[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL64884.1

[Show Plain Result]


## Summary of Sequence Search
    1::222
    5::178     1e-04  29%  253 aa  SOJ_BACSU RecName: Full=Sporulation initiation inhibitor protein
    4::122     2e-04  33%  253 aa  SOJ_TREPA RecName: Full=Protein soj homolog;
    3::39      5e-04  58%  259 aa  GP5D_CHLPS RecName: Full=Virulence plasmid parA family protein
    1::222

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxTVAFTSCKGGAGKTTLAVNVSAALPLNVLLIDLGGGASRFFPAPLINIENITPTIEAYRDARVKN
SOJ_BACSU       ------IAITNQKGGVGKTTTSVNLGACLAYRVLLVDIDGNATSGLGIEKADVEQXXXXXXXXKATTVEN
SOJ_TREPA       -----TLVFVNQKGGVGKTTSAINLGAYLALKTLLVDFGNMSSGLGLARGLTVYDLAHINSVLRTTPVHN
GP5D_CHLPS      -----TLAFCSFKGGTGKTTLSLNIGSNLAKKVLLVDL--------------------------------


                         .         .         *         .         .         .         .:140
query           LFVIPIAIDPASVWRIENWEEIFQNLTDAVRKNIVKNSIDVVVLDMYQLSRITPIETFGLDKADLIVLVV
SOJ_BACSU       LDVIPATIQLAGA-EIELVPTISREVRLKRALEAVKQNYDYIIIDCPPSLGLLTIN--ALTASDSVVIPV
SOJ_TREPA       LFAIPASIDLSGA-TVELVDEQDRELYLKKILAEVKDTYDFILID-------------------------
GP5D_CHLPS      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EGCEDCTKPITIIKKFFDGKLIIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SOJ_BACSU       EGLSQLLNTVRLVQKHLNTDLMI-----------------------------------------------
SOJ_TREPA       ----------------------------------------------------------------------
GP5D_CHLPS      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxx
SOJ_BACSU       ------------
SOJ_TREPA       ------------
GP5D_CHLPS      ------------