[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL64590.1

[Show Plain Result]


## Summary of Sequence Search
    1::213
   17::235     4e-34  40%  247 aa  RIBB_METMA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    4::216     8e-33  39%  227 aa  RIBB_METJA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::235     1e-32  38%  247 aa  RIBB_METAC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    7::220     3e-31  38%  229 aa  RIBB_METTH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    3::222     2e-28  38%  238 aa  RIBB_ARCFU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    5::194     3e-23  40%  397 aa  RIBBA_BACSK RecName: Full=Riboflavin biosynthesis protein
    5::189     2e-21  35%  397 aa  RIBBA_BACWK RecName: Full=Riboflavin biosynthesis protein
    5::189     9e-21  35%  397 aa  RIBBA_BACCR RecName: Full=Riboflavin biosynthesis protein
    5::189     9e-21  35%  397 aa  RIBBA_BACC4 RecName: Full=Riboflavin biosynthesis protein
    5::189     3e-20  35%  397 aa  RIBBA_BACC2 RecName: Full=Riboflavin biosynthesis protein
    5::189     5e-20  34%  397 aa  RIBBA_BACCQ RecName: Full=Riboflavin biosynthesis protein
    5::189     5e-20  34%  397 aa  RIBBA_BACC7 RecName: Full=Riboflavin biosynthesis protein
    5::189     5e-20  34%  397 aa  RIBBA_BACC1 RecName: Full=Riboflavin biosynthesis protein
    5::194     6e-20  34%  398 aa  RIBBA_BACAM RecName: Full=Riboflavin biosynthesis protein
    5::194     8e-20  34%  398 aa  RIBBA_BACSU RecName: Full=Riboflavin biosynthesis protein
    5::189     1e-19  34%  397 aa  RIBBA_BACHK RecName: Full=Riboflavin biosynthesis protein
    5::189     1e-19  34%  397 aa  RIBBA_BACCZ RecName: Full=Riboflavin biosynthesis protein
    5::189     1e-19  34%  397 aa  RIBBA_BACC3 RecName: Full=Riboflavin biosynthesis protein
    5::189     1e-19  34%  397 aa  RIBBA_BACAN RecName: Full=Riboflavin biosynthesis protein
    5::189     1e-19  34%  397 aa  RIBBA_BACAH RecName: Full=Riboflavin biosynthesis protein
    5::189     1e-19  34%  397 aa  RIBBA_BACAC RecName: Full=Riboflavin biosynthesis protein
    5::189     1e-19  34%  397 aa  RIBBA_BACAA RecName: Full=Riboflavin biosynthesis protein
    5::189     2e-19  34%  397 aa  RIBBA_BACC0 RecName: Full=Riboflavin biosynthesis protein
    9::199     3e-19  37%  404 aa  RIBBA_BACFR RecName: Full=Riboflavin biosynthesis protein
    9::199     3e-19  37%  404 aa  RIBBA_BACFN RecName: Full=Riboflavin biosynthesis protein
   12::199     3e-19  37%  406 aa  RIBBA_AQUAE RecName: Full=Riboflavin biosynthesis protein
    5::194     4e-19  34%  398 aa  RIBBA_BACA2 RecName: Full=Riboflavin biosynthesis protein
    9::193     3e-18  30%  401 aa  RIBBA_ACTPL RecName: Full=Riboflavin biosynthesis protein
    9::193     3e-18  30%  401 aa  RIBBA_ACTPJ RecName: Full=Riboflavin biosynthesis protein
    9::193     3e-18  30%  401 aa  RIBBA_ACTP7 RecName: Full=Riboflavin biosynthesis protein
    9::193     3e-18  30%  401 aa  RIBBA_ACTP2 RecName: Full=Riboflavin biosynthesis protein
    5::194     3e-18  35%  397 aa  RIBBA_GEOSW RecName: Full=Riboflavin biosynthesis protein
    9::194     6e-18  34%  404 aa  RIBBA_BACTN RecName: Full=Riboflavin biosynthesis protein
    9::194     2e-17  34%  404 aa  RIBBA_BACV8 RecName: Full=Riboflavin biosynthesis protein
    5::189     2e-17  31%  397 aa  RIBBA_BACCN RecName: Full=Riboflavin biosynthesis protein
    7::168     5e-17  38%  207 aa  RIBB_OCEIH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    5::200     6e-17  33%  204 aa  RIB3_SCHPO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    5::189     8e-17  33%  396 aa  RIBBA_THEPX RecName: Full=Riboflavin biosynthesis protein
    5::189     8e-17  33%  396 aa  RIBBA_THEP3 RecName: Full=Riboflavin biosynthesis protein
    7::196     2e-16  34%  363 aa  RIBB_NEIMA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    6::168     2e-16  36%  369 aa  RIBB_PSESM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    7::184     2e-16  36%  363 aa  RIBB_NEIMB RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    6::196     3e-16  38%  213 aa  RIBB_AGRT5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    6::195     4e-16  33%  393 aa  RIBBA_STAES RecName: Full=Riboflavin biosynthesis protein
    6::195     4e-16  33%  393 aa  RIBBA_STAEQ RecName: Full=Riboflavin biosynthesis protein
    9::200     4e-16  33%  405 aa  RIBBA_PORGI RecName: Full=Riboflavin biosynthesis protein
    9::200     4e-16  33%  405 aa  RIBBA_PORG3 RecName: Full=Riboflavin biosynthesis protein
    9::172     5e-16  36%  405 aa  RIBBA_PARD8 RecName: Full=Riboflavin biosynthesis protein
    5::189     5e-16  33%  399 aa  RIBBA_BREBN RecName: Full=Riboflavin biosynthesis protein
    7::197     7e-16  30%  219 aa  RIBB_METLZ RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    7::194     7e-16  36%  425 aa  RIBBA_MYCUA RecName: Full=Riboflavin biosynthesis protein
    7::194     7e-16  36%  425 aa  RIBBA_MYCMM RecName: Full=Riboflavin biosynthesis protein
    6::165     9e-16  34%  355 aa  RIBB_HELHP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    6::195     9e-16  32%  393 aa  RIBBA_STAHJ RecName: Full=Riboflavin biosynthesis protein
    6::165     1e-15  33%  344 aa  RIBB_HELPJ RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    6::182     2e-15  33%  347 aa  RIBB_WOLSU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   26::211     2e-15  34%  223 aa  RIBB_RALEJ RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    9::172     2e-15  37%  409 aa  RIBBA_PELLD RecName: Full=Riboflavin biosynthesis protein
    7::172     2e-15  37%  423 aa  RIBBA_MYCVP RecName: Full=Riboflavin biosynthesis protein
   16::205     3e-15  30%  228 aa  RIBB_CHLT3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    5::189     3e-15  32%  398 aa  RIBBA_SYNWW RecName: Full=Riboflavin biosynthesis protein
    9::200     3e-15  33%  410 aa  RIBBA_PROVI RecName: Full=Riboflavin biosynthesis protein
    7::194     3e-15  34%  425 aa  RIBBA_MYCTU RecName: Full=Riboflavin biosynthesis protein
    7::194     3e-15  34%  425 aa  RIBBA_MYCTA RecName: Full=Riboflavin biosynthesis protein
    7::194     3e-15  34%  425 aa  RIBBA_MYCBT RecName: Full=Riboflavin biosynthesis protein
    7::194     3e-15  34%  425 aa  RIBBA_MYCBP RecName: Full=Riboflavin biosynthesis protein
    7::194     3e-15  34%  425 aa  RIBBA_MYCBO RecName: Full=Riboflavin biosynthesis protein
    6::165     3e-15  32%  344 aa  RIBB_HELPY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     4e-15  35%  217 aa  RIBB_YERE8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    6::190     8e-15  29%  393 aa  RIBBA_STAAW RecName: Full=Riboflavin biosynthesis protein
    6::190     8e-15  29%  393 aa  RIBBA_STAAS RecName: Full=Riboflavin biosynthesis protein
    6::190     8e-15  29%  393 aa  RIBBA_STAAR RecName: Full=Riboflavin biosynthesis protein
    7::194     8e-15  33%  425 aa  RIBBA_MYCPA RecName: Full=Riboflavin biosynthesis protein
    7::172     8e-15  36%  423 aa  RIBBA_MYCGI RecName: Full=Riboflavin biosynthesis protein
    7::194     8e-15  33%  425 aa  RIBBA_MYCA1 RecName: Full=Riboflavin biosynthesis protein
    9::200     8e-15  33%  405 aa  RIBBA_CYTH3 RecName: Full=Riboflavin biosynthesis protein
    6::190     1e-14  29%  393 aa  RIBBA_STAS1 RecName: Full=Riboflavin biosynthesis protein
    6::190     1e-14  29%  393 aa  RIBBA_STAAN RecName: Full=Riboflavin biosynthesis protein
    6::190     1e-14  29%  393 aa  RIBBA_STAAM RecName: Full=Riboflavin biosynthesis protein
    7::192     1e-14  34%  420 aa  RIBBA_SALAI RecName: Full=Riboflavin biosynthesis protein
    8::175     1e-14  36%  204 aa  RIB3_CANAL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     1e-14  34%  217 aa  RIBB_YERPY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     1e-14  34%  217 aa  RIBB_YERPS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     1e-14  34%  217 aa  RIBB_YERPP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     1e-14  34%  217 aa  RIBB_YERPN RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     1e-14  34%  217 aa  RIBB_YERPG RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     1e-14  34%  217 aa  RIBB_YERPE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     1e-14  34%  217 aa  RIBB_YERPB RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     1e-14  34%  217 aa  RIBB_YERPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     1e-14  34%  217 aa  RIBB_YERP3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    6::190     1e-14  29%  393 aa  RIBBA_STAAC RecName: Full=Riboflavin biosynthesis protein
   15::181     3e-14  36%  233 aa  RIB3_MAGGR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   19::202     4e-14  33%  215 aa  RIBB_HAEIG RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    7::192     4e-14  35%  400 aa  RIBBA_SALTO RecName: Full=Riboflavin biosynthesis protein
   19::202     5e-14  34%  215 aa  RIBB_HAEIE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   19::202     6e-14  34%  215 aa  RIBB_HAEIN RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    9::198     6e-14  31%  403 aa  RIBBA_UNCTG RecName: Full=Riboflavin biosynthesis protein
    9::193     8e-14  32%  414 aa  RIBBA_CLONN RecName: Full=Riboflavin biosynthesis protein
   19::201     1e-13  32%  214 aa  RIBB_PASMU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   37::213     1e-13  34%  227 aa  RIBB_RALSO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   18::207     2e-13  31%  234 aa  RIBB_PELPD RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::207     2e-13  33%  218 aa  RIBB_ERWT9 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::200     4e-13  31%  213 aa  RIBB_WIGBR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     4e-13  30%  212 aa  RIBB_HAES1 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   19::202     4e-13  34%  215 aa  RIBB_HAEI8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    9::200     4e-13  32%  421 aa  RIBBA_PROA2 RecName: Full=Riboflavin biosynthesis protein
   16::201     5e-13  33%  214 aa  RIBB_HAES2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     5e-13  32%  217 aa  RIBB_ECOSM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     5e-13  32%  217 aa  RIBB_ECOLU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    1::175     7e-13  34%  388 aa  RIBBA_THEMA RecName: Full=Riboflavin biosynthesis protein
   16::201     9e-13  31%  217 aa  RIBB_PROMH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    7::168     9e-13  33%  364 aa  RIBB_PHOLE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     9e-13  32%  222 aa  RIBB_CHLL2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     1e-12  31%  211 aa  RIBB_BAUCH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-12  32%  217 aa  RIBB_SHISS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-12  32%  217 aa  RIBB_SHIFL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-12  32%  217 aa  RIBB_SHIF8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-12  32%  217 aa  RIBB_SHIDS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-12  32%  217 aa  RIBB_SHIBS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-12  32%  217 aa  RIBB_SHIB3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-12  32%  217 aa  RIBB_ECOSE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-12  32%  217 aa  RIBB_ECOLI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-12  32%  217 aa  RIBB_ECOLC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-12  32%  217 aa  RIBB_ECOL5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-12  32%  217 aa  RIBB_ECOHS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-12  32%  217 aa  RIBB_ECODH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-12  32%  217 aa  RIBB_ECOBW RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-12  32%  217 aa  RIBB_ECO8A RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-12  32%  217 aa  RIBB_ECO7I RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-12  32%  217 aa  RIBB_ECO5E RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-12  32%  217 aa  RIBB_ECO57 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-12  32%  217 aa  RIBB_ECO55 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-12  32%  217 aa  RIBB_ECO24 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::205     2e-12  30%  217 aa  RIBB_DESAD RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-12  32%  217 aa  RIBB_ESCF3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     3e-12  30%  219 aa  RIBB_EDWI9 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     3e-12  32%  217 aa  RIBB_ECOUT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     3e-12  32%  217 aa  RIBB_ECOL6 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     3e-12  32%  217 aa  RIBB_ECOK1 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     3e-12  32%  217 aa  RIBB_ECO81 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     3e-12  32%  217 aa  RIBB_ECO45 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     3e-12  32%  217 aa  RIBB_ECO27 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::200     5e-12  31%  217 aa  RIBB_TOLAT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    4::168     5e-12  30%  339 aa  RIBB_CAMJE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::205     5e-12  30%  418 aa  RIBBA_CHLPN RecName: Full=Riboflavin biosynthesis protein
   16::178     6e-12  33%  217 aa  RIBB_CITK8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::200     6e-12  34%  422 aa  RIBBA_CORGL RecName: Full=Riboflavin biosynthesis protein
   14::200     6e-12  34%  422 aa  RIBBA_CORGB RecName: Full=Riboflavin biosynthesis protein
   17::176     8e-12  36%  356 aa  RIBB_DEHMU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::196     8e-12  27%  424 aa  RIBBA_CHLMU RecName: Full=Riboflavin biosynthesis protein
   16::201     1e-11  31%  217 aa  RIBB_SODGM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     1e-11  31%  217 aa  RIBB_PECCP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::175     1e-11  35%  219 aa  RIBB_DESDG RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::193     1e-11  33%  218 aa  RIBB_HAMD5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    7::195     2e-11  29%  363 aa  RIBB_PHOPO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-11  31%  217 aa  RIBB_KLEP7 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-11  30%  217 aa  RIBB_ENT38 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::205     3e-11  30%  217 aa  RIBB_SHELP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::175     3e-11  35%  217 aa  RIBB_DESAH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::202     4e-11  30%  218 aa  RIBB_SHEFN RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   19::201     4e-11  29%  214 aa  RIBB_MANSM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     4e-11  30%  217 aa  RIBB_KLEP3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    9::199     5e-11  28%  419 aa  RIBBA_PELPB RecName: Full=Riboflavin biosynthesis protein
    6::191     7e-11  29%  365 aa  RIBB_PSEAE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::193     7e-11  31%  217 aa  RIBB_ERWCT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::205     9e-11  32%  212 aa  RIBB_SHEPW RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   19::204     9e-11  28%  214 aa  RIBB_RHORT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    7::194     9e-11  35%  417 aa  RIBBA_MYCA9 RecName: Full=Riboflavin biosynthesis protein
   16::201     1e-10  29%  228 aa  RIBB_PHOPR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::207     1e-10  27%  217 aa  RIBB_ENTS8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::205     1e-10  32%  212 aa  RIBB_SHEHH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     1e-10  30%  217 aa  RIBB_PSEHT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::202     2e-10  29%  218 aa  RIBB_VIBPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-10  32%  217 aa  RIBB_SERP5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     3e-10  30%  217 aa  RIBB_SALAR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   21::202     3e-10  33%  230 aa  RIBB_BORPE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   21::202     3e-10  33%  230 aa  RIBB_BORPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   21::202     3e-10  33%  230 aa  RIBB_BORBR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::178     3e-10  33%  217 aa  RIBB_SALTY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::178     3e-10  33%  217 aa  RIBB_SALTI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::178     3e-10  33%  217 aa  RIBB_SALSV RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::178     3e-10  33%  217 aa  RIBB_SALPC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::178     3e-10  33%  217 aa  RIBB_SALPB RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::178     3e-10  33%  217 aa  RIBB_SALNS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::178     3e-10  33%  217 aa  RIBB_SALHS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::178     3e-10  33%  217 aa  RIBB_SALG2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::178     3e-10  33%  217 aa  RIBB_SALEP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::178     3e-10  33%  217 aa  RIBB_SALDC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::178     3e-10  33%  217 aa  RIBB_SALCH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::178     3e-10  33%  217 aa  RIBB_SALA4 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::202     4e-10  29%  218 aa  RIBB_VIBVY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::202     4e-10  29%  218 aa  RIBB_VIBVU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::202     4e-10  29%  218 aa  RIBB_VIBSL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::178     4e-10  33%  217 aa  RIBB_SALPK RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::178     4e-10  33%  217 aa  RIBB_SALPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::205     6e-10  28%  217 aa  RIBB_SHEB9 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::205     6e-10  28%  217 aa  RIBB_SHEB8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::205     6e-10  28%  217 aa  RIBB_SHEB5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::205     6e-10  28%  217 aa  RIBB_SHEB2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     6e-10  31%  217 aa  RIBB_DESRM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::205     7e-10  28%  217 aa  RIBB_SHESR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::205     7e-10  28%  217 aa  RIBB_SHESM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::205     7e-10  28%  217 aa  RIBB_SHEPC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::205     1e-09  28%  217 aa  RIBB_SHEWM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::205     1e-09  28%  217 aa  RIBB_SHESA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::196     1e-09  27%  424 aa  RIBBA_CHLTR RecName: Full=Riboflavin biosynthesis protein
  131::318     1e-09  28%  543 aa  RIBBA_ARATH RecName: Full=Riboflavin biosynthesis protein ribBA,
   16::201     2e-09  26%  217 aa  RIBB_PHOLL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::175     2e-09  32%  214 aa  RIBB_DESVV RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::175     2e-09  31%  214 aa  RIBB_DESVH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   24::198     2e-09  30%  556 aa  RIBBA_SYNY3 RecName: Full=Riboflavin biosynthesis protein
   31::191     2e-09  34%  423 aa  RIBBA_CORAM RecName: Full=Riboflavin biosynthesis protein
   17::202     2e-09  28%  218 aa  RIBB_VIBCM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::202     2e-09  28%  218 aa  RIBB_VIBCH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   18::201     2e-09  27%  223 aa  RIBB_DESDA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::202     2e-09  28%  215 aa  RIBB_DESAA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::205     3e-09  28%  217 aa  RIBB_SHESW RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::205     3e-09  28%  217 aa  RIBB_SHEON RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::202     4e-09  27%  218 aa  RIBB_VIBC3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::206     5e-09  27%  230 aa  RIBB_VIBHA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::175     5e-09  33%  213 aa  RIBB_CLOBL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     5e-09  31%  215 aa  RIBB_BUCAT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     5e-09  31%  215 aa  RIBB_BUCAI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     5e-09  31%  215 aa  RIBB_BUCA5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   18::205     5e-09  29%  213 aa  RIBB_BLOFL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::205     6e-09  32%  217 aa  RIBB_SHESH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::205     1e-08  31%  212 aa  RIBB_SHEPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   19::178     1e-08  29%  217 aa  RIBB_PELCD RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::175     2e-08  29%  214 aa  RIBB_DESPS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::201     2e-08  24%  211 aa  RIBB_BUCBP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    7::194     7e-08  29%  424 aa  RIBBA_RHOE4 RecName: Full=Riboflavin biosynthesis protein
   12::201     9e-08  29%  216 aa  RIBB_PSEPK RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::175     9e-08  32%  213 aa  RIBB_CLOBH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::175     9e-08  32%  213 aa  RIBB_CLOB1 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    7::194     9e-08  29%  417 aa  RIBBA_RHOSR RecName: Full=Riboflavin biosynthesis protein
   12::201     1e-07  25%  210 aa  RIBB_CHRVO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    7::194     8e-07  29%  414 aa  RIBBA_NOCFA RecName: Full=Riboflavin biosynthesis protein
    1::213

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGIEDAIAAFKAGRLVMIYDGDDREAEVDFVIRADAVTPTTIRWLRQNAGGLLCFVTTREVGEILGLEFL
RIBB_METMA      --INRALEALRAGKMIQIYDSDSREGETDLVIPAKAVTYTDVKWMRKDAGGLICVAVDPVASKQLKLPFM
RIBB_METJA      --VEKAIEALKKGEIILVYDSDEREGETDMVVASQFITPEHIRIMRKDAGGLICTALHPDICNKLGLEFA
RIBB_METAC      --INRALEVLRAGKMIQIYDSDSREGETDLVIPAKAVTYKDVKWMRKDAGGLICVAVDPVASKQLKLPFM
RIBB_METTH      --IQEALKALRRGEIVLVFDADNRERETDMIVAAEKIKPEHIRIMRNDAGGLICVPVSWENSEKLGIPYM
RIBB_ARCFU      LDFEESLRAFRKGSPVLIYDFEDREGETDIAIPAIHVGKDEVAMMRIDGGGLICVAIHPVAAEKLGLPFM
RIBBA_BACSK     --IDEAITQLKAGGMILVVDDEDRENEGDFLALAETASPETINFMATHGRGLICVPLTEEQAERLQLGQM
RIBBA_BACWK     --IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEEYAERLQLEPM
RIBBA_BACCR     --IEEALEDLKKGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAERLQLEPM
RIBBA_BACC4     --IEEALEDLKKGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAERLQLEPM
RIBBA_BACC2     --IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAERLQLEPM
RIBBA_BACCQ     --IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAERLQLE--
RIBBA_BACC7     --IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAERLQLE--
RIBBA_BACC1     --IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAERLQLE--
RIBBA_BACAM     --IEEALEALKKGEVIIVVDDEDRENEGDFVALAEHATPEVVNFMATHGRGLICTPLSEDIAGRLDLHPM
RIBBA_BACSU     --IEEALDALKKGEVIIVVDDEDRENEGDFVALAEHATPEVINFMATHGRGLICTPLSEEIADRLDLHPM
RIBBA_BACHK     --IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAERLQLEPM
RIBBA_BACCZ     --IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAERLQLEPM
RIBBA_BACC3     --IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAERLQLEPM
RIBBA_BACAN     --IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAERLQLEPM
RIBBA_BACAH     --IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAERLQLEPM
RIBBA_BACAC     --IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAERLQLEPM
RIBBA_BACAA     --IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAERLQLEPM
RIBBA_BACC0     --IEEALEDLKQGKVVIVCDDENRENEGDFMALAEYITPETINFMITHGRGLVCVPITEGYAERLQLEPM
RIBBA_BACFR     --IEEAIADFKEGNFVIVVDDEDRENEGDFIIAAEKITPEKVNFMLTHGRGVLCAPITEERCAELELDMQ
RIBBA_BACFN     --IEEAIADFKEGNFVIVVDDEDRENEGDFIIAAEKITPEKVNFMLTHGRGVLCAPITEERCAELELDMQ
RIBBA_AQUAE     --VEEAIEDIRQGKMVIVVDDPDRENEGDLVMAAEKVTPEAINFMAKYGRGLICLSLTPERCEQLDLHPM
RIBBA_BACA2     --IEEALEALKKGEVIIVVDDEDRENEGDFVALAEHATPEVVNFMATHGRGLICTPLSEDIAGRLDLHPM
RIBBA_ACTPL     --VEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATPENINFMATYGKGLICTPISTEIAKKLNF---
RIBBA_ACTPJ     --VEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATPENINFMATYGKGLICTPISTEIAKKLNF---
RIBBA_ACTP7     --VEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATPENINFMATYGKGLICTPISTEIAKKLNF---
RIBBA_ACTP2     --VEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATPENINFMATYGKGLICTPISTEIAKKLNF---
RIBBA_GEOSW     --IEEAIYELMQGKVIIVCDDEDRENEGDFVALAEKATPEVINFMIKYGRGLVCVPITEELADKLDLAPM
RIBBA_BACTN     --IEDAIADFKEGKFVIVVDDEDRENEGDLIIAAEKITPEKVNFMLKHARGVLCAPIT--VSRCKELDLP
RIBBA_BACV8     --IEEAIADFREGKFVIVVDDEDRENEGDLIVAAEKITPEQVNFMLKHARGVLCAPIT--ISRCKELELP
RIBBA_BACCN     --IEEALEDLKQGKVIIVCDDKNRENEGDFLALAEYITPETINFMITHGRGLVCVPLPEHYAKRLQLEPM
RIBB_OCEIH      --IEQAIEDLRNGKLIIVADDADREAEGDLVGLSEFVTPEKVNFMTKYGRGLICVPITEERALELDLHAM
RIB3_SCHPO      --IEEAVNDFRDGKFLIVLDDETRENEGDLIIAGCKVTTEQMAFLVRHSSGYVCVPMTGERLDSLEIPMM
RIBBA_THEPX     --IEDAIEDIKQGKMIIVVDDENRENEGDLVMAAEKVTGEHINFMIKYGRGLVCVMTEKRLNELGIYQMV
RIBBA_THEP3     --IEDAIEDIKQGKMIIVVDDENRENEGDLVMAAEKVTGEHINFMIKYGRGLVCVMTEKRLNELGIYQMV
RIBB_NEIMA      --IPEILADIKVGKMVIITDAEDRENEGDLLMAAQFVTPEAINFMIKHARGLVCLPMDGEMVEKLGLPMM
RIBB_PSESM      --IEDIIEDYRQGKMVLLVDDEDRENEGDLLLAADCCTAQAISFMAREARGLICLTLTDEHCKSLGLEQM
RIBB_NEIMB      --IPEILADIKAGKMVIITDAEDRENEGDLLMAAQFVTPEAINFMIKHARGLVCLPMDGEMVEKLGLPMM
RIBB_AGRT5      --IEDAIEAISRGEMVIVVDDEDRENEGDIIAASDSITPQQIAFMMNHARGLVCVAMPGERLDALDIPLM
RIBBA_STAES     --IELAIEALRNGESIIVVDDEDRENEGDLVAVTEWMDDNTINFMAKEGRGLICAPIDKSIAERLKLQSM
RIBBA_STAEQ     --IELAIEALRNGESIIVVDDEDRENEGDLVAVTEWMDDNTINFMAREGRGLICAPIDKSIAERLKLQSM
RIBBA_PORGI     --IEEALEDFKEGKFLIVVDDEDRENEGDFIIAAEKITPDKVNFMMHHGRGVLCAPISEERAHELELEMQ
RIBBA_PORG3     --IEEALEDFKEGKFLIVVDDEDRENEGDFIIAAEKITPDKVNFMMHHGRGVLCAPISEERAHELELEMQ
RIBBA_PARD8     --IEEAIEDFREGKFLIVVDDEDRENEGDFIIAAEKVTPEKINFMLKNGRGVLCAPITEERCQELELDM-
RIBBA_BREBN     --IEEALEDLRQGKAVIVVDDEDRENEGDFVCMAEAATPEMINFMVTHGRGLVCVPVTEEHATRLQLPMV
RIBB_METLZ      --IEEALKSLQNGEMIIVTDDENRENEGDLICAAEYATTENVNFMAKYGRGLICMPMGRSLVEKLCLP--
RIBBA_MYCUA     --VERAVADIGAGKAVIVIDDEDRENEGDLIFAAEKATPELVAFMVRYTSGYLCVPLDGAVCDRLGL--L
RIBBA_MYCMM     --VERAVADIGAGKAVIVIDDEDRENEGDLIFAAEKATPELVAFMVRYTSGYLCVPLDGAVCDRLGL--L
RIBB_HELHP      --IKEAIEAIKQGEMIIIMDDEDRENEGDLVMAGIFSSPQKINFMAQEARGLICVSITQELAQKLDLP--
RIBBA_STAHJ     --IKDALNALKRGESIIVVDDEDRENEGDLVAITQWMNDNTINFMAKEGRGLICAPISKDLALKFNLMPM
RIBB_HELPJ      --VTEALEAYKNGEMLIVMDDEDRENEGDLVLAGIFSTPEKINFMATHARGLICVSLTKD---------L
RIBB_WOLSU      --VREAIEAIKKGEMIIMMDDEDRENEGDLVYAAAFSTPEKVNFMVSEAKGLVCVCVTSTCSDRLGLAPM
RIBB_RALEJ      --IAQALDAMREGRPVVLLDDDDRENEADLILAAECLTPSNMAMMIRECSGIVCLCLTTDKVRQLGLRPM
RIBBA_PELLD     --IESAVEDIRQGKLVIVIDDEDRENEGDFIAAADHVTTEMINFITREARGLLCVAVTMERARELQLDPM
RIBBA_MYCVP     --VERAVADIAAGKAVVVIDDEDRENEGDLIFAAEKATPELVAFMVRYTSGYLCVPLAGDICDRLGL--L
RIBB_CHLT3      --VENALTALRSGKGILVSDSPDRENEADLIFSAEFLTETQMAMLIRECSGIVCLCLTTEKVQALALPMM
RIBBA_SYNWW     --IEEVIQDIKEGKMIVLVDDEDRENEGDVIIAAEKAGPEAINFMATHAKGLICMPI---IGERL-----
RIBBA_PROVI     --IESALEDIGQGKLVIVIDDEERENEGDFIAAADKVTTEMINFITKEARGLLCVAVTMDRAKELQLEPM
RIBBA_MYCTU     --VERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDRLGL--L
RIBBA_MYCTA     --VERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDRLGL--L
RIBBA_MYCBT     --VERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDRLGL--L
RIBBA_MYCBP     --VERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDRLGL--L
RIBBA_MYCBO     --VERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDRLGL--L
RIBB_HELPY      --VTEALEAYKNGEMLIVMDDEDRENEGDLVLAGIFSTPEKINFMATHARGLICVSLTKD---------L
RIBB_YERE8      --VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTVEQMALTIRHGSGIVCLCITDERRQQLDLPMM
RIBBA_STAAW     --IDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSKDIAQ--RLDLV
RIBBA_STAAS     --IDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSKDIAQ--RLDLV
RIBBA_STAAR     --IDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSKDIAQ--RLDLV
RIBBA_MYCPA     --VERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDRLGL--L
RIBBA_MYCGI     --VERAVADIAAGKAVVVIDDEDRENEGDLIFAAEKATPELVAFMVRYTSGYLCVPLAGEICDRLGL--L
RIBBA_MYCA1     --VERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDRLGL--L
RIBBA_CYTH3     --IADAIEAIRKGEVIIVVDDEDRENEGDFICAAECVTPEIINFMSKEGRGLICAPISEARCTELKLDLM
RIBBA_STAS1     --IDTALQALKKGESIIVVDDENRENEGDLVAVTEWMNDNTVNFMATYGKGLICAPISNAIAEKLDLNPM
RIBBA_STAAN     --IDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSKDIAQ--RLDLV
RIBBA_STAAM     --IDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSKDIAQ--RLDLV
RIBBA_SALAI     --IEQAMAEIVAGRPVVVVDDANRENEGDLIFAAELATPELVAFMVRYTSGYICAPLTEDECDRLDLPPM
RIB3_CANAL      --IEEALEAYKNGEFLIVMDDEDRENEGDLIMAAELITQEKMAFLVRYSSGYVCVPLSEERANQLELPML
RIBB_YERPY      --VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQLDLPMM
RIBB_YERPS      --VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQLDLPMM
RIBB_YERPP      --VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQLDLPMM
RIBB_YERPN      --VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQLDLPMM
RIBB_YERPG      --VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQLDLPMM
RIBB_YERPE      --VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQLDLPMM
RIBB_YERPB      --VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQLDLPMM
RIBB_YERPA      --VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQLDLPMM
RIBB_YERP3      --VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQLDLPMM
RIBBA_STAAC     --IDSALMALKNGEPIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSKDIAQ--RLDLV
RIB3_MAGGR      --IPDVIQAFKNGEFVVVLDDPSRENEADLIIAAESVTTEQMAFMVRHSSGLICAPLTPERTTALDLQMV
RIBB_HAEIG      ----NAINAFKNGTGVLVLDDEDRENEGDLIFPAETITPEQMAKLIRYGSGIVCLCITDERCQQLDLPSM
RIBBA_SALTO     --IEQAMAEILAGRPVVVVDDANRENEGDLIFAAELATPELVAFMVRYTSGYICASLTEDDCDRLDLPPM
RIBB_HAEIE      ----NAINAFKNGNGVLVLDDEDRENEGDLIFPAETITPEQMAKLIRYGSGIVCLCITDERCQQLDLPSM
RIBB_HAEIN      ----NAINAFKNGTGVLVLDDEDRENEGDLIFPAETITPEQMAKLIRYGSGIVCLCITDERCQQLDLPPM
RIBBA_UNCTG     --IGDAVKDIKVGRMVIVVDDPGRENEGDLICAAEKASPEVINFMTKYARGLICVPMKHERLKELEIEMV
RIBBA_CLONN     --IEEAIEDIKNGKMXXXXXXXXXXXXXXLLMAAEKVTPEAINFMAKYARGLICMPMTEEK-----LKEL
RIBB_PASMU      -----AINAFKQGNGVLVLDDEDRENEGDLIFPAETITVEQMTMLIRYGSGIVCLCLSDEICQQLDLP--
RIBB_RALSO      ---------------VVVLDDADRENEADLIIAADRLTHAGMAMLIRECSGIVCLCLTAEKAAVLGLRPM
RIBB_PELPD      --VEAALDALRAGQGVLVTDDEQRENEGDLIFAAQSLTREQVAMLIRECSGIVCLCLTDEAVRRLDLPLM
RIBB_ERWT9      --VTHAIEALRAGRGVMVLDDEDRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLNEERLEQLDLPMM
RIBB_WIGBR      --VKNALQSLKRGNGILVLDDENRENEGDMIFAAENMTVNQMALAIRFGSGIVCICLTKEKCKILNLPMM
RIBB_HAES1      --VKRAIEAFKRGNGVLVLDDEDRENEGDLIFPAETITVEQMAKLIRYGSGIVCLCITDELCQQLDL---
RIBB_HAEI8      ----NAINAFKHGTGVLVLDDEDRENEGDLIFPAETITSEQMAKLIRYGSGIVCLCITDERCQQLDLPPM
RIBBA_PROA2     --IESAIEDLKNGKLIIVIXXXXXXXXXXFIAAADKVTPEMVNFITKEARGLLCVAVTMDRAKELQLDPM
RIBB_HAES2      --VKRAIEAFKRGNGVLVLDDEDRENEGDLIFPAETITVEQMAKLIRYGSGIVCLCITDELCQQLDLP--
RIBB_ECOSM      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_ECOLU      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBBA_THEMA     --MEELREAFEEGKPVILIDRN-RENEADFVFPAQLITEDVVSFFVTYGKGLFCVTADEEDLLKRGFVKL
RIBB_PROMH      --VERALEALRAGKGVMVLDDENRENEGDMVFVAETMTTEQMAMSIRHGSGIVCVCITEERRQQLDLPMM
RIBB_PHOLE      ---KEIIDDIRQGRMVILMDDESRENEGDLIIASEMVTPEAINFMATHGRGLICLTLSKARCKTLNLPLM
RIBB_CHLL2      --VEKALAALRNGQGVLVADDPGRENEADLIFPAESVTIPQMALLIRECSGIVCLCMTD--GKIRSLELP
RIBB_BAUCH      --VEIALQALRHGRGVLVLDNEDRENEGDMIFAAEKMTIEQMALAIRYGSGIICLCLTEERRQQLELPMM
RIBB_SHISS      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_SHIFL      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_SHIF8      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_SHIDS      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_SHIBS      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_SHIB3      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_ECOSE      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_ECOLI      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_ECOLC      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_ECOL5      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_ECOHS      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_ECODH      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_ECOBW      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_ECO8A      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_ECO7I      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_ECO5E      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_ECO57      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_ECO55      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_ECO24      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_DESAD      --VEKGLQALREGRGILVTDNESRENEGDLIFSAEKLSDEQMAMMIRECSGIVCLCLTDEKTEQLGLPMM
RIBB_ESCF3      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTIEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_EDWI9      --VERALSALRDGRGVMVLDDENRENEGDMIFAAEKMTVEQMALTIRHGSGIVCLCITEARRQQLDLPMM
RIBB_ECOUT      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITDDRRKQLDLPMM
RIBB_ECOL6      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITDDRRKQLDLPMM
RIBB_ECOK1      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITDDRRKQLDLPMM
RIBB_ECO81      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITDDRRKQLDLPMM
RIBB_ECO45      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITDDRRKQLDLPMM
RIBB_ECO27      --VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITDDRRKQLDLPMM
RIBB_TOLAT      --VEQALSALQQGNGVLVVDDEDRENEGDLIFSAEKMTPQQMALMIRECSGIVCLCLTEERIRQLALPMM
RIBB_CAMJE      VSVEQAIKDLQAGKMLVMVDAEDRENEGDLIFPAQFSTQEKVNFMIKEARGVVCVALD---------ETL
RIBBA_CHLPN     VSLERAIEDLRAGKFVIVVDEASREDEGDLIIAGEKITVEKMTFLLQHTTGVVCAALSQE--RLLSLDLP
RIBB_CITK8      --VEHALSALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBBA_CORGL     --VEEAIADIAAGKAXXXXXXXXXXXXXXIIFAAELATPELVAFMVRYSSGYICAPLTAKDADRLDLPPM
RIBBA_CORGB     --VEEAIADIAAGKAXXXXXXXXXXXXXXIIFAAELATPELVAFMVRYSSGYICAPLTAKDADRLDLPPM
RIBB_DEHMU      --VNQAIEDIRQGKMVVMVDDEDRENEGDLVYAASFSTPQKVNFMASHAKGLICVAISKKIANRLQLEPM
RIBBA_CHLMU     --VQQAIKDIADGNFVIVIDRESRENEGDLILAGEKVSAEKMAFLLSHTTGIVCASVTREQARVLDLP--
RIBB_SODGM      --VENALESLRNGRGVLVLDDEDRENEGDMIFAAQNMTVEQMALTIRYGSGIVCLCLTEERRQQLALPMM
RIBB_PECCP      --VERALDALRHGRGVLVLDDEDRENEGDMIFSAENMTVEQMALTIRHGSGIVCLCLTEERRQQLELPMM
RIBB_DESDG      --VEAALDALRRGHGVLVTDDEDRENEGDLIFAAETLSDSQMAMLIRECSGIVCLCLTDEKVRALGLPMM
RIBB_HAMD5      --VKKALENLKNGHGVMVLDDENRENEGDFVFAAETMTVEQMALTIRHGSGIVCLCLTEERCQQLELPMM
RIBB_PHOPO      ---QEIIEDIHQGKMVILMDDEDRENEGDLIIASDKVTPEAINFMATYGRGLICLTLNKE--RCLQLELP
RIBB_KLEP7      --VEHALDALREGRGVMVLDDEDRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLTEERRKQLDLPMM
RIBB_ENT38      --VEHALDALREGRGVMVLDDEHRENEGDMIFAAENMTVEQMALTIRHGSGIVCLCINEERRKQLDLPMM
RIBB_SHELP      --VEAALTALRAGQGVLVVDDEDRENEGDLIYSAEHLTQEQMALLIRECSGIVCLCLTDE--RVKQLELP
RIBB_DESAH      --VDRAIDALVSGRGVLLVDDEDRENEGDLIFPAGNITAEQVALLIRECSGIICLCLPPERIEQLGLPQM
RIBB_SHEFN      --VENALAALREGRGVLLLDDEDRENEGDIIYSVEHLTTAQMALMIRECSGIVCLCLTDEHANKLQLP--
RIBB_MANSM      -----ALDTFKQGNGVLVLDDENRENEGDLIFPAETITTEQMAKLIRYGSGIVCLCITDELCQKLELP--
RIBB_KLEP3      --VEHALDALREGRGVMVLDDEDRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLTEDRRKQLDLPMM
RIBBA_PELPB     --IDAALEDIRQGKLVIVIXXXXXXXXXXFIGAADKVTNEMVNFITREARGLLCVAVTMDRAKELQLDPM
RIBB_PSEAE      --IDELIEDIRQGKMVILMDDEDRENEGDLIMAAECVRTEDINFMVKHARGLVCMPMTRERCERLGLPLM
RIBB_ERWCT      --VERALDALRHGRGVLVLDDEDRENEGDMIFSAESMTVEQMALTIRHGSGIVCLCLTEERRQQLELPMM
RIBB_SHEPW      --VNAALTALREGKGVLVVDDEDRENEGDLIYSAETLTNEQMALLIRECSGIVCLCLTDE--RITQLELP
RIBB_RHORT      --VSRAVDSLRQGQGVIVVDDEDRENEGDLIFAAETLTAEQMSRMIRDGSGIVCLILTDPDLDRLALPPM
RIBBA_MYCA9     --IERAVADIAAGKAXXXXXXXXXXXXXXLIFAAEKATPELVAFMVRYTSGYLCVPLAGEDCDRLGL--L
RIBB_PHOPR      --VEAGLTAIREGRGVLVVDDEDRENEGDIIFAAETLTSEQMALMIRECSGIVCLCLTDERVKQLELPMM
RIBB_ENTS8      --VENAIAALREGRGVMVLDDENRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLTEERRKQLDLPMM
RIBB_SHEHH      --VNAALTALRQGKGVLVVDDEDRENEGDLIYSAETLTNEQMALLIRECSGIVCLCLTDERIEQLQLPMV
RIBB_PSEHT      --VENAITALQQGQGVLVVDDENRENEGDFVFSAEHLTTAQMAEMIREGSGIVCLCMGEERIKQLDLPQM
RIBB_VIBPA      --VENALIALKEGRGVLLLDDEDRENEGDIIYSVEHLTNEQMALMIRECSGIVCLCLTDAQADKLELP--
RIBB_SERP5      --VERALEALRNGRGVMVLDDENRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLTEERRQQLELPMM
RIBB_SALAR      --VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_BORPE      --LERALQHLRIGRPVILMDDFDRENEADLIVAADKLTVPVMAQLIRDGSGIVCLCLP---GETLDLELP
RIBB_BORPA      --LERALQHLRIGRPVILMDDFDRENEADLIVAADKLTVPVMAQLIRDGSGIVCLCLP---GETLDLELP
RIBB_BORBR      --LERALQHLRIGRPVILMDDFDRENEADLIVAADKLTVPVMAQLIRDGSGIVCLCLP---GETLDLELP
RIBB_SALTY      --VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_SALTI      --VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_SALSV      --VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_SALPC      --VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_SALPB      --VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_SALNS      --VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_SALHS      --VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_SALG2      --VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_SALEP      --VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_SALDC      --VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_SALCH      --VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_SALA4      --VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_VIBVY      --VENALLALKEGRGVLLLDDEDRENEGDIIYSVEHLTNAQMALMIRECSGIVCLCLTDEHANKLELP--
RIBB_VIBVU      --VENALLALKEGRGVLLLDDEDRENEGDIIYSVEHLTNAQMALMIRECSGIVCLCLTDEHANKLELP--
RIBB_VIBSL      --VENALQALREGRGVLLLDDEDRENEGDIIYSVEHLTNAQMALMIRECSGIVCLCLTDEQANQLELP--
RIBB_SALPK      --VELALDALREGRGVMVLDDEDRENEGDMIFPAEIMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_SALPA      --VELALDALREGRGVMVLDDEDRENEGDMIFPAEIMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMM
RIBB_SHEB9      --VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAETLTNAQMAMLIRECSGIVCLCLPDEKVKALELPAM
RIBB_SHEB8      --VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAETLTNAQMAMLIRECSGIVCLCLPDE--KIKALELP
RIBB_SHEB5      --VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAETLTNAQMAMLIRECSGIVCLCLPDE--KIKALELP
RIBB_SHEB2      --VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAETLTNAQMAMLIRECSGIVCLCLPDEKVKALELPAM
RIBB_DESRM      --VERALRSLRNGNGVLVTDDENRENEGDLIFPAQTLNEVQMAMLIRECSGIVCLCLTDEKVRSLGLPMM
RIBB_SHESR      --VEAGLEALRQGQGVLVVDDEDRENEGDLIFAAESLTNAQMAMLIRECSGIVCLCLPDE--KVKALELP
RIBB_SHESM      --VEAGLEALRQGQGVLVVDDEDRENEGDLIFAAESLTNAQMAMLIRECSGIVCLCLPDE--KVKALELP
RIBB_SHEPC      --VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAQTLTNTQMAMLIRECSGIVCLCLPDE--KVKALELP
RIBB_SHEWM      --VEAALTSLRQGQGVLVVDDEDRENEGDLIYSAQSLTNEQMALLIRECSGIVCLCLTDERIKQLDLPPM
RIBB_SHESA      --VEAGLEALRQGQGVLVVDDEDRENEGDLIFAAESLTNAQMAMLIRECSGIVCLCLPDE--KVKALELP
RIBBA_CHLTR     --VQQAIKDVAEGKFVIVIDAASRENEGDLILAGEKVSTEKMSFLLSHTTGIVCASLSREQAKSLDLP--
RIBBA_ARATH     --IPEAIEDIRQGKLXXXXXXXXXXXXXXLVMAAQLATPEAMAFIVRHGTGIVCVSMKEDDLERLHLPLM
RIBB_PHOLL      --VEHAINALRDGKGVMVLDNEDRENEGDIIFAAETMTVEQMALTIRYGSGIVCLCLTEERRQQLQLPMM
RIBB_DESVV      --VERGLAALRTGQGVLVADDADRENEGDLIFAAETLTPAQMAMMIRECSGIVCLCLPEERVSRLGLPMM
RIBB_DESVH      --VERGLAALRTGQGVLVADDADRENEGDLIFAAETLTPAQMAMMIRECSGIVCLCLPEERVSRLGLPMM
RIBBA_SYNY3     ---------------------ENRENEGDLICAAQFATPALVNFMAVEARGLICLAMTGDRLDELDLPLM
RIBBA_CORAM     -------------------DNEDRENEGDLIFAAELATPELVAFMVRYSSGYICVPLLPEDCKRLNLPMM
RIBB_VIBCM      --VENALQALREGRGVLLLDDEDRENEGDIIYAVESLTTAQMALMIRECSGIVCLCLTEAQADRLALP--
RIBB_VIBCH      --VENALQALREGRGVLLLDDEDRENEGDIIYAVESLTTAQMALMIRECSGIVCLCLTEAQADRLALP--
RIBB_DESDA      --VQKALASLRAGGGVLVVDDEDRENEGDLIFPAQTITVPQMAMLIRHCSGIVCLCLTDEYTRRLDLPMM
RIBB_DESAA      --VEKGLQALRDGQGVLVADDENRENEGDLIFSAESLTEAQMAMLIRECSGIVCLCMPDE--KIRSLELP
RIBB_SHESW      --VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAQTLTNAQMAMLIRECSGIVCLCLPDE--KVKALELP
RIBB_SHEON      --VEAGLNALRQGLGVLVVDDEDRENEGDLIFAAESLTNAQMAMLIRECSGIVCLCLPDEKVKALALPPM
RIBB_VIBC3      --VENALQALREGRGVLLLDDEDRENEGDIIYAVESLTTVQMALMIRECSGIVCLCLTEAQADRLALPLM
RIBB_VIBHA      --VERAIEALKNGLGVLLMDDEDRENEGDLIFSAQHLTEAQMALMIREGSGIVCLCLTEERANWLDLPPM
RIBB_CLOBL      --VEKALENLKNGKGVLLVDDENRENEGDLIFPAETITVPQMAMLIRECSGIVCLCLTDEKVKKLGLTQM
RIBB_BUCAT      --IKNAILALKSGQGVIILDDEERENEGDLVFACENMTVEQMALSIRYGSGIVCLCITESKRKQLNLPMM
RIBB_BUCAI      --IKNAILALKSGQGVIILDDEERENEGDLVFACENMTVEQMALSIRYGSGIVCLCITESKRKQLNLPMM
RIBB_BUCA5      --IKNAILALKSGQGVIILDDEERENEGDLVFACENMTVEQMALSIRYGSGIVCLCITESKRKQLNLPMM
RIBB_BLOFL      ----NALDALSNGRGILVVDDENRENEGDMIFAAENMTVKQMALAIRYGSGIVCLCLTEEKCRQLKLPMM
RIBB_SHESH      --VETALISLKQGRGVLVVDDEDRENEGDLIYSAETLTNEQMALLIREGSGIVCLCLPDERVKHLALENN
RIBB_SHEPA      --VNAALSALRQGKGVLVVDDEDRENEGDLIYSAETLTNQQMALLIRECSGIVCLCLTDE--RIKQLQLP
RIBB_PELCD      -----AIDRLRQGRGVLLVDDENRENEGDLIFPAETITPAQMAMMIRECSGIVCLCLTEDKLKQLELPQM
RIBB_DESPS      --VEKSLQALRQGEGVLLVDDEDRENEGDLIYSAEHLTAKQMALMIREGSGIVCLCLTGEVDELKLPQMV
RIBB_BUCBP      --VKNAISALRYGHGIIVLDNEDRENEGDLIFSGETMTTEQMALTIRYGSGIVCLCITESKRKQLKLPMM
RIBBA_RHOE4     --IERAVADIAAGKAXXXXXXXXXXXXXXLIFAAEKATPELVAFMVRYTSGYLCVPLDGDDCDRLGLPPM
RIBB_PSEPK      --VSAAIAAFQAGRPVXXXXXXXXXXXXXXXXXXXXXTLQTMAMMIRDCSGIVCLCLDEATVDELQLAPM
RIBB_CLOBH      --VEKALENLKNGKGVLLVDDENRENEGDLIFPAETITVPQMVMLIRECSGIVCLCLTDKKVKKLGLTQM
RIBB_CLOB1      --VEKALENLKNGKGVLLVDDENRENEGDLIFPAETITVPQMVMLIRECSGIVCLCLTDKKVKKLGLTQM
RIBBA_RHOSR     --IERAVADIAAGKAXXXXXXXXXXXXXXLIFAAEKATPELVAFMVRYTSGYLCVPLDGADCDRLGLPPM
RIBB_CHRVO      --VHAALDALRRGLPVIVADDADRENEADLILAADTLTVPEMARMIRDGSGIVCLCLTPERAERLQLPPM
RIBBA_NOCFA     --IERAVADIAAGKAXXXXXXXXXXXXXXLIFAAEKATPELVAFMIRYTSGYICVPLTGEDCDRLGLPPM


                         .         .         *         .         .         .         .:140
query           SSYYKRRGFLATAPYGDEPAFMGYVNHVKTKTGIRDVDKALTIRELAKVVQLAQRDPEEAREAFKANFYM
RIBB_METMA      ADLVREASKTSDSKYDAHSSFSLWVNHRDTRTGIPDIERALTIR---KIGEITEESLSGNGVRFGNEFRT
RIBB_METJA      SQKFKRELYPNDIPYDEKSSFSITINHRKTFTGITDNDRAFTIKKLAELVK------EGRFNDFGKEFRS
RIBB_METAC      ADLVREASRTSESKYDSHSSFSIWVNHRDTRTGIPDLERALTIR---KIGEITEKSLSGNGIRFGNEFRT
RIBB_METTH      SGRYPVLGKLSDIPYDEKSAFSITVNHRKTFTGITDNDRALTIGELAGICR------DDRHESFGDLFRS
RIBB_ARCFU      HDVIRKVADADDIKYDSRSSFSLWVNHRDTFTGITDVDRALTIRRIGEVVDEVMMG---KKVDFGREFRS
RIBBA_BACSK     VSH-------STDPHG--TAFTVSVDHSHTTTGISAFERAETVRALADA------------NAQPSDFKR
RIBBA_BACWK     VSHNTD---------SHHTAFTVSIDHVSTTTGISAHERATTIQELLNPASKG------------SDFNR
RIBBA_BACCR     VSHNTD---------SHHTAFTVSIDHVSTTTGISAHERATTIQELLNPASKG------------ADFNR
RIBBA_BACC4     VSHNTD---------SHHTAFTVSIDHVSTTTGISAHERATTIQELLNPASKG------------ADFNR
RIBBA_BACC2     VSHNTD---------SHHTAFTVSIDHVSTTTGISAHERATTIQELLNPASKG------------TDFNR
RIBBA_BACCQ     -------PMVAHNTDSHHTAFTVSIDHVSTTTGISAHERATTIREMLNPASKG------------ADFNR
RIBBA_BACC7     -------PMVAHNTDSHHTAFTVSIDHVSTTTGISAHERATTIREMLNPASKG------------ADFNR
RIBBA_BACC1     -------PMVAHNTDSHHTAFTVSIDHVSTTTGISAHERATTIREMLNPASKG------------ADFNR
RIBBA_BACAM     VDHNTD---------SHETAFTVSIDHKLTKTGISAQERSFTIQALLD------------EESVPGDFQR
RIBBA_BACSU     VEHNTD---------SHHTAFTVSIDHRETKTGISAQERSFTVQALLD------------SKSVPSDFQR
RIBBA_BACHK     VSHNTD---------SHHTAFTVSIDHVSTTTGISAHERATTIQQLLNPASKG------------ADFNR
RIBBA_BACCZ     VSHNTD---------SHHTAFTVSIDHVSTTTGISAHERATTIQQLLNPASKG------------ADFNR
RIBBA_BACC3     VSHNTD---------SHHTAFTVSIDHVSTTTGISAHERATTIQQLLNPASKG------------ADFNR
RIBBA_BACAN     VSHNTD---------SHHTAFTVSIDHVSTTTGISAHERATTIQQLLNPASKG------------ADFNR
RIBBA_BACAH     VSHNTD---------SHHTAFTVSIDHVSTTTGISAHERATTIQQLLNPASKG------------ADFNR
RIBBA_BACAC     VSHNTD---------SHHTAFTVSIDHVSTTTGISAHERATTIQQLLNPASKG------------ADFNR
RIBBA_BACAA     VSHNTD---------SHHTAFTVSIDHVSTTTGISAHERATTIQQLLNPASKG------------ADFNR
RIBBA_BACC0     VSHNTD---------SHHTAFTVSIDHVSTTTGISAHERATTIQQLLNPASKG------------ADFNR
RIBBA_BACFR     VS-------SNTSIY--ETPFTVTVDLLECTTGVSMHDRAMTIRALA--------DPKTK----PADLGR
RIBBA_BACFN     VS-------SNTSIY--ETPFTVTVDLLECTTGVSMHDRAMTIRALA--------DPKTK----PADLGR
RIBBA_AQUAE     TP-------MNTDPKGTYVSIDAHPKH-GTTTGISAYDRALTIKLAI------------SPDAKPSDFVR
RIBBA_BACA2     VDHNTD---------SHETAFTVSIDHRLTKTGISAQERSFTIQALLN------------EESVSDDFQR
RIBBA_ACTPL     ------HPMVAVNQDNHETAFTVSVDHIDTGTGISAFERSITAMKIVD------------DNAKATDFRR
RIBBA_ACTPJ     ------HPMVAVNQDNHETAFTVSVDHIDTGTGISAFERSITAMKIVD------------DNAKATDFRC
RIBBA_ACTP7     ------HPMVAVNQDNHETAFTVSVDHIDTGTGISAFERSITAMKIVD------------DNAKATDFRR
RIBBA_ACTP2     ------HPMVAVNQDNHETAFTVSVDHIDTGTGISAFERSITAMKIVD------------DNAKATDFRR
RIBBA_GEOSW     VNH-------NTDSHG--TAFTVSIDYKSTTTGISAYERSMTIQALL--------DP----NAKASDFKR
RIBBA_BACTN     HQVSDNTSVLGT------PFTVTIDKLEGCSTGVSASDRAATIQALA--------DPAST----PATFGR
RIBBA_BACV8     HQVDTNTSVLGT-------PFTVTVDKLECSTGVSIHDRAATIRALA--------DPTSTPETFG----R
RIBBA_BACCN     VSQNTD---------SHHTAFTVSIDHISTTTGISAHERATTVRELLN------------PSSKGSDFNR
RIBB_OCEIH      ATN-------NTDTYGTQ--FTVSVDYYTNSTGISTADRADTIRALAEPLSKA------------ADFKR
RIB3_SCHPO      VDNNEDRMRTAYA------VTLDYANG--TTTGISAHDRALTTRQLANPEVTSPRE-----------FNR
RIBBA_THEPX     ENNTDHK----------ETAFTVSVDYKECTTGISAFERALTVKKLVD----DNSKPED--------FTK
RIBBA_THEP3     ENNTDHK----------ETAFTVSVDYKECTTGISAFERALTVKKLVD----DNSKPED--------FTK
RIBB_NEIMA      T---QKNG----AQYGTNFTVSIEAAHGIT-TGISAADRALTIQTAVS----PTAKPED--------IVQ
RIBB_PSESM      ------------VPSNGSVFATAFTVSIEATTG---VTTGISAADRARTVQAAVNP-----GAVPDDLVQ
RIBB_NEIMB      T---QKNG----AQYGTNFTVSIEAAHGIT-TGISAADRALTIQTAVS----PTAKPED--------IVQ
RIBB_AGRT5      VS--RNTESLKT-------AFTVSVDYIPTTTGISAADRAKTVRAL---VSEGSR-PED--------FAR
RIBBA_STAES     EQN-------NTDIYGTH--FTVSIDHYKTTTGISAHERTQTARALID----ENTNPED--------FHR
RIBBA_STAEQ     EQN-------NTDIYGTH--FTVSIDHYKTTTGISAHERTQTARALID----ENTNPED--------FHR
RIBBA_PORGI     ---------VPDNTSVHETPFTVTVDRLGNTTGVSMYDRAQTI--------LALADPNTR----PSDLGR
RIBBA_PORG3     ---------VPDNTSVHETPFTVTVDRLGNTTGVSMYDRAQTI--------LALADPNTR----PSDLGR
RIBBA_PARD8     --QVANNTSLLGTPFTITVDKLG----GKCTTGVSMYDRAETI--------LALADPKTK----PSDLGR
RIBBA_BREBN     NANTDKQG----------TAFTVSIDEGSTNTGISAHERSQTV--------LAMLDEQKDADDFR----R
RIBB_METLZ      -------PMVLKNTDNHETAFTVSIDHVDTTTGISAVERGITARKCI--------DPNARPEDFR----R
RIBBA_MYCUA     PMYAVNQDKHGTAYTVTVDAKNG------VGTGISASDRATTMRLLA--------DPASVAE----DFTR
RIBBA_MYCMM     PMYAVNQDKHGTAYTVTVDAKNG------VGTGISASDRATTMRLLA--------DPASVAE----DFTR
RIBB_HELHP      -------PMVQKNDSNHETAFTISIDAKEAKTGISAFERDMTIRLMCE------------SNTKPSDFVR
RIBBA_STAHJ     VEH-------NTDGFGTN--FTVSIDHATTSTGISAFDRMATARALI--------NPESTPE----DFHK
RIBB_HELPJ      ANKFELPPMVSVNDSNHETAFTVSIDAKEAKTGISAFERHLTIELLCK------------DTTKPSDFVR
RIBB_WOLSU      VRENNSQ---------HETAFTVSIDARECSTGISAFERDLTIRKMVD----GTSKPED--------FVR
RIBB_RALEJ      VE--NNRSQYGTAFTVSIEAREG------VTTGVSAVDRITTIRAAI------------AKDAGTDAVVS
RIBBA_PELLD     VQRNTSQ---------HETNFTVSVDAIAVTTGISVYDRATTIKMLG--------DPASHADSFS----R
RIBBA_MYCVP     PMYAVNQDKHGTAYTVTVDAKKG------VGTGISAMDRATTMRLLA--------DP----DAVADDFTK
RIBB_CHLT3      VS-ENTSGFQTAFTVSIEA-------KTGVKTGVSAADRVRTV----KTAIAADAKPEELAR--------
RIBBA_SYNWW     -DELEIHDMVTENTDNHETAFTVTVDYRGTTTGISAFERAATVKALIDSV------------SKPSDFRK
RIBBA_PROVI     VQRNTSQ---------HETNFTVSVDAIAVTTGISVYDRAMTIKMLGDETSHAD------------SFSR
RIBBA_MYCTU     PMYAVNQDKHGTAYTVTVDARNG------IGTGISASDRATTMRLLADPTSVAD------------DFTR
RIBBA_MYCTA     PMYAVNQDKHGTAYTVTVDARNG------IGTGISASDRATTMRLLADPTSVAD------------DFTR
RIBBA_MYCBT     PMYAVNQDKHGTAYTVTVDARNG------IGTGISASDRATTMRLLADPTSVAD------------DFTR
RIBBA_MYCBP     PMYAVNQDKHGTAYTVTVDARNG------IGTGISASDRATTMRLLADPTSVAD------------DFTR
RIBBA_MYCBO     PMYAVNQDKHGTAYTVTVDARNG------IGTGISASDRATTMRLLADPTSVAD------------DFTR
RIBB_HELPY      AKKFELPPMVSVNDSNHETAFTVSIDAKEARTGISAFERHLTIELLCK------------DTTKPSDFVR
RIBB_YERE8      ---------VANNSSQFQTAFTVTIEAAKVTTGVSAADRLTTIRAAI------------ADNAKPTDLNR
RIBBA_STAAW     QMVDDNSDIFGT-------QFTVSIDHVDTTTGISAYERTLTAKKLI--------DPSSEAK----DFNR
RIBBA_STAAS     QMVDDNSDIFGT-------QFTVSIDHVDTTTGISAYERTLTAKKLI--------DPSSEAK----DFNR
RIBBA_STAAR     QMVDDNSDIFGT-------QFTVSIDHVDTTTGISAYERTLTAKKLI--------DPSSEAK----DFNR
RIBBA_MYCPA     PMYAVNQDKHGTAYTVTVDARNG------VGTGISASDRATTMRLLADPTSIAE------------DFTR
RIBBA_MYCGI     PMYAVNQDKHGTAYTVTVDAKVG------VGTGISASDRATTMRLLA--------DPDSVAD----DFTK
RIBBA_MYCA1     PMYAVNQDKHGTAYTVTVDARNG------VGTGISASDRATTMRLLADPTSIAE------------DFTR
RIBBA_CYTH3     ---------VGSNTATHETPFTVSVDLLGNTTGISASDRSKTIRALV--------DPDTKPE----DLGR
RIBBA_STAS1     VTH-------NSDVYGTQ--FTVSVDHIQTTTGISADERTMTARALID------------EQATGSDFNK
RIBBA_STAAN     QMVDDNSDIFGT-------QFTVSIDHVDTTTGISAYERTLTAKKLI--------DPSSEAK----DFNR
RIBBA_STAAM     QMVDDNSDIFGT-------QFTVSIDHVDTTTGISAYERTLTAKKLI--------DPSSEAK----DFNR
RIBBA_SALAI     HTNQDRRGTAYTVTVDAREG---------VSTGISAADRAHTIRLLA--------DPRTG----PADLAR
RIB3_CANAL      ANRSDRHGYTITCDFAE-----------GTTTGISAHDRALTTRSLANPNSKPQ------------DFIK
RIBB_YERPY      VTHNSSQ---------FQTAFTVTIEAAEVTTGVSAADRLTTIRKAI------------ADNAKPADLNR
RIBB_YERPS      VTHNSSQ---------FQTAFTVTIEAAEVTTGVSAADRLTTIRKAI------------ADNAKPADLNR
RIBB_YERPP      VTHNSSQ---------FQTAFTVTIEAAEVTTGVSAADRLTTIRKAI------------ADNAKPADLNR
RIBB_YERPN      VTHNSSQ---------FQTAFTVTIEAAEVTTGVSAADRLTTIRKAI------------ADNAKPADLNR
RIBB_YERPG      VTHNSSQ---------FQTAFTVTIEAAEVTTGVSAADRLTTIRKAI------------ADNAKPADLNR
RIBB_YERPE      VTHNSSQ---------FQTAFTVTIEAAEVTTGVSAADRLTTIRKAI------------ADNAKPADLNR
RIBB_YERPB      VTHNSSQ---------FQTAFTVTIEAAEVTTGVSAADRLTTIRKAI------------ADNAKPADLNR
RIBB_YERPA      VTHNSSQ---------FQTAFTVTIEAAEVTTGVSAADRLTTIRKAI------------ADNAKPADLNR
RIBB_YERP3      VTHNSSQ---------FQTAFTVTIEAAEVTTGVSAADRLTTIRKAI------------ADNAKPADLNR
RIBBA_STAAC     QMVDDNSDIFGT-------QFTVSIDHVDTTTGISAYERTLTAKKLI--------DPSSEAK----DFNR
RIB3_MAGGR      THNADPRGTAYTVSVDAE--------HPSTTTGISAHDRALACRMLA------------APDAQPSHFRR
RIBB_HAEIG      VEHNNS---------VNKTAFTVTIEAAKVSTGVSAADRVTTIQTAI------------ADNAVPTDLHR
RIBBA_SALTO     HTNQDRRG----------TAYMVTVDARKVSTGISAADRARVIRLLA--------DPSTTPD----DLAR
RIBB_HAEIE      VEHNNS---------VNKTAFTVTIEAAKVSTGVSAADRVTTIQTAI------------ADNAVPTDLHR
RIBB_HAEIN      VEHNNS---------VNKTAFTVTIEAAKVSTGVSAADRVTTIQTAI------------ADNAVLTDLHR
RIBBA_UNCTG     EKPTEKKGFTVSVDY-----------KIGTTTGISAYDRSVTVRKLID------------KTAKHEDFAR
RIBBA_CLONN     DLYQMVINNTDTK----ETAFTVSIDSVETTTGISAFERALTITKAVE------------KGAKAKDFQR
RIBB_PASMU      -------PMVTENTSVNKTAFTVTIEAAKVSTGVSATDRVTTIRAAV------------ADNAKPSDLSR
RIBB_RALSO      VEHNR-------SQYG--TAFTVSIERVGVSTGVSAADRITTIRAAV------------APDADAQSVVS
RIBB_PELPD      VSDNSSRY---------QTAFTVSIEAAEVTTGVSAADRLTTIRAAI------------ADDAGPLCLSR
RIBB_ERWT9      SAY--GTGFTVTIEAAE-----------GVTTGVSATDRLTTIRAAI------------ADDARPSDLNR
RIBB_WIGBR      NSKYKTAFTVSISAYGITTGVSAYDRIITIKTAIKDNAK-----------------PDDLNR--------
RIBB_HAES1      ------------SPMVQNNTSINQTAFTVSIEAAQGVSTGVSAQDRVTTIQAAIADNAKPQDLSR-----
RIBB_HAEI8      VEHNNS---------VNKTAFTVTIEAAKVSTGVSAADRVTTIQTAI------------ADNAVPTDLHR
RIBBA_PROA2     VQRNTSQ---------HETNFTVSVDALAVTTGISAFDRYMTIKMLADPVSHAD------------NFSR
RIBB_HAES2      PMVQNNTSINQTAFTVSIEAAQG------VSTGVSAQDRVTTI-------QVAIADNAKPQDLSR-----
RIBB_ECOSM      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADDAKPSDLNR
RIBB_ECOLU      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADDAKPSDLNR
RIBBA_THEMA     SSNYGANYFV--------PVDWG------TGTGISALERAETCRKLA-----------EGR--YFHEFRY
RIBB_PROMH      VE--NNTSHFHTAFTVTIEAAQG------VTTGVSAADRLTTVRAAA------------ADNAKPSDLNR
RIBB_PHOLE      ---VQGNNDNFSTPFTISIEAAKYVT-----TGISASDRAKTV--LAAV----------APNAKSTDIVM
RIBB_CHLL2      MMVENNTSGFQTAFTVSIEAAEG------VTTGVSAADRVKTVRTAVS---------ENAR---PSDLRH
RIBB_BAUCH      VEH-------NTSHY--QTAFTVTIEAAEVTTGVSAADRITTIRTAIK------------NDAIPEDLNR
RIBB_SHISS      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_SHIFL      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_SHIF8      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_SHIDS      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_SHIBS      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_SHIB3      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_ECOSE      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_ECOLI      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_ECOLC      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_ECOL5      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_ECOHS      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_ECODH      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_ECOBW      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_ECO8A      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_ECO7I      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_ECO5E      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_ECO57      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_ECO55      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_ECO24      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_DESAD      SSRY-QTGFTVTIEAAE-----------GVTTGVSAADRVTTVKAAI------------ADGAKPADLHR
RIBB_ESCF3      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_EDWI9      VSN-------NTSHYG--TAFTVTIEAAEVTTGVSAQDRLTTVRAAI------------ADDAKPGDLHR
RIBB_ECOUT      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_ECOL6      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_ECOK1      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_ECO81      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_ECO45      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_ECO27      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRITTVRAAI------------ADGAKPSDLNR
RIBB_TOLAT      NTSANQTGFTVTI-----EAARG------VTTGVSAQDRITTIRTAI------------ADGAVASDLNR
RIBB_CAMJE      AKKFELPLMVPKNTSNHETAFTITVDAKDATTGVSAYERNMTIQIFAD------------DNAKASDFVR
RIBBA_CHLPN     PMVKDNRCRFKTPFTVSVDAAHGVT------TGVSAADRT-------KVVQLLA-DPKSKPE----DFIS
RIBB_CITK8      VEN-------NTSAYG--TGFTVTIEAAKVTTGVSAADRVTTVRAAI------------ADGAKPADLHR
RIBBA_CORGL     TAHNQARG----------TAYTVTVDANTGTTGISATDRAHTLRLLA--------DPE----ADRTDFTR
RIBBA_CORGB     TAHNQARG----------TAYTVTVDANTGTTGISATDRAHTLRLLA--------DPE----ADRTDFTR
RIBB_DEHMU      SSY--------------ETAFTITVDARTAATGISAGERDMTIKILAD------------GGSHESELVR
RIBBA_CHLMU     AMVQENQCAFKTAFTVSVDASSGIT------TGVSAADRTRTVQLLSDPTSISQ------------SFVR
RIBB_SODGM      SSHY-QTAFTVTIEAAE-----------GVSTGVSAADRLTTIRAAIK------------DNAKPTDLNR
RIBB_PECCP      SSHY-QTAFTVTIEAAE-----------GVTTGVSAADRLTTIRAAI------------ADNAKPSDLNR
RIBB_DESDG      SSQYQ------TAFTVSIEASCG------VSTGVSAADRVCTIQAAI------------ADDACPSDLCR
RIBB_HAMD5      VE--KNSSTFQT------PFTVSIEAAKGVTTGVSASDRITTIK--AAISQTAK----------PADLHR
RIBB_PHOPO      MMVKSNTDKFAT------PFTISIEAASGVTTGISVNDRXXXXXXXXXXXXXXK------------DIVM
RIBB_KLEP7      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRVTTVRAAI------------ADGAKPSDLNR
RIBB_ENT38      VEN-------NTSAFGTGFTVTIEAAHGVT-TGVSAADRLTTVRAAI------------ADGAKPSDLHR
RIBB_SHELP      PMVEDNSSQYGTAFTVSIEAKVG------VTTGVSAADRVTTIKAAI------------ADDAKPSDLAR
RIBB_DESAH      VT-------CNTSAY--QTAFTISIEAAEVTTGVSAADRATTIRCAA------------ALDARPEDIHS
RIBB_SHEFN      -------PMVINNNSANQTAFTISIKHGVT-TGVSAQDRVTTIKTAAN------------RDAKASDLAH
RIBB_MANSM      -------PMVAANTSVNKTAFTVTIEAAEVSTGVSAADRVTTVKVAV------------ADNAKPSDLHH
RIBB_KLEP3      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRVTTVRAAI------------ADGAKPSDLNR
RIBBA_PELPB     VQRNTSQ---------HETNFTVSVDAIAVTTGISVYDRAMTIKMLGDLSSTAD------------DFSR
RIBB_PSEAE      ---VQRNG----SGFGTK-----FTVSIEAAEGV--------TTGISXXXXXXXXXXXXXXXXXXXXIVS
RIBB_ERWCT      SSHY-QTAFTVTIEAAE-----------GVTTGVSAADRLTTIRAAI------------ADNARPSDLNR
RIBB_SHEPW      PMVVDNNSQYGTAFTVSIEAKEG------VTTGVSAADRVTTVKAAI------------ADGAKPGDLAR
RIBB_RHORT      VAHNTSRGFTVSIEARE-----------GVTTGVSAADRVTTIR--------AAIDPASTAD----DLAR
RIBBA_MYCA9     PQYAVNQDKHGTA----------YTVTVDAKTGISASDRAATMRLLADAASTAD------------DFTK
RIBB_PHOPR      ---------VENNTSANETGFTVTIEAAKVTTGVSAADRVTTIKTAI------------ADGAVPADLNH
RIBB_ENTS8      VEN-------NTSAFG-----TGFTVTIEAAHGVTTGVSXXXXXXXXXXXXXXXXKP--------SDLHR
RIBB_SHEHH      SDNNSQYGTAFTVSIEAKQG---------VTTGVSAADRVTTIKTAI------------ADNAKPDDLAR
RIBB_PSEHT      VTHNTSQNNTA------------YTITIEAKTGVSAADRVTTI----KAATADNAKPEDLSR--------
RIBB_VIBPA      -------PMVVNNNSANQTAFTVSIEKVGVTTGVSAADRVTTIKTAAN----PHAKPEDLAR--------
RIBB_SERP5      NSSQFQTAFTVTI-----EAAQG------VTTGVSASDRLTTIRAAV------------ADNAKPSDLNR
RIBB_SALAR      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRVTTVRAAI------------ADGAKPSDLNR
RIBB_BORPE      PMVDSNRSRYSTAFTVSIEAREG------VTTGVSAVDRVTTIRAAI------------APGARSGDVVS
RIBB_BORPA      PMVDSNRSRYSTAFTVSIEAREG------VTTGVSAVDRVTTIRAAI------------APGARSGDVVS
RIBB_BORBR      PMVDSNRSRYSTAFTVSIEAREG------VTTGVSAVDRVTTIRAAI------------APGARSGDVVS
RIBB_SALTY      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRVTTVRAAIK------------DGAKPSDLNR
RIBB_SALTI      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRVTTVRAAIK------------DGAKPSDLNR
RIBB_SALSV      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRVTTVRAAIK------------DGAKPSDLNR
RIBB_SALPC      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRVTTVRAAIK------------DGAKPSDLNR
RIBB_SALPB      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRVTTVRAAIK------------DGAKPSDLNR
RIBB_SALNS      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRVTTVRAAIK------------DGAKPSDLNR
RIBB_SALHS      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRVTTVRAAIK------------DGAKPSDLNR
RIBB_SALG2      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRVTTVRAAIK------------DGAKPSDLNR
RIBB_SALEP      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRVTTVRAAIK------------DGAKPSDLNR
RIBB_SALDC      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRVTTVRAAIK------------DGAKPSDLNR
RIBB_SALCH      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRVTTVRAAIK------------DGAKPSDLNR
RIBB_SALA4      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRVTTVRAAIK------------DGAKPSDLNR
RIBB_VIBVY      -------PMVVNNNSANQTAFTVSIEAKQVTTGVSAQDRVTTIKTAANPSAKAD------------DLAR
RIBB_VIBVU      -------PMVVNNNSANQTAFTVSIEAKQVTTGVSAQDRVTTIKTAANPSAKAD------------DLAR
RIBB_VIBSL      -------PMVVDNNSANQTAFTVTIEKVGVTTGVSAADRVTTIKTAANPT------------AKPTDLAR
RIBB_SALPK      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRVTTVRAAIK------------DGAKPSDLNR
RIBB_SALPA      SAY--GTGFTVTIEAAE-----------GVTTGVSAADRVTTVRAAIK------------DGAKPSDLNR
RIBB_SHEB9      VEH-------NSSQYG--TAFTVSIETVGVTTGVSAADRVTTIKAAI------------ADNAKPSDLAR
RIBB_SHEB8      AMVEHNSSQYGTAFTVSIEATVG------VTTGVSAADRVTTIKAAI------------ADNAKPSDLAR
RIBB_SHEB5      AMVEHNSSQYGTAFTVSIEATVG------VTTGVSAADRVTTIKAAI------------ADNAKPSDLAR
RIBB_SHEB2      VEH-------NSSQYG--TAFTVSIETVGVTTGVSAADRVTTIKAAI------------ADNAKPSDLAR
RIBB_DESRM      SSRFK-TAFTVTAAHG-------------VTTGVSAADRVKTVKTAV------------AENAKPEDLNR
RIBB_SHESR      PMVENNSSQYGTAFTVSIEAKVG------VTTGVSAADRVTTIKAAI------------ADNAKPSDLAR
RIBB_SHESM      PMVENNSSQYGTAFTVSIEAKVG------VTTGVSAADRVTTIKAAI------------ADNAKPSDLAR
RIBB_SHEPC      PMVENNSSQYGTAFTVSIEAKVG------VTTGVSAADRVTTIKAAI------------ADGAKPSDLAR
RIBB_SHEWM      VED-------NSSQYG--TAFTVSIEKVGVTTGVSAADRVTTIKAAI------------ADNAVPEDLAR
RIBB_SHESA      PMVENNSSQYGTAFTVSIEAKVG------VTTGVSAADRVTTIKTAI------------ADNAKPSDLAR
RIBBA_CHLTR     AMVQDNQCAFKTAFTVSVDASSG------VTTGVSASDRTRTVQLLA--------DPAATAE----SFVR
RIBBA_ARATH     VNQKENEEKLSTAFTVTVDAKHG------TTTGVSARDRATTILSLA------------SRDSKPEDFNR
RIBB_PHOLL      ------------VENNSSPFQTAFTVTIEAAQGVTTGVSXXXXXXXXXXXXXXNAKPSDLNR--------
RIBB_DESVV      VAH--NTSSMGTAFTISIEAAEG------VTTGVSAADRVRT-------VQAAIDD-----AACPGCLRS
RIBB_DESVH      VAH--NTSSMGTAFTISIEAAEG------VTTGVSAADRVRTVK--------AAIDDAACPGCLRS----
RIBBA_SYNY3     VSKNTD---------SNQTAFTVSIDHLGVTTGISAEDRARTIQIAINPVTR----PEDLSR--------
RIBBA_CORAM     GRNEDVRG----------TAYTVTVDANTGTTGISATSRAETMLRLADPMSVVD------------DFTR
RIBB_VIBCM      -------PMVVNNNSANQTAFTVSIKHGVT-TGVSAQDRVTTIKTAAN----PQAKPEDLAR--------
RIBB_VIBCH      -------PMVVNNNSANQTAFTVSIKHGVT-TGVSAQDRVTTIKTAAN----PQAKPEDLAR--------
RIBB_DESDA      TERNTNT---------QQTAFISIEXXXXXXXXXXXXDRVATIQAAV------------AENASPENLRR
RIBB_DESAA      MMVEDNSSRYGTAFTVSIEAAQG------VTTGVSAKDRVTTVKTAA------------ADGAKPADLSK
RIBB_SHESW      PMVENNSSQYGTAFTVSIEAKVG------VTTGVSAADRVTTIKAAI------------ADGAKPSDLAR
RIBB_SHEON      VEN-------NSSQYG--TAFTVSIEKVGVTTGVSAADRVTTIKTAI------------ADHAKPSDLAR
RIBB_VIBC3      ---------VVNNNSANQTAFTVSIKHGVT-TGVSAQDRVTTIKTAAN----PQAKPEDLAR--------
RIBB_VIBHA      VKDNCSK---------NQTAFTVSIEAKEVTTGVSAKDRVTTV----KTATYFDAQPEDLAR--------
RIBB_CLOBL      VSN-------NTCTY--ETAFTISIEAKEVTTGVSAADRVTTILTAVK----DDCKPED--------LCH
RIBB_BUCAT      SAY--RTGFTVTI-----EASKG------ISTGVSAKDRLTTIKTAI------------ADDAKPSDLNR
RIBB_BUCAI      SAY--RTGFTVTI-----EASKG------ISTGVSAKDRLTTIKTAI------------ADDAKPSDLNR
RIBB_BUCA5      SAY--RTGFTVTI-----EASKG------ISTGVSAKDRLTTIKTAI------------ADDAKPSDLNR
RIBB_BLOFL      SNHYKT-------------AFTVTIEASKITTGVSAKDRLTTIKTSIEDY------------AKPSDLNR
RIBB_SHESH      SSQY------GTAFTVSIEAKEG------VTTGVSAADRVTTIK--TAIADDAQPD----------DLAR
RIBB_SHEPA      PMVSDNNSQYGTAFTVSIEAKQG------VTTGVSAADRVTT------------XXXXXXXXXXXXXLAR
RIBB_PELCD      ---------VSDNTSANQTAFLSIEARQGVTTGVSAADRVTTIRTAV------------ADDCRPDDLAR
RIBB_DESPS      TNNNSRHG-------------TGFTISIEARTGVSAADRTQTVKAAI------------AEGAVAEDLCQ
RIBB_BUCBP      VQN-------NTSKFG--------TNFTVTIEAAEGISTGVSAKDRLTTIRAAIND-----NAKPSDLNR
RIBBA_RHOE4     YATNQDKHGTAYTVTVDAREGIG--------TGISASDRAATMRLLA--------NPESGAN----DFTR
RIBB_PSEPK      VQNNQARGFTVTIEAAE-----GITTGVSAQDRITTIDAAL-------------RSSAEQR-----HIVS
RIBB_CLOBH      VHN-------NTCTY--ETAFTISIEAKEVTTGVSAADRVTTILTAVK----DDCKPED--------LCH
RIBB_CLOB1      VHN-------NTCTY--ETAFTISIEAKEVTTGVSAADRVTTILTAVK----DDCKPED--------LCH
RIBBA_RHOSR     YATNQDKHGTAYTVTVDAREGIG--------TGISASDRAATMRLLA--------DPSSGAQ----DFTR
RIBB_CHRVO      AAENGSR-------YG-----TAFTVAIEAAQGV--------TTGVSXXXXXXXXXXXXHPDAKPGDLVR
RIBBA_NOCFA     --YATNQDKHGTAYTVSVDAREGIT------TGISAADRATTMRXXXXXXXXXXXXTR------------


                         +         .         .         .         .         *         .:210
query           PGHVPILGGRLGERWGHTELSLILAKAAGVPPAVVIVEVLGDHTEAMPVEEAREYSKTLGVPLVTGTEIK
RIBB_METMA      PGHVALLEGLLDERMGQTELSVALARMAGITPAMVVCEMLDDDSKALSKEKSKEYGKEHGLVFLEGREI-
RIBB_METJA      PGHVTLLEGLVKNRQGHTEMTVALAELANLVPITTICEMMGDDGNAMSKNETKRYAEKHNLIYLSGEEI-
RIBB_METAC      PGHVALLEGLLDERMGQTELSVALARMAGITPAMVVCEMLDDESRALSKENSKDYGKDHGLVFLEGQEI-
RIBB_METTH      PGHVTLLDGHVLRRGGHTEMSIALMEMAGLTGVAVCCEMMDDRTNSLSTEDAMKYAREHDLIFMSGAEL-
RIBB_ARCFU      PGHVALLRAATYERVGQTELSVALAEMAGIAPAVAICEMLDAETKALTKEKAMEYAEEKGIPFIDGRTI-
RIBBA_BACSK     PGHVPLVNGGVLRRAGHTEAAVDFAKLCGAKPAGVICEVMNEDGSMARVPELRIIADQHNLPLVT---IK
RIBBA_BACWK     PGHIPLIAGGVLRRAGHTEAAVDLAKLCGAEPAGVICEIINEDGTMARVPDLLECAKQFDIKMIT-----
RIBBA_BACCR     PGHIPLIAGGVLRRAGHTEAAVDLAKLCGAEPAGVICEIINEDGTMARVPDLIECAKQFDIKMIT-----
RIBBA_BACC4     PGHIPLIAGGVLRRAGHTEAAVDLAKLCGAEPAGVICEIINEDGTMARVPDLIECAKQFDIKMIT-----
RIBBA_BACC2     PGHIPLIAGGVLRRAGHTEAAVDLAKLCGAEPAGVICEIINEDGTMARVPDLIECAKQFDIKMIT-----
RIBBA_BACCQ     PGHIPLIAGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMIT-----
RIBBA_BACC7     PGHIPLIAGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMIT-----
RIBBA_BACC1     PGHIPLIAGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMIT-----
RIBBA_BACAM     PGHIPLIAKKGGKRAGHTEAAVDLAKACGSQGADVICEIMNEDGTMARVPEISEIAKSHQLKMIT---IK
RIBBA_BACSU     PGHIPLIAKKGGKRAGHTEAAVDLAEACGSPGAGVICEIMNEDGTMARVPELIEIAKKHQLKMIT---IK
RIBBA_BACHK     PGHIPLIAGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMIT-----
RIBBA_BACCZ     PGHIPLIAGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGAMARVPDLLQCAKQFDIKMIT-----
RIBBA_BACC3     PGHIPLIAGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMIT-----
RIBBA_BACAN     PGHIPLIAGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMIT-----
RIBBA_BACAH     PGHIPLIAGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMIT-----
RIBBA_BACAC     PGHIPLIAGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMIT-----
RIBBA_BACAA     PGHIPLIAGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMIT-----
RIBBA_BACC0     PGHIPLIAGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMIT-----
RIBBA_BACFR     PGHINPLRARVLRRAGHTEASVDLAKLAGLYPAAALIEIINEDGTMARLPQLVEVARRFGLKIIS---IK
RIBBA_BACFN     PGHINPLRARVLRRAGHTEASVDLAKLAGLYPAAALIEIINEDGTMARLPQLVEVARRFGLKIIS---IK
RIBBA_AQUAE     PGHVFPLKARPGERAGHTEASVDLARLAGLYPAGVICEIMKDDGTMARVPDLMEFAKKHNLKIIT-----
RIBBA_BACA2     PGHIPLIAKKGGKRAGHTEAAVDLAKACGSQGAGVICEIMNEDGTMARVPELAEIAERHQLKMIT---IK
RIBBA_ACTPL     PGHMPLIAGGVLVRNGHTEATVDLARLAGLKHAGLCCEIMADDGTMMTMPDLQKFAVEHNMPFIT-----
RIBBA_ACTPJ     PGHMPLIAGGVLVRNGHTEATVDLARLAGLKHAGLCCEIMADDGTMMTMPDLQKFAVEHNMPFIT-----
RIBBA_ACTP7     PGHMPLIAGGVLVRNGHTEATVDLARLAGLKHAGLCCEIMADDGTMMTMPDLQKFAVEHNMPFIT-----
RIBBA_ACTP2     PGHMPLIAGGVLVRNGHTEATVDLARLAGLKHAGLCCEIMADDGTMMTMPDLQKFAVEHNMPFIT-----
RIBBA_GEOSW     PGHVPLVAKKGGRRAGHTEAAVDLARLCGAKPAGVICEIIKEDGTMARVSDLRKIADEFDLKMIT---IK
RIBBA_BACTN     PGHIPLYAQEKGRRAGHTEATIDMARLAGLYPAGALMEIMSDDGTMARLPELRAMADEHGLKLIS-----
RIBBA_BACV8     PGHVPLYAQDKGRRAGHTEACIDMARLAGLYPAAALMEIMSEDGTMARLPELRKMADEWGLKLIS-----
RIBBA_BACCN     PGHIPLIAGGVLRRAGHTEAAVDLAKLCGTEPVGVICEIIKEDGTMARVPDLIQVAKQFDIKMIT-----
RIBB_OCEIH      PGHMPLIAKNAGERRGHTEAAVDLARLSNSIPSAYICEILND----------------------------
RIB3_SCHPO      PGHIVPLRARDGERDGHTEAAVDLCKLAGLPPVGAICELVREEDGLMSFDDCISFGKKWGIKVITIESLK
RIBBA_THEPX     PGHIFPLRAKDGVRAGHTEAAVDLAVLAGLKPAGVICEIIKDDGNMARLPDLLEFAKKFGLRIIS-----
RIBBA_THEP3     PGHIFPLRAKDGVRAGHTEAAVDLAVLAGLKPAGVICEIIKDDGNMARLPDLLEFAKKFGLRIIS-----
RIBB_NEIMA      PGHIFPLRAQKGVRAGHTEAGVDLAQMNGLIPAAVICEIINDDGTMARMPELMKFAEEHKLKIGTITDL-
RIBB_PSESM      PGHIFPLRARDGTRAGHTEAGCDLARMAGFTPASVIVEVMND----------------------------
RIBB_NEIMB      PGHIFPLRAQKGVRAGHTEAGVDLAQMNGLIPASVICEIINDDGTMARMPELMKFAE-------------
RIBB_AGRT5      PGHIPLRAGVLG-RTGHTEAAVDLCRLAGKFPSGTICEVANDDGTMARLPQLEIFAERHGLLVVT---IK
RIBBA_STAES     PGHLPLIAKENGTRNGHTEAAVDLARLTGAQPAGVICEIMNDDGTMAKGEDLQSFKERHHLKMIT---IK
RIBBA_STAEQ     PGHLPLIAKENGTRNGHTEAAVDLARLTGAQPAGVICEIMNDDGTMAKGEDLQSFKERHHLKMIT---IK
RIBBA_PORGI     PGHICPLRARVLRRAGHTEAAVDLARLCGMQPAAALIEIINEDGTMARLPQLWEVSKRFGLKIIA---IK
RIBBA_PORG3     PGHICPLRARVLRRAGHTEAAVDLARLCGMQPAAALIEIINEDGTMARLPQLWEVSKRFGLKIIA---IK
RIBBA_PARD8     PGHINPLRARVLRRAGHTEAAVDLARLAGLYPAGALIEIINE----------------------------
RIBBA_BREBN     PGHIPLIAGGVLRRAGHTEAAVDLARLAGGIPAGVICEIMNEDGSMARLPQLVEIARRFDLKLIT-----
RIBB_METLZ      PGHMFPLQAKVFEREGHTEATVDLMKLAGLREAGLCCEIMADNGEMMRTPELISMAKQYNLTFVTIKDLQ
RIBBA_MYCUA     PGHVVPLRAKDGRRPGHTEAAVDLARMAGLQPAGAICEIVSDEGSMAQTDELRVFADEHGLALIT-----
RIBBA_MYCMM     PGHVVPLRAKDGRRPGHTEAAVDLARMAGLQPAGAICEIVSDEGSMAQTDELRVFADEHGLALIT-----
RIBB_HELHP      PGHIPLIAGGVLVRTGHTEASVDICRLAGVAPISVICEIM------------------------------
RIBBA_STAHJ     PGHLPLIAKENGERTGHTEAAVDLAKLTKAAPAGVICEIMNEDGTMAKGEQLEAFKHQHGLKMIT---IE
RIBB_HELPJ      PGHIPLIAGGVLARTGHTEASVDLCKLAGLKPVSVICEIM------------------------------
RIBB_WOLSU      PGHIPLIAGGVLVRTGHTEGSVDICKLAGVAPVAVICEIIKKDGHMARRDDLMEFAK-------------
RIBB_RALEJ      PGHVPLVGGVLVRR-GHTEGSVELARMAGLSPAAVLCELMNPDGTMARRPEALSFAEMYRLPILT-----
RIBBA_PELLD     PGHIPLMDGGVLRRVGHTEAAVDLARLAGCSPVGLLCEILHD----------------------------
RIBBA_MYCVP     PGHVVPLRAKDGRRPGHTEAAVDLARLAGLQPAGAICEIVSQKDE-------------------------
RIBB_CHLT3      PGHVFPLRARTGERPGHTEATVDLMRLAGLSPYGVLCELTNPDGTMANLDEAIAFAEKHDFPVLTVEDV-
RIBBA_SYNWW     PGHIFPLRYREGRRAGHTEGSIDLTRLAGLYPAAVICEVMNEDGTMARLPQLLEFARQHNLKLAS-----
RIBBA_PROVI     PGHIPLMDGGVLRRVGHTEAAVDLARLAGCSPVGLLCEILHEDGSMARLADLMTIKEKFGLKLIT---IK
RIBBA_MYCTU     PGHVVPLRAKDGRRPGHTEAAVDLARMAGLQPAGAICEIVSDEGSMAHTDELRVFADEHGLALIT-----
RIBBA_MYCTA     PGHVVPLRAKDGRRPGHTEAAVDLARMAGLQPAGAICEIVSDEGSMAHTDELRVFADEHGLALIT-----
RIBBA_MYCBT     PGHVVPLRAKDGRRPGHTEAAVDLARMAGLQPAGAICEIVSDEGSMAHTDELRVFADEHGLALIT-----
RIBBA_MYCBP     PGHVVPLRAKDGRRPGHTEAAVDLARMAGLQPAGAICEIVSDEGSMAHTDELRVFADEHGLALIT-----
RIBBA_MYCBO     PGHVVPLRAKDGRRPGHTEAAVDLARMAGLQPAGAICEIVSDEGSMAHTDELRVFADEHGLALIT-----
RIBB_HELPY      PGHIPLIAGGVLARTGHTEASVDLCKLAGLKPVSVICEIM------------------------------
RIBB_YERE8      PGHVFPLRGQPGSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIEFAKLHDMPVVT-----
RIBBA_STAAW     PGHLPLVAQDKGARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQKFKEKHQLKMIT-----
RIBBA_STAAS     PGHLPLVAQDKGARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQKFKEKHQLKMIT-----
RIBBA_STAAR     PGHLPLVAQDKGARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQKFKEKHKLKMIT-----
RIBBA_MYCPA     PGHVVPLRAKDGRRPGHTEAAVDLARMAGLQPAGAICEIVSDEGSMAQTDELRVFADEHDLAMIT-----
RIBBA_MYCGI     PGHVVPLRAKDGRRPGHTEAAVDLARLAGLQAAGTICEIVSQKDE-------------------------
RIBBA_MYCA1     PGHVVPLRAKDGRRPGHTEAAVDLARMAGLQPAGAICEIVSDEGSMAQTDELRVFADEHDLAMIT-----
RIBBA_CYTH3     PGHIPLKAKDEGRRVGHTEAAVDLARLAGFKPAGVLIEIMSEDGSMARLPELKQIATKFNLKLIS---IK
RIBBA_STAS1     PGHLPLIAQDNGSRRGHTEASVDLAKLTGAKPAALICEIMDEDGTMAKGASLEAFKETHGLVMIS-----
RIBBA_STAAN     PGHLPLVAQDKGARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQNFKEKHQLKMIT-----
RIBBA_STAAM     PGHLPLVAQDKGARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQNFKEKHQLKMIT-----
RIBBA_SALAI     PGHVVPLRARQGRRPGHTEAAIDLTRLAGLRPAGVLCELVNDDGTMMRVPDLERFCAEHSLVLIT-----
RIB3_CANAL      PGHIPLVPGLLKKRRGHTEAAVQLSTLAGLQPAGVICELVRDEDGLM-----------------------
RIBB_YERPY      PGHVFPLRGQPGSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVT-----
RIBB_YERPS      PGHVFPLRGQPGSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVT-----
RIBB_YERPP      PGHVFPLRGQPGSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVT-----
RIBB_YERPN      PGHVFPLRGQPGSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVT-----
RIBB_YERPG      PGHVFPLRGQPGSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVT-----
RIBB_YERPE      PGHVFPLRGQPGSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVT-----
RIBB_YERPB      PGHVFPLRGQPGSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVT-----
RIBB_YERPA      PGHVFPLRGQPGSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVT-----
RIBB_YERP3      PGHVFPLRGQPGSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVT-----
RIBBA_STAAC     PGHLPLVAQDKGARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQKFKEKHQLKMIT-----
RIB3_MAGGR      PGHVXXXXXXXXXXXXHTEAGVELCRLAGKRPVAVISEIVDDGQE-------------------------
RIBB_HAEIG      PGHVAVNGGVLTRR-GHTEASVDLARLAGFKEAGVICEITNDDGTMARTPDIVEFAKKFGYSVLT-----
RIBBA_SALTO     PGHVVPLRAREGRRTGHTEAATDLTRLAGLRPAGVLCELVNDDGTMMRVPDLERFCAEHSLVLVT-----
RIBB_HAEIE      PGHVFPLGGVLTRR-GHTEASVDLARLAGFKEAGVICEITNDDGTMARTPDIVEFAKKFGYSVLT-----
RIBB_HAEIN      PGHVFPLGGVLTRR-GHTEASVDLARLAGFKEAGVICEITNDDGTMARAPEIVEFAKKFGYSVLT-----
RIBBA_UNCTG     PGHIFPLGGVLA-RTGHTEAAVDLVRLAGFYPAGIICEIMNNDGTMARMSDLIKFAKKHDLHIITIGEL-
RIBBA_CLONN     PGHIFPLRARKGKRAGHTEAAVDLATLAGLTPAGTICEIMNEDGTMARVPDLMKYVKVHNLKIVT-----
RIBB_PASMU      PGHIPLMTGGVLKRRGHTEASVDLARLAGYKAAGVICEITNDDGSMARAPEIVTFAQKFGFPVVT-----
RIBB_RALSO      PGHVPLVGGVLARR-GHTEGSVDLARLAGLSPAGVLCELMLPDGTMARRDDAVRFADQHGLPVLTIEDI-
RIBB_PELPD      PGHVFPLRARPGERRGHTEATVDLMRLAGLKPCGVLCELTNPDGSMARMPEIVAFSRKHGFPLITVEEL-
RIBB_ERWT9      PGHVFPLRARSGTRGGHTEATLDLVTLAGFKPAGVLCELTNDDGSMAHAPEVIVFARQHDMPVVTIEDLV
RIBB_WIGBR      PGHVFPLQAHPGSRAGHTEAAVDLTKLAGLKPAGVICEVMNDDGSMARMPEIINFSKKYNMPVL------
RIBB_HAES1      PGHVFPLRAKKGARRGHTEAAVDLASWAGHKPAGVICEITNDDGSMARTPEIVEFGKKFNYPVVT-----
RIBB_HAEI8      PGHVFPLGGVLTRR-GHTEASVDLARLAGFKEAGVICEITNDDGTMARTPEIVEFAKKFGYSVLT-----
RIBBA_PROA2     PGHIPLMDGGVLRRVGHTEAAVDLAELAGSTPVGLLCEILHDDGSMARLPELLKIKEKFDLKLIT---IK
RIBB_HAES2      PGHVFPLRAKKGARRGHTEAAVDLASWAGHKPAGVICEITNDDGSMARTLEIVEFGKKFNYPVVT-----
RIBB_ECOSM      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_ECOLU      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBBA_THEMA     PGHVTVIGGGFQRRKGHTEASLEISELAGFSRHAVIVEILDEKGNSHNLDYVLKLSEKFSLPVL------
RIBB_PROMH      PGHVFPLRAQPGTRGGHTEASIDLATLAGFKPVAVLCELTNDDGTMARAPEVVTFAKQHDMPVLT-----
RIBB_PHOLE      PGHIPLMAGGVLIRAGHTEAGCDVARLAGLEPSSVIVEILNE----------------------------
RIBB_CHLL2      PGHIFPLRARPGERPGHTEATVDLMRLAGLSPAGVLCELTNPDGSMAGIEETFAFSVQHGFPVLS-----
RIBB_BAUCH      PGHVPLLAGGVLNRGGHTEAAIDLTLLAGLKPAGVLCEVTNEDGSMARALEIIAFSNQHNMPVLT-----
RIBB_SHISS      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_SHIFL      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_SHIF8      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_SHIDS      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_SHIBS      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_SHIB3      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_ECOSE      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_ECOLI      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_ECOLC      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_ECOL5      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_ECOHS      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_ECODH      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_ECOBW      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_ECO8A      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_ECO7I      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_ECO5E      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_ECO57      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_ECO55      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_ECO24      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_DESAD      PGHVFPLRAREGEREGHTEATVDMMTLAGLNPCGVLCELTNPDGTMARLPEIVEFGQKHDMPVLTVDDI-
RIBB_ESCF3      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_EDWI9      PGHVFPLRARPGARRGHTEATIDLVSLAGFRPAGVLCELTNDDGTMARAPQVMAFARQHEMPVVT-----
RIBB_ECOUT      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_ECOL6      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_ECOK1      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_ECO81      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_ECO45      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_ECO27      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVT-----
RIBB_TOLAT      PGHVFPLRARAGTRRGHTEATIDLMKLAGLKPYGVLCEVQNEDGSMARLPGIVEFANKHNMPVL------
RIBB_CAMJE      PGHIPLIAKKGGERTGHTEGTVDLCKLAGLKGACVICEIVKDN---------------------------
RIBBA_CHLPN     PGHFFPLASSPGKRAGHTESTVDLMELAGLQPCGVLAELVNEDYSMMRLPQILEFARKHNIAVIPVTSI-
RIBB_CITK8      PGHVFPLRAQPGTRGGHTEATIDLVTLAGFKPAGVLCELTND----------------------------
RIBBA_CORGL     PGHVVPLRAREGGRAGHTEAAVDLARAAGLRPAGVICEVVSDPTGMARVPELRRFCDEHDLKLIS-----
RIBBA_CORGB     PGHVVPLRAREGGRAGHTEAAVDLARAAGLRPAGVICEVVSDPTGMARVPELRRFCDEHDLKLIS-----
RIBB_DEHMU      PGHIPLIGGAL-VRIGHTEGSVDLCRLAGQGDSAVICEIM------------------------------
RIBBA_CHLMU     PGHVPLVSGGVVKRPGHTEASMDLMRLAGMYPCGIFAELVNADHSMMRQQQILDFAEQHGFTVIT-----
RIBB_SODGM      PGHVPLCAGGVLVRGGHTEAAVDLTTLAGLKPAGVLCEVTNDDGSMAHAPEIIAFGRRHNMPVLT-----
RIBB_PECCP      PGHVFPLRAQPGTRGGHTEATVDLMTLAGLKPSGVLCELTNDDGSMAHAPEVIAFAKQHDMPVLT-----
RIBB_DESDG      PGHVFPLRARPGERRGHTEATVDLMRLAGLKPCGVLCEV-------------------------------
RIBB_HAMD5      PGHVPLKGGVLG-RSGHTEAAIDLARLAGLKPAGVLCELTNDNGTMARAPEVIAFAK-------------
RIBB_PHOPO      PGHIPLMAGGVLARAGHTEAGCDVARLAGLEPSSVIVEILNDDGTMARRPQLEVFAKKHGLKLGTVADL-
RIBB_KLEP7      PGHVFPLRAQPGTRGGHTEATIDLVTLAGFKPAGVLCELTNDDGTMARAPECIKFAQQHNMAVVT-----
RIBB_ENT38      PGHVFPLRAQAGTRGGHTEATLDLVTLAGFKPAGVLCELTNDDGTMARAPECVTFARLHNMPVVT-----
RIBB_SHELP      PGHVYPLRAQPGTRRGHTEGTIDLMKLAGLKPAGVLCEVTNVNGTMARLPEIIAFGEQHKMPVLTIEDI-
RIBB_DESAH      PGHVAVEQGVLGRR-GHTEGTVDLMRLAGLAPAGVLCEL-------------------------------
RIBB_SHEFN      PGHVFPLRARAGSRRGHTEGTVDLMQMAGLMPAGVLCELANEDGSMAKTPEIIAFGLKHNMPVLT-----
RIBB_MANSM      PGHVPLRAAENGARPGHTEAAVDLARLCGYKPAGVICEITNDDGTMARTPELVAFAQKFGYAVVT-----
RIBB_KLEP3      PGHVFPLRAQPGTRGGHTEATIDLVTLAGFKPAGVLCELTNDDGTMARAPECIKFAQQHNMAIVT-----
RIBBA_PELPB     PGHIPLMDGGVLRRVGHTEAAVDLARLAGCSPTGLLCEILNDDGSMARLPQLIKLKAKFGLKLITIKEL-
RIBB_PSEAE      PGHIPLMGGTLA-RAGHTEAACDLARMAGFEPSGVICEVMNDDGSMARRPELEAFAAEHGIKIGT-----
RIBB_ERWCT      PGHVFPLRAQPGTRGGHTEATVDLMTLAGLKPSGVLCELTNDDGSMAHAPEVIAFAK-------------
RIBB_SHEPW      PGHVYPLRARPGERRGHTEGTVDLMKLAGLKPFGVLCEVLPDGTMAR-LPEIVEFGQQHNMPVLTIEDI-
RIBB_RHORT      PGHVFPLRAHLSARRGHTEATIALMRLAGLRPAGVLCEVMNPDGTMARLPTLIGYGQAHGLPIVS-----
RIBBA_MYCA9     PGHVVPLRAKDGRRPGHTEASVDLAKLAGLRPAAVICEIVSQKDEGAQTEELRVFADEHNLALVS-----
RIBB_PHOPR      PGHVPLADGVLGRR-GHTEATIDLMRLSGLKPYGVLCELTNIDGTMARLPEVIVFGKKFNMPVLT-----
RIBB_ENTS8      PGHVFPLRAQPGTRGGHTEATIDLVSLAGFKPAGVLCELTNDDGTMARAPECIAFAREHNMPVVTIEDLV
RIBB_SHEHH      PGHVYPLRARPGERRGHTEGTVDLMKLAGLKPYGVLCEVLVDGTMAR-LPEIIEFGQQHDMPVLTIEDI-
RIBB_PSEHT      PGHVFGLKAKTGVRRGHTEASVDLMQLAGLKPFGVICELTNPDGSMARLPEVSGYANKHNMPVVS-----
RIBB_VIBPA      PGHVFPLRARPGTRRGHTEGTIDLMQMAGLQPAGVLCEVTNPDGTMAKAPEIVAFGHLHNMPVLT-----
RIBB_SERP5      PGHVFPLGGVLSRR-GHTEATIDLVSMAGFKPAGVLCELTNDDGSMAHAPEVILFAKQHDMTVLT-----
RIBB_SALAR      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTNDNGTMARAPECIAFAGQHNMAVVT-----
RIBB_BORPE      PGHVFPLRAQPGTRRGHTEGSVDLAALAGLRPAGVLCELMNADGTMMRGASLERYAAKEGL---------
RIBB_BORPA      PGHVFPLRAQPGTRRGHTEGSVDLAALAGLRPAGVLCELMNADGTMMRGASLERYAAKEGL---------
RIBB_BORBR      PGHVFPLRAQPGTRRGHTEGSVDLAALAGLRPAGVLCELMNADGTMMRGASLERYAAKEGL---------
RIBB_SALTY      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTND----------------------------
RIBB_SALTI      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTND----------------------------
RIBB_SALSV      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTND----------------------------
RIBB_SALPC      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTND----------------------------
RIBB_SALPB      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTND----------------------------
RIBB_SALNS      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTND----------------------------
RIBB_SALHS      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTND----------------------------
RIBB_SALG2      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTND----------------------------
RIBB_SALEP      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTND----------------------------
RIBB_SALDC      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTND----------------------------
RIBB_SALCH      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTND----------------------------
RIBB_SALA4      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTND----------------------------
RIBB_VIBVY      PGHVFPLRARPGARRGHTEGTVDLMQMAGLQPAGVLCELTNPDGTMAKTPEIIAFGKQHNMPVLT-----
RIBB_VIBVU      PGHVFPLRARPGARRGHTEGTVDLMQMAGLQPAGVLCELTNPDGTMAKTPEIIAFGKQHNMPVLT-----
RIBB_VIBSL      PGHVFPLRARKGARRGHTEGTVDLMQMAGLQSAGVLCEVTNPDGTMAKAPEIVAFGKMHNMPVLT-----
RIBB_SALPK      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTND----------------------------
RIBB_SALPA      PGHVFPLRAQAGTRGGHTEATIDLMTLAGFKPAGVLCELTND----------------------------
RIBB_SHEB9      PGHVYPLRAQPGTRRGHTEGTIDLVQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGALHNMPVLTIEDI-
RIBB_SHEB8      PGHVYPLRAQPGTRRGHTEGTIDLVQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGALHNMPVLTIEDI-
RIBB_SHEB5      PGHVYPLRAQPGTRRGHTEGTIDLVQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGALHNMPVLTIEDI-
RIBB_SHEB2      PGHVYPLRAQPGTRRGHTEGTIDLVQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGALHNMPVLTIEDI-
RIBB_DESRM      PGHVPLRAGGVLERQGHTEATVDLMKLAGLQPYGVLCELTNIDGTMARLPEVVTFANKNNIPVVT-----
RIBB_SHESR      PGHVYPLRAQPGTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGAAHNMPVLTIEDI-
RIBB_SHESM      PGHVYPLRAQPGTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGAAHNMPVLTIEDI-
RIBB_SHEPC      PGHVYPLRAQPGTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGAQHNIPVLTIEDI-
RIBB_SHEWM      PGHVYPLRAQSGSRRGHTEGTIDLMLLAGLKPAGVLCEITNPDGTMARLPEIIQFGQQHNLPVLTIEDI-
RIBB_SHESA      PGHVYPLRAQPGTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGAEHNMPVLTIEDI-
RIBBA_CHLTR     PGHVPLISGGAVQRPGHTEAAMDLMRLAGMQPCGIFAELVNPDHSMMRQQQVLAFAEQHDLTVIT-----
RIBBA_ARATH     PGHIFPLKYREGKRAGHTEASVDLTVLAGLDPVGVLCEIVDDDGSMARLPKLREFAAENNLKVVS-----
RIBB_PHOLL      PGHVFPLRAQPGVRQGHTEAAIDLVSLAGFKPAGVLCELTNDDGSMARTLEVVQFAKLHNMPVVT-----
RIBB_DESVV      PGHVPLRAGGVLERRGHTEATVDLMRLAGLKPYGVLCEL-------------------------------
RIBB_DESVH      PGHVPLRAGGVLERRGHTEATVDLMRLAGLKPYGVLCEL-------------------------------
RIBBA_SYNY3     PGHIFPLRAKTGKRAGHTEAAVDLSRLAGLYPAGVICEIQNADGSMARLPELVEYARKYDLKLISIADLI
RIBBA_CORAM     PGHVVPLAARPNERDGHTEAAIDLARLAGLRPAGVLCEIVSDPTTMARSEELRRFS--------------
RIBB_VIBCM      PGHVXXXXXXXXXXXXHTEGTVDLMQMAGLQPAGVLCELTNPDGSMAKTPEIIEFGKLHNMPVLT-----
RIBB_VIBCH      PGHVXXXXXXXXXXXXHTEGTVDLMQMAGLQPAGVLCELTNPDGSMAKTPEIIEFGKLHNMPVLT-----
RIBB_DESDA      PGHVFPLRAKPGERRGHTEATVDLMRLAGHAPCGVLCELTLDDGSMARLPQVAAFAVAHAIPL-------
RIBB_DESAA      PGHVFPLRARPGERRGHTEATVDMMRLAGLKPCGVLCELTNPDGTMARLPQLADFAKKHGMVLLT-----
RIBB_SHESW      PGHVYPLRAQPGTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGAQHNIPVLTIEDI-
RIBB_SHEON      PGHVYPLRAQPGTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGALHNMPVLTIEDI-
RIBB_VIBC3      PGHVXXXXXXXXXXXXHTEGTVDLMQMAGLQPAGVLCELTNPDGSMAKTPEIIAFGKLHNMPVLT-----
RIBB_VIBHA      PGHVPLVAKTNGARRGHTEGTIDLMYLANLVPSGILCELTNPDGTMAKLPETIEFARRHGMPVLTIEDI-
RIBB_CLOBL      PGHVFPLRARAGTRPGHTEGTVDLMRLAGYNPAGILCEL-------------------------------
RIBB_BUCAT      PGHVFPLRAHKGSRPGHTEAAIEIVSLAGFKPAGVICELTNKDGTMARTPEIIKFSENKKMQVLT-----
RIBB_BUCAI      PGHVFPLRAHKGSRPGHTEAAIEIVSLAGFKPAGVICELTNKDGTMARTPEIIKFSENKKMQVLT-----
RIBB_BUCA5      PGHVFPLRAHKGSRPGHTEAAIEIVSLAGFKPAGVICELTNKDGTMARTPEIIKFSENKKMQVLT-----
RIBB_BLOFL      PGHVFPLRAHNGSRSGHTEAAVDLTTLAGLKPFGVICEVTNEDGSMARTTEIIKFSKQYDMPVLTISDV-
RIBB_SHESH      PGHVYPLRAQPGTRRGHTEGTIDLMILAGLKPAGVLCEITNPDGTMARLAEIISFGAKHDLPVLTIEDI-
RIBB_SHEPA      PGHVYPLRARPGERRGHTEGTVDLMKLAGLQPFGVLCEVLPDGTMAR-LPEIVEFAQQHDMPVLTIEDI-
RIBB_PELCD      PGHVFPLRARPGTRRGHTEGTVDLMRMAGYKPAGVLCELTNE----------------------------
RIBB_DESPS      PGHVFPLRARVLDRRGHTEGTVDLMKLSGLAPAGLLCEL-------------------------------
RIBB_BUCBP      PGHIPLQAHKNGGRIGHTEAAIEFVTLAGFKPAGIICELTNRNGTMSKVPDIIKFSKLKKMTIVT-----
RIBBA_RHOE4     PGHVVPLRAKEGRRPGHTEAAVDLARMADLRPAGVICEIVSQKDEGAQTDELRVFADEHNLALIS-----
RIBB_PSEPK      PGHVFPLRARNGTRRGHTEGSVDLARLAGLRPAAVLCELMNPDGSMARGEQVAVYARQYNLPVLTIEEL-
RIBB_CLOBH      PGHVFPLRARAGTRPGHTEGTVDLMRLAGYNPAGILCEL-------------------------------
RIBB_CLOB1      PGHVFPLRARAGTRPGHTEGTVDLMRLAGYNPAGILCEL-------------------------------
RIBBA_RHOSR     PGHVVPLRAKEGRRPGHTEAAVDLARMADLRPAGVICEIVSDEGHMAQTDELRVFADDHNLALIS-----
RIBB_CHRVO      PGHVPIXXXXXXXXXXHTEASVELARLAGFSPAGVLCELMNPDGTMMRGQQVQDYAERHDLPQLSVAEL-
RIBBA_NOCFA     PGHVVPLRAKDGRRPGHTEAAVDLARMAGLRPAGVICEIVSDEGHMARTEELRVFADDHDLALIS-----


                         .         .         .         +         .         .         .:280
query           SLI
RIBB_METMA      ---
RIBB_METJA      ---
RIBB_METAC      ---
RIBB_METTH      ---
RIBB_ARCFU      ---
RIBBA_BACSK     DLI
RIBBA_BACWK     ---
RIBBA_BACCR     ---
RIBBA_BACC4     ---
RIBBA_BACC2     ---
RIBBA_BACCQ     ---
RIBBA_BACC7     ---
RIBBA_BACC1     ---
RIBBA_BACAM     DLI
RIBBA_BACSU     DLI
RIBBA_BACHK     ---
RIBBA_BACCZ     ---
RIBBA_BACC3     ---
RIBBA_BACAN     ---
RIBBA_BACAH     ---
RIBBA_BACAC     ---
RIBBA_BACAA     ---
RIBBA_BACC0     ---
RIBBA_BACFR     DLI
RIBBA_BACFN     DLI
RIBBA_AQUAE     ---
RIBBA_BACA2     DLI
RIBBA_ACTPL     ---
RIBBA_ACTPJ     ---
RIBBA_ACTP7     ---
RIBBA_ACTP2     ---
RIBBA_GEOSW     DLI
RIBBA_BACTN     ---
RIBBA_BACV8     ---
RIBBA_BACCN     ---
RIBB_OCEIH      ---
RIB3_SCHPO      SYI
RIBBA_THEPX     ---
RIBBA_THEP3     ---
RIBB_NEIMA      ---
RIBB_PSESM      ---
RIBB_NEIMB      ---
RIBB_AGRT5      DLV
RIBBA_STAES     SLV
RIBBA_STAEQ     SLV
RIBBA_PORGI     DLI
RIBBA_PORG3     DLI
RIBBA_PARD8     ---
RIBBA_BREBN     ---
RIBB_METLZ      A--
RIBBA_MYCUA     ---
RIBBA_MYCMM     ---
RIBB_HELHP      ---
RIBBA_STAHJ     SLV
RIBB_HELPJ      ---
RIBB_WOLSU      ---
RIBB_RALEJ      ---
RIBBA_PELLD     ---
RIBBA_MYCVP     ---
RIBB_CHLT3      ---
RIBBA_SYNWW     ---
RIBBA_PROVI     DLV
RIBBA_MYCTU     ---
RIBBA_MYCTA     ---
RIBBA_MYCBT     ---
RIBBA_MYCBP     ---
RIBBA_MYCBO     ---
RIBB_HELPY      ---
RIBB_YERE8      ---
RIBBA_STAAW     ---
RIBBA_STAAS     ---
RIBBA_STAAR     ---
RIBBA_MYCPA     ---
RIBBA_MYCGI     ---
RIBBA_MYCA1     ---
RIBBA_CYTH3     DLI
RIBBA_STAS1     ---
RIBBA_STAAN     ---
RIBBA_STAAM     ---
RIBBA_SALAI     ---
RIB3_CANAL      ---
RIBB_YERPY      ---
RIBB_YERPS      ---
RIBB_YERPP      ---
RIBB_YERPN      ---
RIBB_YERPG      ---
RIBB_YERPE      ---
RIBB_YERPB      ---
RIBB_YERPA      ---
RIBB_YERP3      ---
RIBBA_STAAC     ---
RIB3_MAGGR      ---
RIBB_HAEIG      ---
RIBBA_SALTO     ---
RIBB_HAEIE      ---
RIBB_HAEIN      ---
RIBBA_UNCTG     ---
RIBBA_CLONN     ---
RIBB_PASMU      ---
RIBB_RALSO      ---
RIBB_PELPD      ---
RIBB_ERWT9      S--
RIBB_WIGBR      ---
RIBB_HAES1      ---
RIBB_HAEI8      ---
RIBBA_PROA2     DLV
RIBB_HAES2      ---
RIBB_ECOSM      ---
RIBB_ECOLU      ---
RIBBA_THEMA     ---
RIBB_PROMH      ---
RIBB_PHOLE      ---
RIBB_CHLL2      ---
RIBB_BAUCH      ---
RIBB_SHISS      ---
RIBB_SHIFL      ---
RIBB_SHIF8      ---
RIBB_SHIDS      ---
RIBB_SHIBS      ---
RIBB_SHIB3      ---
RIBB_ECOSE      ---
RIBB_ECOLI      ---
RIBB_ECOLC      ---
RIBB_ECOL5      ---
RIBB_ECOHS      ---
RIBB_ECODH      ---
RIBB_ECOBW      ---
RIBB_ECO8A      ---
RIBB_ECO7I      ---
RIBB_ECO5E      ---
RIBB_ECO57      ---
RIBB_ECO55      ---
RIBB_ECO24      ---
RIBB_DESAD      ---
RIBB_ESCF3      ---
RIBB_EDWI9      ---
RIBB_ECOUT      ---
RIBB_ECOL6      ---
RIBB_ECOK1      ---
RIBB_ECO81      ---
RIBB_ECO45      ---
RIBB_ECO27      ---
RIBB_TOLAT      ---
RIBB_CAMJE      ---
RIBBA_CHLPN     ---
RIBB_CITK8      ---
RIBBA_CORGL     ---
RIBBA_CORGB     ---
RIBB_DEHMU      ---
RIBBA_CHLMU     ---
RIBB_SODGM      ---
RIBB_PECCP      ---
RIBB_DESDG      ---
RIBB_HAMD5      ---
RIBB_PHOPO      ---
RIBB_KLEP7      ---
RIBB_ENT38      ---
RIBB_SHELP      ---
RIBB_DESAH      ---
RIBB_SHEFN      ---
RIBB_MANSM      ---
RIBB_KLEP3      ---
RIBBA_PELPB     ---
RIBB_PSEAE      ---
RIBB_ERWCT      ---
RIBB_SHEPW      ---
RIBB_RHORT      ---
RIBBA_MYCA9     ---
RIBB_PHOPR      ---
RIBB_ENTS8      S--
RIBB_SHEHH      ---
RIBB_PSEHT      ---
RIBB_VIBPA      ---
RIBB_SERP5      ---
RIBB_SALAR      ---
RIBB_BORPE      ---
RIBB_BORPA      ---
RIBB_BORBR      ---
RIBB_SALTY      ---
RIBB_SALTI      ---
RIBB_SALSV      ---
RIBB_SALPC      ---
RIBB_SALPB      ---
RIBB_SALNS      ---
RIBB_SALHS      ---
RIBB_SALG2      ---
RIBB_SALEP      ---
RIBB_SALDC      ---
RIBB_SALCH      ---
RIBB_SALA4      ---
RIBB_VIBVY      ---
RIBB_VIBVU      ---
RIBB_VIBSL      ---
RIBB_SALPK      ---
RIBB_SALPA      ---
RIBB_SHEB9      ---
RIBB_SHEB8      ---
RIBB_SHEB5      ---
RIBB_SHEB2      ---
RIBB_DESRM      ---
RIBB_SHESR      ---
RIBB_SHESM      ---
RIBB_SHEPC      ---
RIBB_SHEWM      ---
RIBB_SHESA      ---
RIBBA_CHLTR     ---
RIBBA_ARATH     ---
RIBB_PHOLL      ---
RIBB_DESVV      ---
RIBB_DESVH      ---
RIBBA_SYNY3     S--
RIBBA_CORAM     ---
RIBB_VIBCM      ---
RIBB_VIBCH      ---
RIBB_DESDA      ---
RIBB_DESAA      ---
RIBB_SHESW      ---
RIBB_SHEON      ---
RIBB_VIBC3      ---
RIBB_VIBHA      ---
RIBB_CLOBL      ---
RIBB_BUCAT      ---
RIBB_BUCAI      ---
RIBB_BUCA5      ---
RIBB_BLOFL      ---
RIBB_SHESH      ---
RIBB_SHEPA      ---
RIBB_PELCD      ---
RIBB_DESPS      ---
RIBB_BUCBP      ---
RIBBA_RHOE4     ---
RIBB_PSEPK      ---
RIBB_CLOBH      ---
RIBB_CLOB1      ---
RIBBA_RHOSR     ---
RIBB_CHRVO      ---
RIBBA_NOCFA     ---