[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL64927.1

[Show Plain Result]


## Summary of Sequence Search
    1::999
   71::234     7e-08  26%  686 aa  AMY1_DICT6 RecName: Full=Alpha-amylase 1;       
    2::246     8e-06  24%  633 aa  AMYA_PYRHO RecName: Full=Alpha-amylase;         EC=3.2.1.1;
   79::284     5e-05  28%  467 aa  AMYA_METJA RecName: Full=Putative alpha-amylase;       
    1::999

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AMY1_DICT6      ----------------------------------------------------------------------
AMYA_PYRHO      ----------------------------------------------------------------------
AMYA_METJA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPRYAVLLGV
AMY1_DICT6      ----------------------------------------------------------------------
AMYA_PYRHO      -------------------------------------------------------------PRINFIFGV
AMYA_METJA      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RNDAFNKCPPGNMTCVVSRFSDQDFIDLATLFNLLWIDPYIARQNPEIWALRNKTNYTREDLKKVLQIHL
AMY1_DICT6      ----------------------------------------------------------------------
AMYA_PYRHO      HNHQ----PLGNFEWIIKRAYEKPFLETLEEYPNMKVAVHISGVLVE-WLERNRPEY-------------
AMYA_METJA      ---------------------------------------------------------------------L


                         .         .         .         +         .         .         .:280
query           ELIKQVLPVYKKLAEQGRIELVPVPYSHPLMPLLADMGAIYDLKLHVNLSNSLFKRYLGVTPTGVWPPEQ
AMY1_DICT6      ----------KIMAERGQIEFVSGGFYEPILPIIPDKDKVQQIK---KLNKYIYDKF-GQTPKGMWLAER
AMYA_PYRHO      ------IDLLKSLIKKGQVELVVAGFYEPILVAIPEEDRVEQIKL-----SKGWARKMGYEARGLWLTER
AMYA_METJA      EFNDYVLDLFKDLVKTGNVELIAETYHHSLTSL---XXXXXXXXXXXXMHRKMYKEIFGFKAKVFRNTEL


                         .         *         .         .         .         .         +:350
query           AVNDEVLRLFANAGYIWTVTDEDVLKATAPGASHFKLYFVQYGDRKLYVFFRDKTLSDNIGFRYSSLSPE
AMY1_DICT6      VWEPHLVKYIAEAGIEYVVVDDHFFSVGLKEEDLFGYYLMEEQGYKLAVF--------PISMKLRYLIPF
AMYA_PYRHO      VWEPELVKTLREAGIEYVILDDHFMSAGLSKEELFWPYYTENGGEAIVVFPIDEKL------RY--LIPF
AMYA_METJA      IYNNRIAKIAKDLGFIFTEGIEKILGWRSPN------YLYQSPD-GMKILLRNYRLSDDIGFRFSARDWD


                         .         .         .         .         *         .         .:420
query           AALADFVNYLKRVPREKCSVVVIALDGENPWENYPNFGDDFLRVFFQGLAQLEKNGTVKIWKPSDFIKAC
AMY1_DICT6      ADPEETITYLDKFASEDKSKIALLFDDGEKFGLWP---DTYRTVYEEG----------------------
AMYA_PYRHO      RPVNETLEYLHSLADEDESKVAVFHDDGEKFGAWPGYERGWLKEFFDRISSDDK----------------
AMYA_METJA      PLTADYAIWLASTPGE---VINIYMDGEHHWKETGIF--EFLRYLPIEIAKHEHLEVVNVSEVVDRLEPR


                         .         .         +         .         .         .         .:490
query           Gxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AMY1_DICT6      ----------------------------------------------------------------------
AMYA_PYRHO      ----------------------------------------------------------------------
AMYA_METJA      G---------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AMY1_DICT6      ----------------------------------------------------------------------
AMYA_PYRHO      ----------------------------------------------------------------------
AMYA_METJA      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AMY1_DICT6      ----------------------------------------------------------------------
AMYA_PYRHO      ----------------------------------------------------------------------
AMYA_METJA      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AMY1_DICT6      ----------------------------------------------------------------------
AMYA_PYRHO      ----------------------------------------------------------------------
AMYA_METJA      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AMY1_DICT6      ----------------------------------------------------------------------
AMYA_PYRHO      ----------------------------------------------------------------------
AMYA_METJA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AMY1_DICT6      ----------------------------------------------------------------------
AMYA_PYRHO      ----------------------------------------------------------------------
AMYA_METJA      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AMY1_DICT6      ----------------------------------------------------------------------
AMYA_PYRHO      ----------------------------------------------------------------------
AMYA_METJA      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AMY1_DICT6      ----------------------------------------------------------------------
AMYA_PYRHO      ----------------------------------------------------------------------
AMYA_METJA      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxx
AMY1_DICT6      -------------------
AMYA_PYRHO      -------------------
AMYA_METJA      -------------------