGPIPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRPS      ----ANKKIRIRLKAYEHRTLDTAAAKIVESATRTGAQVAGPIPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRPN      ----ANKKIRIRLKAYEHRTLDTAAAKIVESATRTGAQVAGPIPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRPJ      ----ANKKIRIRLKAYEHRTLDTAAAKIVESATRTGAQVAGPIPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRPI      ----ANKKIRIRLKAYEHRTLDTAAAKIVESATRTGAQVAGPIPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRP7      ----ANKKIRIRLKAYEHRTLDTAAAKIVESATRTGAQVAGPIPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRP4      ----ANKKIRIRLKAYEHRTLDTAAAKIVESATRTGAQVAGPIPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRP2      ----ANKKIRIRLKAYEHRTLDTAAAKIVESATRTGAQVAGPIPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STAHJ      ----AKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGAEVSGPIPLPTEKSVYTIIRA-----VHMYEQFE
RS10_STACT      ----AKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGAEVSGPIPLPTEKSVYTIIRAVH-KYKDSREQFE
RS10_POLSJ      --MATKQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPTRMKRFDILRSPH-VNKTSRDQLE
RS10_POLNA      --MATKQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPTRMKRFDILRSPH-VNKTSRDQLE
RS10_NOCSJ      ------QKIRIRLKAYDHEVIDTSARKIVDTVTRTGAKVAGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_KINRD      ------QKIRIRLKAYDHEVIDSSARKIVDTVTRTGASVAGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_DIAST      ----SKQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPTRMKRFDILRSPH-VNKTSRDQFE
RS10_DELAS      ----SKQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPTRMKRFDILRSPH-VNKTSRDQFE
RS10_DEIRA      -------KIRIKLRGFDHKALDQSASKIVDTVRRTGADVSGPVPLPTRIRRFTVLRSPF-KYKDSREHFE
RS10_DEIGD      -------KIRIKLRGFDHKALDQSASKIVDTVRRTGADVSGPVPLPTRIRRFTVLRSPF-KYKDSREHFE
RS10_BACWK      ----AKEKIRIRLKAYDHRILDQSAEKIVETAKRSGATVSGPIPLPTEKTIYTILRAVH-KYKDSREQFE
RS10_BACSU      ----AKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSVYTILRAVH-KYKDSREQFE
RS10_BACSK      ----AKQKIRIRLKAYDHRVLDQSAEKIVETAKRSGASVSGPIPLPTEKSVYTILRAVH-KYKDSREQFE
RS10_BACP2      ----AKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSVYTILRAVH-KYKDSREQFE
RS10_BACLD      ----AKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSVYTILRAVH-KYKDSREQFE
RS10_BACHD      ----AKQKIRIRLKAYDHRVLDQSAEKIVETAKRSGANVSGPIPLPTEKSVYTILRAVH-KYKDSREQFE
RS10_BACC2      ----AKEKIRIRLKAYDHRILDQSAEKIVETAKRSGATVSGPIPLPTEKTIYTILRAVH-KYKDSREQFE
RS10_BACA2      ----AKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSVYTILRAVH-KYKDSREQFE
RS10_ALCBS      ----ANQRIRIRLKAFDHRLIDQSAQEIVDTAKRTGAQVTGPIPLPTRKERFTVLVSPH-VNKDARDQYE
RS10_ACISJ      ----SKQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPTRMKRFDILRSPH-VNKTSRDQFE
RS10_ACIAC      ----SKQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPTRMKRFDILRSPH-VNKTSRDQFE
RS10_MARMS      ------QKIRIRLKAFDHRLIDASTQEIVDTAKRTGAQVRGPIPLPTRKERYTVLISPH-VNKDARDQYE
RS10_DICNV      --MASTQKIRIRLKSYDHRLIDASAKQIVETAKRAGAQVKGPIPLPVKKEIYTVLISPH-VNKDARDQYE
RS10_BIFAA      ------QKIRIRLKSYDHEVIDQSAKKIVETVTNAGATVVGPVPLPTEKNVLVVIRSPH-KYKDSREHFE
RS10_BACHK      ----AKEKIRIRLKAYDHRILDQSAEKIVETAKRSGATVSGPIPLPTEKTVYTILRAVH-KYKDSREQFE
RS10_BACCZ      ----AKEKIRIRLKAYDHRILDQSAEKIVETAKRSGATVSGPIPLPTEKTVYTILRAVH-KYKDSREQFE
RS10_BACCR      ----AKEKIRIRLKAYDHRILDQSAEKIVETAKRSGATVSGPIPLPTEKTVYTILRAVH-KYKDSREQFE
RS10_BACCQ      ----AKEKIRIRLKAYDHRILDQSAEKIVETAKRSGATVSGPIPLPTEKTVYTILRAVH-KYKDSREQFE
RS10_BACCN      ----AKEKIRIRLKAYDHRILDQSAEKIVETAKRSGATVSGPIPLPTEKTVYTILRAVH-KYKDSREQFE
RS10_BACC7      ----AKEKIRIRLKAYDHRILDQSAEKIVETAKRSGATVSGPIPLPTEKTVYTILRAVH-KYKDSREQFE
RS10_BACC4      ----AKEKIRIRLKAYDHRILDQSAEKIVETAKRSGATVSGPIPLPTEKTVYTILRAVH-KYKDSREQFE
RS10_BACC3      ----AKEKIRIRLKAYDHRILDQSAEKIVETAKRSGATVSGPIPLPTEKTVYTILRAVH-KYKDSREQFE
RS10_BACC0      ----AKEKIRIRLKAYDHRILDQSAEKIVETAKRSGATVSGPIPLPTEKTVYTILRAVH-KYKDSREQFE
RS10_BACAH      ----AKEKIRIRLKAYDHRILDQSAEKIVETAKRSGATVSGPIPLPTEKTVYTILRAVH-KYKDSREQFE
RS10_YERPY      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_YERPS      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_YERPP      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_YERPN      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_YERPG      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_YERPE      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_YERPB      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_YERPA      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_YERP3      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_YERE8      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_STRSV      ----ANKKIRIRLKAYEHRTLDTAAAKIVETATRTGAEVAGPIPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRS2      ----ANKKIRIRLKAYEHRTLDTAAAKIVETATRTGAQVAGPVPLPTERSFYTIIRA-THKYKDSREQFE
RS10_STRGC      ----ANKKIRIRLKAYEHRTLDTAAAKIVETATRTGAEVAGPIPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STAES      ----AKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVH-KYKDSREQFE
RS10_STAEQ      ----AKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVH-KYKDSREQFE
RS10_STAAW      ----AKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVH-KYKDSREQFE
RS10_STAAS      ----AKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVH-KYKDSREQFE
RS10_STAAR      ----AKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVH-KYKDSREQFE
RS10_STAAN      ----AKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVH-KYKDSREQFE
RS10_STAAM      ----AKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRA-----VHMYEQFE
RS10_STAAE      ----AKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVH-KYKDSREQFE
RS10_STAAC      ----AKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRA-----VHMYEQFE
RS10_STAAB      ----AKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVH-KYKDSREQFE
RS10_STAA9      ----AKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVH-KYKDSREQFE
RS10_STAA3      ----AKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVH-KYKDSREQFE
RS10_STAA2      ----AKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVH-KYKDSREQFE
RS10_STAA1      ----AKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRA-----VHMYEQFE
RS10_SERP5      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_SALTY      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_SALTI      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_SALSV      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_SALPK      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_SALPC      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_SALPB      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_SALPA      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_SALNS      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_SALHS      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_SALG2      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_SALEP      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_SALDC      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_SALCH      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_SALAR      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_SALA4      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_PSYIN      ------QRIRIRLKAFDHKLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTILVSPH-VNKDARDQYE
RS10_PROMH      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_PHOLL      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_PECCP      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_PASMU      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_MANSM      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_LEPCP      -----KQKIRIRLKAFDYKLIDQSAQEIVETAKRTGAIVKGPVPLPTRMQRFDILRSPH-VNKTSRDQFE
RS10_KLEP7      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_KLEP3      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_HAES2      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_HAES1      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_HAEPS      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_HAEIN      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_HAEIG      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_HAEIE      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_HAEI8      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_HAEDU      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRAGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_FERNB      ------QKIRIRLRAYDHRLLDESAKKIVEVAKQTNAKVSGPIPLPTERSLYVVLRSPL-KHKDSREQFE
RS10_ESCF3      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ERWT9      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ENTS8      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_EDWI9      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_CLONN      ----ANQKIRIRLKAFDHNILDQSAEKIVETAKNTGAKVAGPVPLPTEKDVVTILRA-THKYKDSREQFE
RS10_CITK8      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_BUCAT      ------QRIRIRLKAFDHRLIDQSTTEIVETAKRTGAQVRGPIPLPTRKERFTILVSPH-VNKDARDQYE
RS10_BUCAP      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTILISPH-VNKDARDQYE
RS10_BUCAI      ------QRIRIRLKAFDHRLIDQSTTEIVETAKRTGAQVRGPIPLPTRKERFTILVSPH-VNKDARDQYE
RS10_BUCA5      ------QRIRIRLKAFDHRLIDQSTTEIVETAKRTGAQVRGPIPLPTRKERFTILVSPH-VNKDARDQYE
RS10_ACTSZ      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ACTPJ      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ACTP7      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ACTP2      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_VIBFM      ------QRIRIRLKAFDYKLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLTSPH-VNKDARDQYE
RS10_VIBF1      ------QRIRIRLKAFDYKLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLTSPH-VNKDARDQYE
RS10_VEREI      ----SKQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPTRMKRFDILRSPH-VNKTSRDQLE
RS10_THEM4      ------QKIRIRLKAYDHKLLDESAKKIVEVVKQTNAKVSGPVPLPTERTLYVVLRSPL-KHKDSREQFE
RS10_STRMU      ----ANKKIRIRLKAYEHRTLDTAAEKIVETATRTGASVAGPVPLPTERSLYTVIRA-THKYKDSREQFE
RS10_SODGM      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTILISPH-VNKDARDQYE
RS10_SACEN      ------QKIRIRLKAYDHEAIDASARKIVETVTRTGARVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_PSEHT      ----SNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRFERFTVLTSPH-VNKDARDQYE
RS10_MICLC      ------QKIRIRLKSYDHEVIDVSARKIVDTVTRAGATVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_LACH4      --------IRIRLKSYEHGILDESAAKIVATAKRTGAEISGPVPLPTERTLFTVLRSPH-KNKDSREQFE
RS10_LACAC      --------IRIRLKSYEHGILDESAAKIVATAKRTGAEISGPVPLPTERTLFTVLRSPH-KNKDSREQFE
RS10_ERWCT      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTILISPH-VNKDARDQYE
RS10_ENT38      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTILISPH-VNKDARDQYE
RS10_BACAN      ----AKEKIRIRLKAYDHRILDQSADKIVETAKRSGATVSGPIPLPTEKTVYTILRAVH-KYKDSREQFE
RS10_BACAC      ----AKEKIRIRLKAYDHRILDQSADKIVETAKRSGATVSGPIPLPTEKTVYTILRAVH-KYKDSREQFE
RS10_BACAA      ----AKEKIRIRLKAYDHRILDQSADKIVETAKRSGATVSGPIPLPTEKTVYTILRAVH-KYKDSREQFE
RS10_ALISL      ------QRIRIRLKAFDYKLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLTSPH-VNKDARDQYE
RS10_TREPS      ----ARERIRVKLCGFDVELVDQSSRAIVHAVQKAGAEVLGPIPLPTRMHKFTVLRSPH-VNKKSREQFE
RS10_TREPA      ----ARERIRVKLCGFDVELVDQSSRAIVHAVQKAGAEVLGPIPLPTRMHKFTVLRSPH-VNKKSREQFE
RS10_STRPC      ----ANKKIRIRLKAYEHRTLDTAAEKIVETATRTGAKVAGPVPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRPB      ----ANKKIRIRLKAYEHRTLDTAAEKIVETATRTGAKVAGPVPLPTERSLYTIIRA-THKYKDSREQFE
RS10_METPP      -----KQKIRIRLKAFDYKLIDQSALEIVDTAKRTGAIVKGPVPLPTRMQRFDILRSPH-VNKSSRDQFE
RS10_FINM2      ----ANQKIRIRLRAYDHELIDQSAQKIVEAAKRTDVKVSGPIPLPTEKEVITILRAVH-KYKDSREQFE
RS10_BORPD      ------QKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAVVRGPVPLPTRIRRYDVLRSPH-VNKSSRDQFE
RS10_BIFLO      ------QKIRIRLKSYDHEVIDQSAKKIVETVTNAGATVVGPVPLPTEKNVFCVIRSPH-KYKDSREHFE
RS10_BIFLD      ------QKIRIRLKSYDHEVIDQSAKKIVETVTNAGATVVGPVPLPTEKNVFCVIRSPH-KYKDSREHFE
RS10_BIFA0      ------QKIRIRLKSYDHEVIDQSAKKIVETVTNAGATVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RR10_GRATL      MKIHEQNKIRIKLQAYNHTLLDMSCKTIIDTAHRTKVQAKGPITLPAKRKIYCILRSPH-VDKDSREHFE
RS10_TOLAT      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_STRU0      ----ANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRT2      ----ANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRS7      ----ANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRE4      ----ANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTIIRA-THKYKDSREQFE
RS10_ROSCS      ----AKQKVRIRLKAYDHKILDQSARQIVEAAERTGALVAGPVPLPTKIEKYSVIRSPF-IDKDSQEQFE
RS10_PHOPR      ------QRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVKGPIPLPTRKERFTVLTSPH-VNKDARDQYE
RS10_CORGL      ------QKIRIRLKAYDHEAIDASARKIVETVTRTGARVVGPVPLPTEKNVYAVIRSPH-KYKDSREHFE
RS10_CORGB      ------QKIRIRLKAYDHEAIDASARKIVETVTRTGARVVGPVPLPTEKNVYAVIRSPH-KYKDSREHFE
RS10_COREF      ------QKIRIRLKAYDHEAIDASARKIVETVTRTGARVVGPVPLPTEKNVYAVIRSPH-KYKDSREHFE
RS10_CELJU      ------QRIRIRLKAFDHKLIDASTQEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_BUCBP      --MQQNQRIRIRLKAFDHRLIDQSTSEIVETAKRTGAQVRGPIPLPTHKEKFTVLISPH-VNKDARDQYE
RS10_BORPE      ------QKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAVVRGPVPLPTRIRRYDVLRSPH-VNKTSRDQFE
RS10_BORBR      ------QKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAVVRGPVPLPTRIRRYDVLRSPH-VNKTSRDQFE
RS10_BORA1      ------QKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAVVRGPVPLPTRIRRYDVLRSPH-VNKTSRDQFE
RS10_BIFLI      ------QKIRIRLKSYDHEVIDQSAKKIVETVTNAGATVVGPVPLPTEKNVFCVIRSPH-MYKDSREHFE
RS10_WIGBR      ------QRIRIRLKAFDHRLIDQSTSEIVETAKRTGAQVRGPIPLPTRKEKFTILVSPH-VDKDARDQYE
RS10_THICR      ------QNIRIRLKAFDHRLIDQSAREITETAKRTGAQVKGPIPMPTRKERFTVLVSPH-VNKDARDQYE
RS10_STRPZ      ----ANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRPM      ----ANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRPG      ----ANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRPF      ----ANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRPD      ----ANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRP8      ----ANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRP6      ----ANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRP3      ----ANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRP1      ----ANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRA5      ----ANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRA3      ----ANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTIIRA-THKYKDSREQFE
RS10_STRA1      ----ANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTIIRA-THKYKDSREQFE
RS10_SACD2      ------QRIRIRLKAFDHKLIDASTQEIVETAKRTGAQVRGPIPLPTRKERYTVLVSPH-VNKDARDQYE
RS10_RHOSR      ------QKIRIRLKAYDHEAIDASARKIVETVTRTGARVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_RHOOB      ------QKIRIRLKAYDHEAIDASARKIVETVTRTGARVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_RHOE4      ------QKIRIRLKAYDHEAIDASARKIVETVTRTGARVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_PSEU2      ------QQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLVSPH-VNKDARDQYE
RS10_PSESM      ------QQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLVSPH-VNKDARDQYE
RS10_PSE14      ------QQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLVSPH-VNKDARDQYE
RS10_NOCFA      ------QKIRIRLKAYDHEAIDASARKIVETVTRTGARVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_LACJO      ------QQIRIRLKSYEHGILDESAAKIVATAERTGAQISGPVPLPTERTLFTVLRSPH-KNKDSREQFE
RS10_LACGA      ------QQIRIRLKSYEHGILDESAAKIVATAERTGAQISGPVPLPTERTLFTVLRSPH-KNKDSREQFE
RS10_IDILO      ----ANQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_DECAR      ----ANQKIRIRLKAFDYRLIDQSAQEIVETAKRTGAVVRGPVPLPTRKQRFDILRSPH-VNKASRDQLE
RS10_CHLTR      -----KQRIRIRLKGFDQGQLDQSTANIVETAKRTGARVVGPIPLPTKREVYTVLRSPH-VDKKSREQFE
RS10_CHLTB      -----KQRIRIRLKGFDQGQLDQSTANIVETAKRTGARVVGPIPLPTKREVYTVLRSPH-VDKKSREQFE
RS10_CHLTA      -----KQRIRIRLKGFDQGQLDQSTANIVETAKRTGARVVGPIPLPTKREVYTVLRSPH-VDKKSREQFE
RS10_CHLT2      -----KQRIRIRLKGFDQGQLDQSTANIVETAKRTGARVVGPIPLPTKREVYTVLRSPH-VDKKSREQFE
RS10_CHLMU      -----KQRIRIRLKGFDQGQLDQSTANIVETAKRTGARVVGPIPLPTKREVYTVLRSPH-VDKKSREQFE
RS10_STRTD      ----ANKKIRIRLKAYEHRTLDTAAGKIVETATRTGATVAGPVPLPTERSLYTIIRA-THKYKDSREQFE
RS10_SHISS      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_SHIFL      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_SHIF8      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_SHIDS      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_SHIBS      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_SHIB3      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ROSS1      ----AKQKVRIRLKAYDHKILDQSARQIVEAAERTGALVAGPVPLPTKIEKHSVIRSPF-IDKDSQEQFE
RS10_MYCVP      ------QKIRIRLKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_MYCSS      ------QKIRIRLKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_MYCSK      ------QKIRIRLKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_MYCSJ      ------QKIRIRLKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_MYCS2      ------QKIRIRLKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_MYCGI      ------QKIRIRLKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_MYCA9      ------QKIRIRLKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_KOCRD      ------QKIRIRLKSYDHEVIDVSARKIVETVTRAGATVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_ECOUT      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ECOSM      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ECOSE      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ECOLU      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ECOLI      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ECOLC      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ECOL6      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ECOL5      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ECOK1      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ECOHS      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ECODH      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ECOBW      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ECO8A      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ECO81      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ECO7I      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ECO5E      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ECO57      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ECO55      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ECO45      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ECO27      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_ECO24      ------QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_DEIDV      -------KIRIKLRGFDHKALDQSASKIVDTVRRTGADVSGPVPLPTRIRRFCVLRSPF-KYKDAREHFE
RS10_CORU7      ------QKIRIRLKAYDHEAIDASAKKIVETVTRTGARVVGPVPLPTEKNVYCVIRSPH-KDKDSREHFE
RS10_BURVG      -----QQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPH-VNKTSRDQLE
RS10_BURTA      -----QQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPH-VNKTSRDQLE
RS10_BURS3      -----QQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPH-VNKTSRDQLE
RS10_BURPS      -----QQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPH-VNKTSRDQLE
RS10_BURP6      -----QQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPH-VNKTSRDQLE
RS10_BURP1      -----QQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPH-VNKTSRDQLE
RS10_BURP0      -----QQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPH-VNKTSRDQLE
RS10_BURMS      -----QQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPH-VNKTSRDQLE
RS10_BURMA      -----QQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPH-VNKTSRDQLE
RS10_BURM9      -----QQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPH-VNKTSRDQLE
RS10_BURM7      -----QQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPH-VNKTSRDQLE
RS10_BURM1      -----QQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPH-VNKTSRDQLE
RS10_BURCM      -----QQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPH-VNKTSRDQLE
RS10_BURCJ      -----QQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPH-VNKTSRDQLE
RS10_BURCH      -----QQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPH-VNKTSRDQLE
RS10_BURCC      -----QQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPH-VNKTSRDQLE
RS10_BURCA      -----QQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPH-VNKTSRDQLE
RS10_BURA4      -----QQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPH-VNKTSRDQLE
RS10_ARTS2      ------QKIRIRLKSYDHEVIDVSARKIVETVTRAGATVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_ARTCA      ------QKIRIRLKSYDHEVIDVSARKIVETVTRAGATVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_ARTAT      ------QKIRIRLKSYDHEVIDVSARKIVETVTRAGATVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RR10_PORPU      MTVTQQPKIRIKLKAYNSSLLNTSCKKIVDTAERTNAIAVGPIPLPTKRRIYCVLRSPH-VDKDSREHFE
RS10_TROWT      ------QKIRIRLKSYSHEIIDVSAKKIVDTVTRAGATIVGPVPLPTKKSVVCVIRSPH-RHKDSREHFE
RS10_TROW8      ------QKIRIRLKSYSHEIIDVSAKKIVDTVTRAGATIVGPVPLPTKKSVVCVIRSPH-RHKDSREHFE
RS10_SPIPL      MATIQQQKIRIRLKAFDRRLLDTSCEKIVDTANRTGATALGPIPLPTKRRIYCVLRSPH-VDKDSREHFE
RS10_RHOPB      ------QNIRIRLKAFDHRILDSSTREIVNTAKRTGAQVRGPIPLPTRIEKFTVNRSPH-VDKKSREQFE
RS10_MYCUA      ------QKIRIRLKAYDHEAIDASARKIVETVVRTGASVVGPVPLPTEKNVYCVVRSPH-KYKDSREHFE
RS10_MYCTU      ------QKIRIRLKAYDHEAIDASARKIVETVVRTGASVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_MYCTA      ------QKIRIRLKAYDHEAIDASARKIVETVVRTGASVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_MYCPA      ------QKIRIRLKAYDHEAIDASARKIVETVVRTGASVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_MYCMM      ------QKIRIRLKAYDHEAIDASARKIVETVVRTGASVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_MYCLE      ------QKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_MYCLB      ------QKIRIRLKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_MYCBT      ------QKIRIRLKAYDHEAIDASARKIVETVVRTGASVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_MYCBP      ------QKIRIRLKAYDHEAIDASARKIVETVVRTGASVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_MYCBO      ------QKIRIRLKAYDHEAIDASARKIVETVVRTGASVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_MYCA1      ------QKIRIRLKAYDHEAIDASARKIVETVVRTGASVVGPVPLPTEKNVYCVIRSPH-KYKDSREHFE
RS10_METCA      ----AKQRIRIRLKAFDHRLIDQSASEIVETAKRTGAQVLGPIPLPTKKERFTVLVSPH-VNKDARDQYE
RS10_LEPIN      ------QKIRVKLKAFDHRLIDQSTYEIVATAKRTGATVSGPIPLPTKKEIYTVLRSPH-VNKKSREQFE
RS10_LEPIC      ------QKIRVKLKAFDHRLIDQSTYEIVATAKRTGATVSGPIPLPTKKEIYTVLRSPH-VNKKSREQFE
RS10_LEPBJ      ------QKIRVKLKAFDHRLIDQSTYEIVATAKRTGATVSGPIPLPTKKEIYTVLRSPH-VNKKSREQFE
RS10_CORDI      ------QKIRIRLKAYDHEAIDASAKKIVETVTRTGARVVGPVPLPTEKNVYAVIRSPH-KYKDSREHFE
RS10_CORA7      ------QKIRIRLKAYDHEAIDASAKKIVETVTRTGARVVGPVPLPTEKNVYAVIRSPH-KYKDSREHFE
RS10_BURXL      ------QKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPH-VNKTSRDQLE
RS10_BURPP      ------QKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPH-VNKTSRDQLE
RS10_BURP8      ------QKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPH-VNKTSRDQLE
RS10_AZOSE      ------QKIRIRLKAFDYRLIDQSALEIVDTAKRTGAVVRGPVPLPTRIERFDLLRSPH-VNKASRDQFE
RS10_TREDE      ----TKEKIRVKLRGFDVELVDQSSKAIVQAVQKAGAKVCGPIPLPTRINKFTVLRSPH-VNKKSREQFE
RS10_STREM      ----ANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTIIRA-THKYKDSREQFE
RS10_SALTO      ------QKIRIRLKAYDHEVVDSSARKIVETVTRTGAQVAGPVPLPTEINRFCVIRSPH-KYKDSREHFE
RS10_SALAI      ------QKIRIRLKAYDHEVVDSSARKIVETVTRTGAQVAGPVPLPTEINRFCVIRSPH-KYKDSREHFE
RS10_RHORT      ------QNIRIRLKAFDHRVLDQSTREIVSTAKRTGAQVRGPIPLPTRIEKFTVNRSPH-IDKKSREQFE
RS10_RHOPT      ------QNIRIRLKAFDHRILDTSTREIVNTAKRTGAQVRGPIPLPTRIEKFTVNRSPH-VDKKSREQFE
RS10_RHOPS      ------QNIRIRLKAFDHRILDTSTREIVNTAKRTGAQVRGPIPLPTRIEKFTVNRSPH-VDKKSREQFE
RS10_RHOPA      ------QNIRIRLKAFDHRILDTSTREIVNTAKRTGAQVRGPIPLPTRIEKFTVNRSPH-VDKKSREQFE
RS10_RHOP5      ------QNIRIRLKAFDHRILDTSTREIVNTAKRTGAQVRGPIPLPTRIEKFTVNRSPH-VDKKSREQFE
RS10_RHOP2      ------QNIRIRLKAFDHRILDTSTREIVNTAKRTGAQVRGPIPLPTRIEKFTVNRSPH-VDKKSREQFE
RS10_PSEU5      ------QQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLVSPH-VNKDARDQYE
RS10_PSEPW      ------QQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLVSPH-VNKDARDQYE
RS10_PSEPK      ------QQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLVSPH-VNKDARDQYE
RS10_PSEPG      ------QQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLVSPH-VNKDARDQYE
RS10_PSEPF      ------QQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLVSPH-VNKDARDQYE
RS10_PSEP1      ------QQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLVSPH-VNKDARDQYE
RS10_PSEMY      ------QQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERYTVLISPH-VNKDARDQYE
RS10_PSEFS      ------QQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLVSPH-VNKDARDQYE
RS10_PSEF5      ------QQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLVSPH-VNKDARDQYE
RS10_PSEE4      ------QQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_PSEAE      ------QQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_PSEAB      ------QQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_PSEA8      ------QQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_PSEA7      ------QQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLISPH-VNKDARDQYE
RS10_PLARO      ------QKIRIRLKAYDHEVIDSSAKKIVETVTRTGAKVAGPVPLPTEKNVYCVIRSPHND-KDSREHFE
RS10_OLICO      ------QNIRIRLKAFDHRVLDTSTREIVNTAKRTGAQVRGPIPLPTRIEKFTVNRSPH-VDKKSREQFE
RS10_NITWN      ------QNIRIRLKAFDHRILDTSTREIVNTAKRTGAQVRGPIPLPTRIEKFTVNRSPH-VDKKSREQFE
RS10_NITHX      ------QNIRIRLKAFDHRILDTSTREIVNTAKRTGAQVRGPIPLPTRIEKFTVNRSPH-VDKKSREQFE
RS10_LEPBP      ------QRIRVKLKAFDHRLIDQSTFEIVATAKRTGATVSGPIPLPTKKEIYTVLRSPH-VNKKAREQFE
RS10_LEPBA      ------QRIRVKLKAFDHRLIDQSTFEIVATAKRTGATVSGPIPLPTKKEIYTVLRSPH-VNKKAREQFE
RS10_FRATW      ----NNQRIRIRLKAFDHKLIDISTQEIVDTAKKTGAQVKGPIPLPVRKERFTILISPH-VNKKARDQYE
RS10_FRATT      ----NNQRIRIRLKAFDHKLIDISTQEIVDT