[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL64645.1

[Show Plain Result]


## Summary of Sequence Search
    1::546
    8::147     2e-10  22%  585 aa  SAC1_CHLRE RecName: Full=Putative sulfur deprivation response
   35::183     2e-08  23%  612 aa  Y640_SYNY3 RecName: Full=Uncharacterized transporter sll0640;
   58::162     2e-08  29%  428 aa  Y2685_MYCTU RecName: Full=Uncharacterized transporter
  250::388     8e-08  27%  429 aa  Y2703_MYCBO RecName: Full=Uncharacterized transporter Mb2703;
  250::388     8e-08  27%  429 aa  Y2684_MYCTU RecName: Full=Uncharacterized transporter
   41::161     7e-07  26%  610 aa  YFBS_ECOLI RecName: Full=Uncharacterized transporter yfbS;
   41::161     7e-07  26%  610 aa  YFBS_ECO57 RecName: Full=Uncharacterized transporter yfbS;
  285::408     3e-06  32%  449 aa  Y753_SYNY3 RecName: Full=Uncharacterized transporter slr0753;
  331::500     4e-06  27%  845 aa  P_PIG  RecName: Full=P protein;AltName: Full=Melanocyte-specific
  376::493     1e-05  26%  838 aa  P_HUMAN RecName: Full=P protein;AltName: Full=Melanocyte-specific
  371::488     3e-05  23%  833 aa  P_MOUSE RecName: Full=P protein;AltName: Full=Melanocyte-specific
  477::611     4e-04  23%  867 aa  YBH4_SCHPO RecName: Full=Uncharacterized transporter C3B8.04c;
  122::207     7e-04  32%  403 aa  Y532_BUCBP RecName: Full=Uncharacterized transporter bbp_532;
  132::186     7e-04  42%  287 aa  ROGDI_BOVIN RecName: Full=Protein rogdi homolog;
   58::162     7e-04  26%  429 aa  AG45_MYCLE RecName: Full=46 kDa membrane protein;
  236::340     0.001  36%  752 aa  DRS1_VANPO RecName: Full=ATP-dependent RNA helicase DRS1;       
    1::546

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxRADIIAFVSLMALVLVGVYDLREALSYLISPAVIVLFGSMVISGVIAD
SAC1_CHLRE      -----------------------ADVCLFAASTLLLLRGIIQARDAFAGLANDSIVSIALMMMIAAGLES
Y640_SYNY3      ------------------------DTTAILVAVILMVLGLVTPTEGIAGFSNSATVTIMAMFILSXXXXX
Y2685_MYCTU     ------------------------------------------------------IFLLLGMMIIVSVLRH
Y2703_MYCBO     -------------------------LVALLGAGMLIVVSGLTRSEYLSSVEWDTLLFFAGLFIMVGALVK
Y2684_MYCTU     -------------------------LVALLGAGMLIVVSGLTRSEYLSSVEWDTLLFFAGLFIMVGALVK
YFBS_ECOLI      --------------------------------------GTLTVPEVFSGFSDPNVVLIAALFIIGDGLVR
YFBS_ECO57      --------------------------------------GTLTVPEVFSGFSDPNVVLIAALFIIGDGLVR
Y753_SYNY3      ------------------------------------------------------LIFFMSIFVIIGSLEK
P_PIG           ----------------------RASIEAQVTIAAVILAGVYTLTQVVEWIDFETLALLFGMMILVAIFSE
P_HUMAN         ------------------------------------------LTHVVEWIDFETLALLFGMMILVAIFSE
P_MOUSE         ------------------------------------------LTHVVEWIDFETLALLFGMMILVAVFSE
YBH4_SCHPO      ------------------------------------LSGKESTKVIFSSMWNPTIVLLLGGFTIAAALSK
Y532_BUCBP      ----------------------------------------------------------------------
ROGDI_BOVIN     ----------------------------------------------------------------------
AG45_MYCLE      ------------------------------------------------------IFLLLSMMIIVSVLRQ
DRS1_VANPO      -----------------------------LTLSRPVLKGLSDLGYTKPSPIQSATIPLSGKDIIAGAVTG


                         .         .         *         .         .         .         .:140
query           SGLLDRVARYISVRVRHVATASLLLYFVAGVASGFVSDVAIVLAMAVLIGDVAKRLGASPAAYVIPLAFA
SAC1_CHLRE      SGALEFVPELVLGRSKREWVGQLRMHIAVASVSAVMNNTPLVAVMIPVVESWCRNNNHHPSRFMMPLSYS
Y640_SYNY3      XXXXDSLIKFGGDSLRRQL---LLMGFIVGPSSAFLNNTAIVAIFLPIIEEWARQRQISVSKLLIPLSYA
Y2685_MYCTU     TGVFEYVAIWAVKRANAAPLRMILLVLVTALGSALLDNVTTVLLIAPVTLLVCDRLGVNSTPFLVAEVFA
Y2703_MYCBO     TGVVNDLARAATQLTNIVATAFLILGVSAPI-SGIIDNIPYVATMTPLVAELVAVMGGQPSTDTPALALG
Y2684_MYCTU     TGVVNDLARAATQLTNIVATAFLILGVSAPI-SGIIDNIPYVATMTPLVAELVAVMGGQPSTDTPALALG
YFBS_ECOLI      TGVATVMGTWL-VKVAEIKMLVLLMLTVAGLGA-FMSSTGVVAIFIPVVLSVAMRMQTSPSRLMMPLSFA
YFBS_ECO57      TGVATVMGTWL-VKVAEIKMLVLLMLTVAGLGA-FMSSTGVVAIFIPVVLSVAMRMQTSPSRLMMPLSFA
Y753_SYNY3      TGVTASLAQLLAVVVQNIAFGAIVLVFTVGLLSSVVPNIPLVVAMVPLLKQYVVNIGAGPEAEVLPLFYA
P_PIG           TGFFDYCAKAYQLSRGRVWAMIIMLCLIAAVLSAFLDNVTTALLFTPVTIRLCEVLNLDPRQVLIAEVIF
P_HUMAN         TGFFDAVKAYRLSRGR-VWAMIIMLCLIAAVLSAFLDNVTTMLLFTPVTIRLCEVLNLDPRQVLIAEVIF
P_MOUSE         TGFFDYCAKAYQLSRGRVWAMIFMLCLMAAILSAFLDNVTTMLLFTPVTIRLCEVLNLDPRQVLIAEVIF
YBH4_SCHPO      YHIAKRLATSILAHAGRKPRSVLLTMFVAMFASMWISNVAAPVLCFSIIQPLLRNLPAESKILIVGIALA
Y532_BUCBP      ----------------------------------------------------------------------
ROGDI_BOVIN     ----------------------------------------------------------------------
AG45_MYCLE      TGVFEYVAIWTAKRSHGSPXXXXXXXXXXXXXXXXXXDVTTVLLIAPVTLLVCERLTINAAPFLMAEVFA
DRS1_VANPO      SG---KTAAFM------IPIIERLLYKPAKVASTRVIVLTPTRELAIQIADVGKKIG----KYVSGLTFG


                         +         .         .         .         .         *         .:210
query           AAIGGRLTMVGNAGNVILLDIYQTTTGEKLNIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SAC1_CHLRE      AILGGLCTIIGTSTNLIARGLAQ-----------------------------------------------
Y640_SYNY3      TILGGMITLLGTSTNILASGLAEKLTGQGFSI--------------------------------------
Y2685_MYCTU     SNVGGAATLVGDPPNIII----------------------------------------------------
Y2703_MYCBO     ADFGGNLTAIGASANVVMLGI-------------------------------------------------
Y2684_MYCTU     ADFGGNLTAIGASANVVMLGI-------------------------------------------------
YFBS_ECOLI      GLISGMMTLVATPPNLVV----------------------------------------------------
YFBS_ECO57      GLISGMMTLVATPPNLVV----------------------------------------------------
Y753_SYNY3      ATLGGNGTLVGASSNIVAAGI-------------------------------------------------
P_PIG           TNIGGAATAIGDPPNVIIV---------------------------------------------------
P_HUMAN         TNIGGAATAIGDPPNVIIV---------------------------------------------------
P_MOUSE         TNIGGAATAIGDPPNVIIV---------------------------------------------------
YBH4_SCHPO      SNVGGIASPISSPQNIVALQNMDPAAG-------------------------------------------
Y532_BUCBP      ----------------------------------------------------------------------
ROGDI_BOVIN     ----------------------------------------------------------------------
AG45_MYCLE      SNIGGAATLVGDPPNIII----------------------------------------------------
DRS1_VANPO      LAVGG-----------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SAC1_CHLRE      ----------------------------------------------------------------------
Y640_SYNY3      ----------------------------------------------------------------------
Y2685_MYCTU     ----------------------------------------------------------------------
Y2703_MYCBO     ----------------------------------------------------------------------
Y2684_MYCTU     ----------------------------------------------------------------------
YFBS_ECOLI      ----------------------------------------------------------------------
YFBS_ECO57      ----------------------------------------------------------------------
Y753_SYNY3      ----------------------------------------------------------------------
P_PIG           ----------------------------------------------------------------------
P_HUMAN         ----------------------------------------------------------------------
P_MOUSE         ----------------------------------------------------------------------
YBH4_SCHPO      ----------------------------------------------------------------------
Y532_BUCBP      ----------------------------------------------------------------------
ROGDI_BOVIN     ----------------------------------------------------------------------
AG45_MYCLE      ----------------------------------------------------------------------
DRS1_VANPO      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxESYVFRPGDEILVLGDEKVIERIAAYYR
SAC1_CHLRE      ----------------------------------------------------------------------
Y640_SYNY3      ----------------------------------------------------------------------
Y2685_MYCTU     ----------------------------------------------------------------------
Y2703_MYCBO     ----------------------------------------------------------------------
Y2684_MYCTU     ----------------------------------------------------------------------
YFBS_ECOLI      ----------------------------------------------------------------------
YFBS_ECO57      ----------------------------------------------------------------------
Y753_SYNY3      ----------------------------------------------------------------------
P_PIG           ----------------------------------------------------------------------
P_HUMAN         ----------------------------------------------------------------------
P_MOUSE         ----------------------------------------------------------------------
YBH4_SCHPO      ----------------------------------------------------------------------
Y532_BUCBP      ----------------------------------------------------------------------
ROGDI_BOVIN     ------------------------------------------ESYQFRTGAEVLKLMDAVMLQLTRARNR
AG45_MYCLE      ----------------------------------------------------------------------
DRS1_VANPO      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LERSKTLVKAFNPRLAASGISGLFAAVVLSQFAPASLAFIIGTFIALLGGGKAVERLYQYVSWETLIYVG
SAC1_CHLRE      ----------------------------------------------------------------------
Y640_SYNY3      ----------------------------------------------------------------------
Y2685_MYCTU     ----------------------------------------------------------------------
Y2703_MYCBO     ----------------------------------------------------------------------
Y2684_MYCTU     ----------------------------------------------------------------------
YFBS_ECOLI      ----------------------------------------------------------------------
YFBS_ECO57      ----------------------------------------------------------------------
Y753_SYNY3      ----------------------------------------------------------------------
P_PIG           ----------------------------------------------------------------------
P_HUMAN         ----------------------------------------------------------------------
P_MOUSE         ----------------------------------------------------------------------
YBH4_SCHPO      ----------------------------------------------------------------------
Y532_BUCBP      --------------LALSGVAAVAMTYLSEEMHPSVLSFSIGLYISTIGGGRFLSSLFEYFSWNIALEFI
ROGDI_BOVIN     LTTPATLTL---PEIAASGLTRMFAPTLPS----------------------------------------
AG45_MYCLE      ----------------------------------------------------------------------
DRS1_VANPO      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           SFLAIGTAAARIDLLKPITPLLNSPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SAC1_CHLRE      ----------------------------------------------------------------------
Y640_SYNY3      ----------------------------------------------------------------------
Y2685_MYCTU     ----------------------------------------------------------------------
Y2703_MYCBO     ----------------------------------------------------------------------
Y2684_MYCTU     ----------------------------------------------------------------------
YFBS_ECOLI      ----------------------------------------------------------------------
YFBS_ECO57      ----------------------------------------------------------------------
Y753_SYNY3      ----------------------------------------------------------------------
P_PIG           ----------------------------------------------------------------------
P_HUMAN         ----------------------------------------------------------------------
P_MOUSE         ----------------------------------------------------------------------
YBH4_SCHPO      ----------------------------------------------------------------------
Y532_BUCBP      SFLAFTSAVLFVYLLPKSKNFCSSP---------------------------------------------
ROGDI_BOVIN     ----------------------------------------------------------------------
AG45_MYCLE      ----------------------------------------------------------------------
DRS1_VANPO      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SAC1_CHLRE      --------------------------------------------------------
Y640_SYNY3      --------------------------------------------------------
Y2685_MYCTU     --------------------------------------------------------
Y2703_MYCBO     --------------------------------------------------------
Y2684_MYCTU     --------------------------------------------------------
YFBS_ECOLI      --------------------------------------------------------
YFBS_ECO57      --------------------------------------------------------
Y753_SYNY3      --------------------------------------------------------
P_PIG           --------------------------------------------------------
P_HUMAN         --------------------------------------------------------
P_MOUSE         --------------------------------------------------------
YBH4_SCHPO      --------------------------------------------------------
Y532_BUCBP      --------------------------------------------------------
ROGDI_BOVIN     --------------------------------------------------------
AG45_MYCLE      --------------------------------------------------------
DRS1_VANPO      --------------------------------------------------------