[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL64909.1

[Show Plain Result]


## Summary of Sequence Search
    1::270
   76::364     8e-22  35%  376 aa  CI114_HUMAN RecName: Full=Uncharacterized protein C9orf114;
    4::279     9e-21  32%  283 aa  Y1688_HALSA RecName: Full=Uncharacterized protein VNG_1688C;
   77::365     4e-20  33%  385 aa  CI114_MOUSE RecName: Full=Uncharacterized protein C9orf114 homolog;
   69::310     3e-14  36%  378 aa  YMP6_CAEEL RecName: Full=Uncharacterized protein B0361.6;
    4::277     3e-11  27%  281 aa  Y1612_HALMA RecName: Full=Uncharacterized protein rrnAC1612;
   20::134     1e-05  31%  317 aa  YM91_YEAST RecName: Full=Uncharacterized protein YMR310C;
   40::239     4e-04  29%  341 aa  YG5X_YEAST RecName: Full=Uncharacterized protein YGR283C;
    1::270

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xFSIAIPHDFLSEIPDEAGKVRKLGYLARAAAIFKAEYIIIYHYGTPRREDIDFAKTVLEYLVTPPYLRK
CI114_HUMAN     --SVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDVGKKGQACVQLAR-ILQYLECPQYLRK
Y1688_HALSA     --SVLVPSSLVREAEDKREATRKLGYVARAAAVFRIDRVVVFPDEDGERQGGGFVETVLRYAATPPYLRK
CI114_MOUSE     --SVALPGSILDNAQSPELRTYLAGQIARACTIFCVDEIVVFDVGKKGQACVQLAR-ILQYLECPQYLRK
YMP6_CAEEL      --SIAVPGQFLNNAQSAELRTYMAGQIARAATLYRVDEIIIYYNGTTNYEGCFYLAKILEYLECPQYLRK
Y1612_HALMA     --SVLVPSSLXXXXXXXXXXTRKLGXXXXXXXXXXXDRLTVYPDGAGKWED-GFVETVLRYAATPPHLRK
YM91_YEAST      -YSLCIPTTLVSDCRNLSQITHKVYQVAKFASLFNVSEVVILEDNSQTKKKISTAKLILQYFVTPPYLRN
YG5X_YEAST      -YSICIP----TTVIDNCNNLEQVTFIARTAVLFNVQEIIVLDQXXXXXSDCLLLATLLQYFVTPPNLLD


                         .         .         *         .         .         .         .:140
query           KVYKIDNRLKLAGLLPPLKIPSHTVPVEPRIGEIREGIVERWDGYYSLIYIGGGKYAKVPKPYPIGTRLL
CI114_HUMAN     AFFPKHQDLQFAGLLNPLDSPHHMRQDEE--SEFREGIVPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVT
Y1688_HALSA     EAFDTRDELAYAGVLPPLRLXXXXXXXXXXXXXLRQGIVTQ-VGSEGRVRVNCGMQHPISLHEPPGMAVR
CI114_MOUSE     AFFPKHQDLQFAGILNPLDSPHHMRQDEE--SEFREGVVPTKAGHGSLVNCGMKKEVKIDKKLDPGLRVT
YMP6_CAEEL      DLFPIQKPLKNAGLLNPLD-AQHHLKYDEKTLRFREGVVRSKDGRGPICNIGLEKEFEIDSQLPPYTRVT
Y1612_HALMA     EMWGKRDELEYVGVLPPLRVRSQTXXXXXXXXXLRQGIVTE-VGADGRVRVNCGMQHPISLPVPADMDVQ
YM91_YEAST      TVFKFRPYLTAASKLPRLSTLPFTRYQKQDHGRYREGL--------------------------------
YG5X_YEAST      TTFKKKNKLKCASTFPPLQLPFMNASAEQ---HYKEGLSKSDDALTNLVYIGKNQIITLSNQNIPNT---


                         +         .         .         .         .         *         .:210
query           VRIEGTTSRPDTYRAAVYRGAPPDYWGYKIDVRPLQNLSEGFDTVILTGKEGKSICEAKPKIGKKTLVVF
CI114_HUMAN     VRL-NQQQHPDTYHGKVVSSQDPRYWGYTVRLASCLSFQDGYDLTIGTSERGSDVASAQLPNFRHALVVF
Y1688_HALSA     VTIRVSSRRP--VRAKLVDDPLP---GFSVERTGLGDALDRSDVRIATSRHGEPLSVARERIARDVTVAF
CI114_MOUSE     VRLQQQLPECKTYKGTVVSSQDPRYWGYTVRLASCLSFQDGYDLTIGTSERGSDVASAQLPSFRHALVVF
YMP6_CAEEL      VEIKNLTEQCKLYRGSITSGATVTYWGYSVRLMTLQKVAKKFDIVAGVSPRGKLASQMKPKI--------
Y1612_HALMA     GEXXXXXXXXXXXXXAKLVDAPTTGFXXXXXXXXXXXXXXXXGLTIASSRYGEQLAERRDAEGGMT-VAF
YM91_YEAST      ----------------------------------------------------------------------
YG5X_YEAST      ARVTVDTERKEVVSPIAYKGKP---LGYHVRMSTLNEVSEGYTKIV------------------------


                         .         .         .         +         .         .         .:280
query           GGPRKGVDEIFREAGLEPPGELINFAPGQGVETIRTEEAVFIVLSILxxxxxxxxxxxxx
CI114_HUMAN     GGLQAGADADPNLEVAEPSDLYVNTCPGQGSRTIRTEEAILISLAAL-------------
Y1688_HALSA     GAPERGVNESVTDSSADAPARFLNTIPDQGSEVVRTEEAVLATLGSL-------------
CI114_MOUSE     GGLQGLEAAVDADPNLEDPSVLVNTCLSQGSRTIRTEEAILISLAAL-------------
YMP6_CAEEL      ------------------------------------------------------------
Y1612_HALMA     GAPERGLPSILDQTSDEPEGLWLNTVPNQGSEVVRTEEALFASLTCL-------------
YM91_YEAST      ------------------------------------------------------------
YG5X_YEAST      ------------------------------------------------------------