[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL64945.1

[Show Plain Result]


## Summary of Sequence Search
    1::181
   17::192     1e-25  43%  202 aa  IORB_PYRAB RecName: Full=Indolepyruvate oxidoreductase subunit
   17::192     2e-24  42%  202 aa  IORB_PYRKO RecName: Full=Indolepyruvate oxidoreductase subunit
   17::192     3e-24  43%  202 aa  IORB_PYRHO RecName: Full=Indolepyruvate oxidoreductase subunit
   16::160     1e-21  43%  201 aa  IORB_ARCFU RecName: Full=Indolepyruvate oxidoreductase subunit
   22::189     1e-17  38%  196 aa  IORB_METTH RecName: Full=Indolepyruvate oxidoreductase subunit
   15::155     4e-05  28%  178 aa  PORC_METJA RecName: Full=Pyruvate synthase subunit porC;       
   29::180     4e-05  30%  189 aa  KORC_METTH RecName: Full=2-oxoglutarate synthase subunit korC;     
  457::572     7e-04  31% 1199 aa  NIFJ_SYNY3 RecName: Full=Putative pyruvate-flavodoxin
    1::181

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxLTLARWIGEAALAEGYDVRIAEVHGMSQRGGSVEVHVRYGKDIYAPIVEEGGADY
IORB_PYRAB      ---------------LTAANLLGWAALRAGYKVRVGEVHGMSQRFGSVIAYVRFGEDVYGAMVPEGKADV
IORB_PYRKO      ---------------LTAANLLGWAALRAGYKVRVGEVHGMSQRFGSVIAYVRFGEDVYGAMVPEGKADV
IORB_PYRHO      ---------------LTAANLLGWAALKAGYKVRVGEVHGMSQRFGSVIAYVRFGDDVYGAMVPEGKADV
IORB_ARCFU      ---------------LTTSGIIARAAMRAGLNVVTAETHGMAQRGGSVEVHVRIG-DVRAPLIPEGGADV
IORB_METTH      ---------------------IGEAAMKKDINVVMSEIHGMAQRGGSVSTEIRIG-EVHGSIIPDGEADL
PORC_METJA      ---------------VTAAQILAKAAFYDGKFCQAFPFFGVERRGAPVMAFTRIDDKKITLRCQIYEPDY
KORC_METTH      ------------------------ASLYDGLYAVQTQSYGPEARGGASRAEVVISDEIDYPKVQS--PDI
NIFJ_SYNY3      -----------------------------------------SKKSGSVTVHLRFGPNPILSTYLISQANF


                         .         .         *         .         .         .         .:140
query           VIALEALEALRAYKYLKRGGELIVNRRVIQPPGNWLEEEEVFKAILTSGLKSYIVPCFDIAIELGSPLYE
IORB_PYRAB      ILSFEPVEALRYINYLKKGGLVFTNARPIPPVASYPSMEEIRKIVEEDGGKFLAFDAEKLAIEAGNVITT
IORB_PYRKO      ILSFEPVEALRYINYLKKGGLVFTNARPIPPVATYPTLDEMKKIVEEDGGKFMAFDAEKLAMEAGNIVTT
IORB_PYRHO      ILSFEPVEALRYINYLKKGGLVFTNARPIPPVATYPSLEEIKRIVEEEFNGKFL--AFDLAIEAGNVITT
IORB_ARCFU      MIALEPAEALRYAKFLNKNTLVILNTRKIIPPAKYPELDEIIGELRKVTPRVIPVNASEIAEKAGSVLAT
IORB_METTH      VLAFEPLEAIRALPKMSEESEVILNTSVIPPPHPYPPLDEIMSTLEERAGSVRGFNAEEIALKAGHILSL
PORC_METJA      VIVQDALESVNVVEGLKKDGAVVIN---------------TVKDDLDLGYKTYTIDATGIALDLGVPIV-
KORC_METTH      LVAMSHQALLTYMDDLKRGGALIVDPDMV-------VEAEIEDFIRAREVKYFRAPATRTAEEVGITIVA
NIFJ_SYNY3      VACWEFLEQFEVLEPAVDGGVFLVNSPY-GPEEIWREPRKVQQEIIDKNLKVYTINANDVARDAGMGRRT


                         +         .         .         .         .         *         .:210
query           NAVMLGFFSQLAGLPMPPSLDERNREAFRRGxxxxxxxxxx
IORB_PYRAB      NVVLIGALTQTPGFPLPPKAVDVNMRAFELG----------
IORB_PYRKO      NVVLIGALSQTPGFPLPPKTIDVNMRAFELG----------
IORB_PYRHO      NVVLIGALTQTPGFPLPPKAVDVNMKAFDLG----------
IORB_ARCFU      NVVVVGMLFGYYSMP--------------------------
IORB_METTH      NMVMLGAAAATPGFPLPSRLIDVNLRAFRDG----------
PORC_METJA      NTAMVGAFAGVTGIVSIESVKKAILDTFK------------
KORC_METTH      NMVMIGALTEATGISVPPGTEEKNLMAFQAG----------
NIFJ_SYNY3      NTVMQTCFFALAGV---------------------------