[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL64946.1

[Show Plain Result]


## Summary of Sequence Search
    1::390
  230::289     1e-47  48%  648 aa  IORA_PYRAB RecName: Full=Indolepyruvate oxidoreductase subunit
  244::619     4e-47  35%  623 aa  IORA_ARCFU RecName: Full=Indolepyruvate oxidoreductase subunit
  390::642     5e-47  46%  647 aa  IORA_PYRKO RecName: Full=Indolepyruvate oxidoreductase subunit
  230::289     1e-42  46%  648 aa  IORA_PYRHO RecName: Full=Indolepyruvate oxidoreductase subunit
  220::617     5e-39  32%  618 aa  IORA_METTH RecName: Full=Indolepyruvate oxidoreductase subunit
  121::181     3e-10  43%  250 aa  Y514_METJA RecName: Full=Uncharacterized polyferredoxin-like
  271::352     4e-10  47%  355 aa  FWDF_METJA RecName: Full=Polyferredoxin protein fwdF;
   30::198     1e-09  36%  412 aa  MVHB_METFE RecName: Full=Polyferredoxin protein mvhB;
    4::58      6e-08  42%   58 aa  FER_METTE RecName: Full=Probable ferredoxin;
  194::264     1e-07  30%  412 aa  MVHB_METTH RecName: Full=Polyferredoxin protein mvhB;
   73::146     1e-07  38%  501 aa  Y1303_METJA RecName: Full=Uncharacterized polyferredoxin-like
   48::97      2e-07  42%  105 aa  VORD_PYRFU RecName: Full=Ketoisovalerate oxidoreductase subunit
  483::547     3e-07  43%  620 aa  Y870_METJA RecName: Full=Uncharacterized protein MJ0870;
   48::97      5e-07  40%  105 aa  VORD_PYRAB RecName: Full=Ketoisovalerate oxidoreductase subunit
  142::191     5e-07  42%  394 aa  VHUB_METJA RecName: Full=Polyferredoxin protein vhuB;
   48::97      6e-07  40%  105 aa  VORD_PYRHO RecName: Full=Ketoisovalerate oxidoreductase subunit
  575::625     6e-07  43%  793 aa  HDRA_METMA RecName: Full=CoB--CoM heterodisulfide reductase 1
  575::625     2e-06  41%  793 aa  HDRA_METAC RecName: Full=CoB--CoM heterodisulfide reductase 1
  119::182     2e-06  33%  398 aa  VHUB_METVO RecName: Full=Polyferredoxin protein vhuB;
  580::635     2e-06  45%  656 aa  HDRA2_METKA RecName: Full=CoB--CoM heterodisulfide reductase
   46::99      3e-06  43%  105 aa  PORD_PYRAB RecName: Full=Pyruvate synthase subunit porD;AltName:
    4::99      4e-06  35%  153 aa  Y264_METJA RecName: Full=Uncharacterized protein MJ0264;
  108::171     4e-06  34%  183 aa  RNFB_AZOSB RecName: Full=Electron transport complex protein
    7::56      4e-06  38%   59 aa  FER2_DESNO RecName: Full=Ferredoxin-2;AltName: Full=Ferredoxin II;
   43::113     5e-06  41%  181 aa  NUOI_MYCA1 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   43::113     5e-06  41%  181 aa  NUOI2_MYCPA RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
    6::55      5e-06  40%   55 aa  FER_CLOST RecName: Full=Ferredoxin;
  107::171     7e-06  34%  183 aa  RNFB_AZOSE RecName: Full=Electron transport complex protein rnfB;
   42::89      7e-06  38%   95 aa  PORD_METBF RecName: Full=Pyruvate synthase subunit porD;AltName:
   43::113     7e-06  41%  181 aa  NUOI_MYCUA RecName: Full=NADH-quinone oxidoreductase subunit I;    
   70::140     7e-06  41%  211 aa  NUOI_MYCTU RecName: Full=NADH-quinone oxidoreductase subunit I;    
   70::140     7e-06  41%  211 aa  NUOI_MYCTA RecName: Full=NADH-quinone oxidoreductase subunit I;    
   43::113     7e-06  41%  174 aa  NUOI_MYCSS RecName: Full=NADH-quinone oxidoreductase subunit I;    
   43::113     7e-06  41%  174 aa  NUOI_MYCSK RecName: Full=NADH-quinone oxidoreductase subunit I;    
   43::113     7e-06  41%  174 aa  NUOI_MYCSJ RecName: Full=NADH-quinone oxidoreductase subunit I;    
   43::113     7e-06  41%  180 aa  NUOI_MYCS2 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   43::113     7e-06  41%  181 aa  NUOI_MYCMM RecName: Full=NADH-quinone oxidoreductase subunit I;    
   70::140     7e-06  41%  211 aa  NUOI_MYCBT RecName: Full=NADH-quinone oxidoreductase subunit I;    
   70::140     7e-06  41%  211 aa  NUOI_MYCBP RecName: Full=NADH-quinone oxidoreductase subunit I;    
   70::140     7e-06  41%  211 aa  NUOI_MYCBO RecName: Full=NADH-quinone oxidoreductase subunit I;    
  338::389     1e-05  39%  411 aa  YEIA_ECOLI RecName: Full=Uncharacterized protein yeiA;
    6::53      1e-05  46%   58 aa  FER6_METJA RecName: Full=Uncharacterized ferredoxin MJ0624;
   78::128     1e-05  35%  131 aa  FER2_METJA RecName: Full=Uncharacterized ferredoxin MJ0099;
  148::268     2e-05  28%  354 aa  ODPA_ZYMMO RecName: Full=Pyruvate dehydrogenase E1 component
   92::160     2e-05  37%  211 aa  NUOI_SULDN RecName: Full=NADH-quinone oxidoreductase subunit I;    
   43::113     2e-05  39%  195 aa  NUOI_RHOE4 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   54::118     2e-05  36%  164 aa  NUOI_MAGSM RecName: Full=NADH-quinone oxidoreductase subunit I;    
   81::132     2e-05  44%  220 aa  NUOI_HELPY RecName: Full=NADH-quinone oxidoreductase subunit I;    
   81::132     2e-05  44%  220 aa  NUOI_HELPS RecName: Full=NADH-quinone oxidoreductase subunit I;    
   81::132     2e-05  44%  220 aa  NUOI_HELPJ RecName: Full=NADH-quinone oxidoreductase subunit I;    
   81::132     2e-05  44%  220 aa  NUOI_HELPH RecName: Full=NADH-quinone oxidoreductase subunit I;    
   81::132     2e-05  44%  220 aa  NUOI_HELPG RecName: Full=NADH-quinone oxidoreductase subunit I;    
   81::132     2e-05  44%  220 aa  NUOI_HELP2 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   81::132     2e-05  44%  220 aa  NUOI_HELAH RecName: Full=NADH-quinone oxidoreductase subunit I;    
   16::66      2e-05  43%   78 aa  FER_ALIAC RecName: Full=Ferredoxin;
   53::101     2e-05  44%  166 aa  Y1043_HAEIN RecName: Full=Uncharacterized protein HI1043;
   46::99      2e-05  41%  105 aa  PORD_PYRHO RecName: Full=Pyruvate synthase subunit porD;AltName:
   45::99      2e-05  38%  105 aa  PORD_PYRFU RecName: Full=Pyruvate synthase subunit porD;AltName:
  133::266     2e-05  25%  367 aa  ODBA_THET8 RecName: Full=2-oxoisovalerate dehydrogenase subunit
  133::266     2e-05  26%  367 aa  ODBA_THET2 RecName: Full=2-oxoisovalerate dehydrogenase subunit
   43::113     2e-05  39%  188 aa  NUOI_RHOSR RecName: Full=NADH-quinone oxidoreductase subunit I;    
   43::113     2e-05  39%  188 aa  NUOI_RHOOB RecName: Full=NADH-quinone oxidoreductase subunit I;    
   43::113     2e-05  39%  174 aa  NUOI_MYCVP RecName: Full=NADH-quinone oxidoreductase subunit I;    
   43::113     2e-05  39%  175 aa  NUOI_MYCGI RecName: Full=NADH-quinone oxidoreductase subunit I;    
   59::103     2e-05  40%  205 aa  HYFA_ECOLI RecName: Full=Hydrogenase-4 component A;       
  138::204     2e-05  41%  984 aa  FDHL_STAS1 RecName: Full=Putative formate dehydrogenase SSP0601;   
   38::112     3e-05  35%  132 aa  NUOI1_GEOSL RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
  454::524     3e-05  39%  597 aa  NUOHI_NOCFA RecName: Full=NADH-quinone oxidoreductase subunits H/I;
    6::54      3e-05  39%   55 aa  FER_BUTME RecName: Full=Ferredoxin;
   70::123     3e-05  43%  276 aa  Y578_METJA RecName: Full=Uncharacterized protein MJ0578;
   92::155     3e-05  35%  370 aa  HMC2_DESVH RecName: Full=Protein DVU_0535;AltName: Full=HMC operon
  587::634     3e-05  42%  659 aa  HDRA_METTM RecName: Full=CoB--CoM heterodisulfide reductase
  588::635     3e-05  42%  659 aa  HDRA_METTH RecName: Full=CoB--CoM heterodisulfide reductase
   55::151     4e-05  33%  193 aa  RNFB_HAEIN RecName: Full=Electron transport complex protein rnfB;
   55::151     4e-05  33%  193 aa  RNFB_HAEIE RecName: Full=Electron transport complex protein rnfB;
   55::151     4e-05  33%  193 aa  RNFB_HAEI8 RecName: Full=Electron transport complex protein rnfB;
  113::164     4e-05  35%  168 aa  RNFB_BUCAP RecName: Full=Electron transport complex protein rnfB;
    5::117     4e-05  29%  157 aa  NUOI_PARUW RecName: Full=NADH-quinone oxidoreductase subunit I;    
  144::210     4e-05  44%  980 aa  FDHL_BACSU RecName: Full=Putative formate dehydrogenase yrhE;      
  139::210     6e-05  37%  985 aa  YJGC_BACSU RecName: Full=Probable oxidoreductase yjgC;       
   42::86      6e-05  40%  209 aa  Y934_METJA RecName: Full=Uncharacterized polyferredoxin-like
   83::145     6e-05  41%  205 aa  NUOI_WOLSU RecName: Full=NADH-quinone oxidoreductase subunit I;    
   50::113     6e-05  35%  159 aa  NUOI_RICCK RecName: Full=NADH-quinone oxidoreductase subunit I;    
   67::121     6e-05  39%  188 aa  NUOI2_RHIME RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
   67::121     6e-05  39%  188 aa  NUOI2_RHIEC RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
    3::59      6e-05  39%   61 aa  FER3_DESAF RecName: Full=Ferredoxin-3;AltName: Full=Ferredoxin III;
  936::985     6e-05  40% 1009 aa  DPYD_DICDI RecName: Full=Dihydropyrimidine dehydrogenase [NADP+];  
   49::119     8e-05  39%  211 aa  NUOI1_STRCO RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
   51::121     8e-05  39%  200 aa  NUOI1_STRAW RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
  178::231     8e-05  31%  243 aa  FRHG_METVO RecName: Full=Coenzyme F420 hydrogenase subunit gamma;  
    6::55      8e-05  38%   55 aa  FER_CLOTS RecName: Full=Ferredoxin;
    7::60      8e-05  42%   62 aa  FER1_DESVM RecName: Full=Ferredoxin-1;AltName: Full=Ferredoxin I;  
   45::69      1e-04  56%  593 aa  YOX6_SCHPO RecName: Full=Uncharacterized ABC transporter
   53::116     1e-04  35%  162 aa  NUOI_MAGSA RecName: Full=NADH-quinone oxidoreductase subunit I;    
    6::51      1e-04  39%   55 aa  FER_CLOBU RecName: Full=Ferredoxin;
  110::162     1e-04  30%  169 aa  RNFB_BUCBP RecName: Full=Electron transport complex protein rnfB;
   50::113     1e-04  33%  159 aa  NUOI_RICAH RecName: Full=NADH-quinone oxidoreductase subunit I;    
   43::113     1e-04  38%  175 aa  NUOI1_MYCPA RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
   53::116     1e-04  35%  162 aa  NDUS8_RECAM RecName: Full=NADH-ubiquinone oxidoreductase subunit 8;
    8::51      1e-04  41%   55 aa  FER_CLOAC RecName: Full=Ferredoxin;
  186::246     2e-04  41%  246 aa  Y749_METJA RecName: Full=Uncharacterized protein MJ0749;
  664::795     2e-04  32% 1934 aa  PNO_CRYPV RecName: Full=Pyruvate dehydrogenase [NADP+];       
   29::80      2e-04  39%  421 aa  PHFL_DESVH RecName: Full=Periplasmic [Fe] hydrogenase large
   50::113     2e-04  33%  159 aa  NUOI_RICRS RecName: Full=NADH-quinone oxidoreductase subunit I;    
   50::113     2e-04  33%  159 aa  NUOI_RICRO RecName: Full=NADH-quinone oxidoreductase subunit I;    
   50::113     2e-04  33%  159 aa  NUOI_RICPU RecName: Full=NADH-quinone oxidoreductase subunit I;    
   50::113     2e-04  33%  159 aa  NUOI_RICCN RecName: Full=NADH-quinone oxidoreductase subunit I;    
   50::113     2e-04  33%  159 aa  NUOI_RICBR RecName: Full=NADH-quinone oxidoreductase subunit I;    
   50::113     2e-04  33%  159 aa  NUOI_RICB8 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   50::113     2e-04  33%  159 aa  NUOI_RICAE RecName: Full=NADH-quinone oxidoreductase subunit I;    
    7::59      2e-04  32%   59 aa  FER_ENTHI RecName: Full=Ferredoxin;
  119::171     2e-04  38%  408 aa  Y51B_METJA RecName: Full=Uncharacterized polyferredoxin-like
  237::319     2e-04  35%  397 aa  PPD_STRVR RecName: Full=Phosphonopyruvate decarboxylase;       
   29::80      2e-04  40%  421 aa  PHFL_DESVO RecName: Full=Periplasmic [Fe] hydrogenase large
   21::123     2e-04  30%  169 aa  NUOI_WOLPM RecName: Full=NADH-quinone oxidoreductase subunit I;    
   50::113     2e-04  33%  159 aa  NUOI_RICPR RecName: Full=NADH-quinone oxidoreductase subunit I;    
   50::113     2e-04  33%  159 aa  NUOI_RICFE RecName: Full=NADH-quinone oxidoreductase subunit I;    
   38::112     2e-04  33%  131 aa  NUOI2_GEOMG RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
  676::779     2e-04  41% 1173 aa  NIFJ_ENTAG RecName: Full=Pyruvate-flavodoxin oxidoreductase;       
  103::166     2e-04  36%  212 aa  NDUS8_CAEEL RecName: Full=Probable NADH dehydrogenase [ubiquinone]
   54::97      2e-04  39%  166 aa  FER9_METJA RecName: Full=Uncharacterized ferredoxin MJ0265;
   16::90      2e-04  44%   97 aa  FER3_ANASP RecName: Full=Ferredoxin-3;AltName: Full=Ferredoxin III;
  168::228     2e-04  34%  337 aa  ASRC_SALTY RecName: Full=Anaerobic sulfite reductase subunit C;    
  168::228     2e-04  34%  337 aa  ASRC_SALTI RecName: Full=Anaerobic sulfite reductase subunit C;    
  142::207     3e-04  39%  246 aa  Y208_METJA RecName: Full=Uncharacterized protein MJ0208;
  112::158     3e-04  34%  192 aa  RNFB_SHISS RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_SHIDS RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_SHIB3 RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_SALTY RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_SALTI RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_SALSV RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_SALPK RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_SALPC RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_SALPB RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_SALPA RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_SALNS RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_SALHS RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_SALG2 RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_SALEP RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_SALDC RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_SALCH RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_SALA4 RecName: Full=Electron transport complex protein rnfB;
  112::169     3e-04  34%  187 aa  RNFB_RHOCA RecName: Full=Electron transport complex protein
  112::158     3e-04  34%  192 aa  RNFB_ESCF3 RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_ECOUT RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_ECOSM RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_ECOSE RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_ECOLU RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_ECOLI RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_ECOLC RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_ECOL6 RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_ECOL5 RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_ECOK1 RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_ECOHS RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_ECODH RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_ECOBW RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_ECO8A RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_ECO81 RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_ECO7I RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_ECO5E RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_ECO57 RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_ECO55 RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_ECO45 RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_ECO27 RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_ECO24 RecName: Full=Electron transport complex protein rnfB;
  112::158     3e-04  34%  192 aa  RNFB_CITK8 RecName: Full=Electron transport complex protein rnfB;
  108::167     3e-04  33%  167 aa  RNFB_BUCAT RecName: Full=Electron transport complex protein rnfB;
  108::167     3e-04  33%  167 aa  RNFB_BUCAI RecName: Full=Electron transport complex protein rnfB;
  108::167     3e-04  33%  167 aa  RNFB_BUCA5 RecName: Full=Electron transport complex protein rnfB;
   50::81      3e-04  47%   81 aa  PORD_METTH RecName: Full=Pyruvate synthase subunit porD;AltName:
   29::78      3e-04  36%   86 aa  PORD_METJA RecName: Full=Pyruvate synthase subunit porD;AltName:
   43::113     3e-04  38%  183 aa  NUOI_THEFY RecName: Full=NADH-quinone oxidoreductase subunit I;    
   50::113     3e-04  33%  159 aa  NUOI_RICTY RecName: Full=NADH-quinone oxidoreductase subunit I;    
   84::135     3e-04  40%  212 aa  NUOI_HELHP RecName: Full=NADH-quinone oxidoreductase subunit I;    
   42::112     3e-04  38%  211 aa  NUOI_FRASN RecName: Full=NADH-quinone oxidoreductase subunit I;    
   42::112     3e-04  38%  217 aa  NUOI_FRASC RecName: Full=NADH-quinone oxidoreductase subunit I;    
   43::112     3e-04  36%  182 aa  NQO9_THET8 RecName: Full=NADH-quinone oxidoreductase subunit 9;    
   43::112     3e-04  36%  182 aa  NQO9_THET2 RecName: Full=NADH-quinone oxidoreductase subunit 9;    
    7::59      3e-04  38%   77 aa  FER7_METJA RecName: Full=Uncharacterized ferredoxin MJ0722;
   35::70      3e-04  42%  113 aa  FER1_CAUCR RecName: Full=Ferredoxin-1;AltName: Full=Ferredoxin I;  
  138::204     3e-04  37%  984 aa  FDHL_STAAW RecName: Full=Putative formate dehydrogenase MW2229;    
  138::204     3e-04  37%  984 aa  FDHL_STAAS RecName: Full=Putative formate dehydrogenase SAS2201;   
  138::204     3e-04  39%  984 aa  FDHL_STAAR RecName: Full=Putative formate dehydrogenase SAR2393;   
  138::204     3e-04  37%  984 aa  FDHL_STAAN RecName: Full=Putative formate dehydrogenase SA2102;    
  138::204     3e-04  37%  984 aa  FDHL_STAAM RecName: Full=Putative formate dehydrogenase SAV2309;   
  138::204     3e-04  37%  984 aa  FDHL_STAAC RecName: Full=Putative formate dehydrogenase SACOL2301; 
  138::204     3e-04  37%  984 aa  FDHL_STAAB RecName: Full=Putative formate dehydrogenase SAB2186c;  
  138::204     3e-04  37%  984 aa  FDHL_STAA8 RecName: Full=Putative formate dehydrogenase
  138::204     3e-04  37%  984 aa  FDHL_STAA3 RecName: Full=Putative formate dehydrogenase
  112::158     4e-04  34%  192 aa  RNFB_SALAR RecName: Full=Electron transport complex protein rnfB;
  237::319     4e-04  32%  401 aa  PPD_STRHY RecName: Full=Phosphonopyruvate decarboxylase;       
  144::261     4e-04  25%  348 aa  ODPA_RHIME RecName: Full=Pyruvate dehydrogenase E1 component
   12::114     4e-04  27%  160 aa  NUOI_WOLTR RecName: Full=NADH-quinone oxidoreductase subunit I;    
   42::109     4e-04  38%  188 aa  NUOI_SACEN RecName: Full=NADH-quinone oxidoreductase subunit I;    
   41::111     4e-04  38%  198 aa  NUOI_PROAC RecName: Full=NADH-quinone oxidoreductase subunit I;    
   52::115     4e-04  35%  161 aa  NUOI_ORITI RecName: Full=NADH-quinone oxidoreductase subunit I;    
   52::115     4e-04  35%  161 aa  NUOI_ORITB RecName: Full=NADH-quinone oxidoreductase subunit I;    
   43::133     4e-04  32%  213 aa  NUOI_CAMJR RecName: Full=NADH-quinone oxidoreductase subunit I;    
   43::133     4e-04  32%  213 aa  NUOI_CAMJJ RecName: Full=NADH-quinone oxidoreductase subunit I;    
   43::133     4e-04  32%  213 aa  NUOI_CAMJE RecName: Full=NADH-quinone oxidoreductase subunit I;    
   43::133     4e-04  32%  213 aa  NUOI_CAMJD RecName: Full=NADH-quinone oxidoreductase subunit I;    
   43::133     4e-04  32%  213 aa  NUOI_CAMJ8 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   95::114     4e-04  70%  197 aa  NUOI2_STRCO RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
  420::527     4e-04  40%  590 aa  ILVB_PORUM RecName: Full=Acetolactate synthase large subunit;      
  420::527     4e-04  40%  590 aa  ILVB_PORPU RecName: Full=Acetolactate synthase large subunit;      
    7::103     4e-04  32%  180 aa  HYCF_ECOLI RecName: Full=Formate hydrogenlyase subunit 6;       
  126::164     4e-04  36%  269 aa  HMEA_ARCFU RecName: Full=Hdr-like menaquinol oxidoreductase
    6::52      4e-04  36%   56 aa  FER_CLOPE RecName: Full=Ferredoxin;
    7::52      4e-04  37%   56 aa  FER_CLOPA RecName: Full=Ferredoxin;
    3::57      5e-04  35%   75 aa  YCXI_PORPU RecName: Full=Uncharacterized protein in rpl9-rpl11
  112::158     5e-04  34%  192 aa  RNFB_SHIFL RecName: Full=Electron transport complex protein rnfB;
  112::158     5e-04  34%  192 aa  RNFB_SHIBS RecName: Full=Electron transport complex protein rnfB;
   42::109     5e-04  27%  192 aa  PHSB_SALTY RecName: Full=Thiosulfate reductase electron transport
   42::109     5e-04  27%  192 aa  PHSB_SALTI RecName: Full=Thiosulfate reductase electron transport
   50::104     5e-04  41%  140 aa  NUOI_CARHZ RecName: Full=NADH-quinone oxidoreductase subunit I;    
   55::118     5e-04  31%  164 aa  NUOI_ANAPZ RecName: Full=NADH-quinone oxidoreductase subunit I;    
    3::56      5e-04  33%   56 aa  FERA_METJA RecName: Full=Uncharacterized ferredoxin MJ0533;
    5::28      5e-04  54%   65 aa  FDXN_RHOCA RecName: Full=Ferredoxin-1;AltName: Full=Ferredoxin I;  
   46::71      5e-04  46%  603 aa  AB1E_ARATH RecName: Full=ABC transporter E family member 1;        
   37::125     6e-04  35%  157 aa  VHCB_METVO RecName: Full=Polyferredoxin protein vhcB;
  164::217     6e-04  35%  264 aa  RPOD_ARCFU RecName: Full=DNA-directed RNA polymerase subunit D;    
  100::158     6e-04  36%  192 aa  RNFB_PECCP RecName: Full=Electron transport complex protein rnfB;
   68::151     6e-04  29%  181 aa  RNFB_MAGSM RecName: Full=Electron transport complex protein rnfB;
   77::162     6e-04  30%  207 aa  RNFB_HAEDU RecName: Full=Electron transport complex protein rnfB;
   48::71      6e-04  50%  608 aa  RLI1_YEAST RecName: Full=Translation initiation factor
   60::123     6e-04  35%  169 aa  NUOI_EHRCR RecName: Full=NADH-quinone oxidoreductase subunit I;    
   58::121     6e-04  35%  167 aa  NUOI_EHRCJ RecName: Full=NADH-quinone oxidoreductase subunit I;    
   54::117     6e-04  33%  163 aa  NUOI_CAUCR RecName: Full=NADH-quinone oxidoreductase subunit I;    
   81::132     6e-04  42%  200 aa  NUOI_CAMHC RecName: Full=NADH-quinone oxidoreductase subunit I;    
  121::184     6e-04  33%  230 aa  NDUS8_TOBAC RecName: Full=NADH dehydrogenase [ubiquinone]
  120::183     6e-04  33%  229 aa  NDUS8_SOLTU RecName: Full=NADH dehydrogenase [ubiquinone]
  151::218     6e-04  29%  230 aa  FRHG_METJA RecName: Full=Coenzyme F420 hydrogenase subunit gamma;  
    4::63      6e-04  32%  575 aa  FPRB_MYCTU RecName: Full=Probable ferredoxin/ferredoxin--NADP
    4::63      6e-04  32%  575 aa  FPRB_MYCBO RecName: Full=Probable ferredoxin/ferredoxin--NADP
  138::204     6e-04  39%  984 aa  FDHL_STAHJ RecName: Full=Putative formate dehydrogenase SH0748;    
   67::113     8e-04  36%  205 aa  YNFG_ECOLI RecName: Full=Probable anaerobic dimethyl sulfoxide
   67::113     8e-04  36%  205 aa  YNFG_ECOL6 RecName: Full=Probable anaerobic dimethyl sulfoxide
  169::207     8e-04  44%  216 aa  Y726_METJA RecName: Full=Uncharacterized protein MJ0726;
  113::161     8e-04  31%  185 aa  RNFB_TOLAT RecName: Full=Electron transport complex protein rnfB;
  110::156     8e-04  32%  198 aa  RNFB_PASMU RecName: Full=Electron transport complex protein rnfB;
   50::113     8e-04  31%  159 aa  NUOI_RICM5 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   54::117     8e-04  35%  163 aa  NUOI_RALEH RecName: Full=NADH-quinone oxidoreductase subunit I;    
   53::127     8e-04  38%  196 aa  NUOI_NOCSJ RecName: Full=NADH-quinone oxidoreductase subunit I;    
   54::117     8e-04  35%  163 aa  NUOI_CUPTR RecName: Full=NADH-quinone oxidoreductase subunit I;    
   43::113     8e-04  35%  178 aa  NUOI2_SYNFM RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
   95::114     8e-04  65%  216 aa  NUOI2_STRAW RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
   27::113     8e-04  36%  149 aa  NUOI1_SYNFM RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
  101::164     8e-04  33%  210 aa  NDUS8_PONAB RecName: Full=NADH dehydrogenase [ubiquinone]
  101::164     8e-04  33%  210 aa  NDUS8_PANTR RecName: Full=NADH dehydrogenase [ubiquinone]
  103::166     8e-04  33%  212 aa  NDUS8_MOUSE RecName: Full=NADH dehydrogenase [ubiquinone]
  101::164     8e-04  33%  210 aa  NDUS8_HUMAN RecName: Full=NADH dehydrogenase [ubiquinone]
  101::164     8e-04  33%  210 aa  NDUS8_GORGO RecName: Full=NADH dehydrogenase [ubiquinone]
  113::176     8e-04  33%  222 aa  NDUS8_ARATH RecName: Full=NADH dehydrogenase [ubiquinone]
  221::277     8e-04  35%  287 aa  NAPH_HAEIN RecName: Full=Ferredoxin-type protein napH homolog;
  237::260     8e-04  62%  669 aa  HDRA1_METKA RecName: Full=CoB--CoM heterodisulfide reductase
   12::82      8e-04  42%   82 aa  FWDG_METJA RecName: Full=Polyferredoxin protein fwdG;
    9::60      8e-04  36%  555 aa  FPRB_MYCLE RecName: Full=Probable ferredoxin/ferredoxin--NADP
   17::58      8e-04  36%   79 aa  FER_THET8 RecName: Full=Ferredoxin;
    5::60      8e-04  33%   62 aa  FER4_METJA RecName: Full=Uncharacterized ferredoxin MJ0199;
  947::996     8e-04  40% 1022 aa  DPYD_DANRE RecName: Full=Dihydropyrimidine dehydrogenase [NADP+];  
   48::71      8e-04  50%  605 aa  AB2E_ARATH RecName: Full=ABC transporter E family member 2;        
    1::390

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDKWRELEKLSSDFLQIEGSGDVVIVTSGVAYNYVKEAVRRLNIRATVVKLGISVPVPPKVREIARXXXX
IORA_PYRAB      IEKFRE-EFNNSPFNWIEGPEDVGIIAPGLSYAYVKEALAWLGVNVKVLKLGTPFPVP------------
IORA_ARCFU      -----------------EGDGDVGIIACGLSYAYTKEALENLNLNLPVLKLSSMHPLPERLIEVSQMKKV
IORA_PYRKO      ----------------------------------------------------------------------
IORA_PYRHO      IEKFRE-EFNTSPFNWIEGPEDVGIIAPGLSYAYVKEALAWLGINVKILKLGTPFPVP------------
IORA_METTH      VDKMKEL-RIRADESELNSDSELGVVASGGAFNYVYDALESLGLELPVLKLGFTYPFPAGLVEEFLSGLK
Y514_METJA      ----------------------------------------------------------------------
FWDF_METJA      ----------------------------------------------------------------------
MVHB_METFE      ----------------------------------------------------------------------
FER_METTE       ----------------------------------------------------------------------
MVHB_METTH      ----------------------------------------------------------------------
Y1303_METJA     ----------------------------------------------------------------------
VORD_PYRFU      ----------------------------------------------------------------------
Y870_METJA      ----------------------------------------------------------------------
VORD_PYRAB      ----------------------------------------------------------------------
VHUB_METJA      ----------------------------------------------------------------------
VORD_PYRHO      ----------------------------------------------------------------------
HDRA_METMA      ----------------------------------------------------------------------
HDRA_METAC      ----------------------------------------------------------------------
VHUB_METVO      ----------------------------------------------------------------------
HDRA2_METKA     ----------------------------------------------------------------------
PORD_PYRAB      ----------------------------------------------------------------------
Y264_METJA      ----------------------------------------------------------------------
RNFB_AZOSB      ----------------------------------------------------------------------
FER2_DESNO      ----------------------------------------------------------------------
NUOI_MYCA1      ----------------------------------------------------------------------
NUOI2_MYCPA     ----------------------------------------------------------------------
FER_CLOST       ----------------------------------------------------------------------
RNFB_AZOSE      ----------------------------------------------------------------------
PORD_METBF      ----------------------------------------------------------------------
NUOI_MYCUA      ----------------------------------------------------------------------
NUOI_MYCTU      ----------------------------------------------------------------------
NUOI_MYCTA      ----------------------------------------------------------------------
NUOI_MYCSS      ----------------------------------------------------------------------
NUOI_MYCSK      ----------------------------------------------------------------------
NUOI_MYCSJ      ----------------------------------------------------------------------
NUOI_MYCS2      ----------------------------------------------------------------------
NUOI_MYCMM      ----------------------------------------------------------------------
NUOI_MYCBT      ----------------------------------------------------------------------
NUOI_MYCBP      ----------------------------------------------------------------------
NUOI_MYCBO      ----------------------------------------------------------------------
YEIA_ECOLI      ----------------------------------------------------------------------
FER6_METJA      ----------------------------------------------------------------------
FER2_METJA      ----------------------------------------------------------------------
ODPA_ZYMMO      ----------------------------------------------------------------------
NUOI_SULDN      ----------------------------------------------------------------------
NUOI_RHOE4      ----------------------------------------------------------------------
NUOI_MAGSM      ----------------------------------------------------------------------
NUOI_HELPY      ----------------------------------------------------------------------
NUOI_HELPS      ----------------------------------------------------------------------
NUOI_HELPJ      ----------------------------------------------------------------------
NUOI_HELPH      ----------------------------------------------------------------------
NUOI_HELPG      ----------------------------------------------------------------------
NUOI_HELP2      ----------------------------------------------------------------------
NUOI_HELAH      ----------------------------------------------------------------------
FER_ALIAC       ----------------------------------------------------------------------
Y1043_HAEIN     ----------------------------------------------------------------------
PORD_PYRHO      ----------------------------------------------------------------------
PORD_PYRFU      ----------------------------------------------------------------------
ODBA_THET8      ----------------------------------------------------------------------
ODBA_THET2      ----------------------------------------------------------------------
NUOI_RHOSR      ----------------------------------------------------------------------
NUOI_RHOOB      ----------------------------------------------------------------------
NUOI_MYCVP      ----------------------------------------------------------------------
NUOI_MYCGI      ----------------------------------------------------------------------
HYFA_ECOLI      ----------------------------------------------------------------------
FDHL_STAS1      ----------------------------------------------------------------------
NUOI1_GEOSL     ----------------------------------------------------------------------
NUOHI_NOCFA     ----------------------------------------------------------------------
FER_BUTME       ----------------------------------------------------------------------
Y578_METJA      ----------------------------------------------------------------------
HMC2_DESVH      ----------------------------------------------------------------------
HDRA_METTM      ----------------------------------------------------------------------
HDRA_METTH      ----------------------------------------------------------------------
RNFB_HAEIN      ----------------------------------------------------------------------
RNFB_HAEIE      ----------------------------------------------------------------------
RNFB_HAEI8      ----------------------------------------------------------------------
RNFB_BUCAP      ----------------------------------------------------------------------
NUOI_PARUW      ----------------------------------------------------------------------
FDHL_BACSU      ----------------------------------------------------------------------
YJGC_BACSU      ----------------------------------------------------------------------
Y934_METJA      ----------------------------------------------------------------------
NUOI_WOLSU      ----------------------------------------------------------------------
NUOI_RICCK      ----------------------------------------------------------------------
NUOI2_RHIME     ----------------------------------------------------------------------
NUOI2_RHIEC     ----------------------------------------------------------------------
FER3_DESAF      ----------------------------------------------------------------------
DPYD_DICDI      ----------------------------------------------------------------------
NUOI1_STRCO     ----------------------------------------------------------------------
NUOI1_STRAW     ----------------------------------------------------------------------
FRHG_METVO      ----------------------------------------------------------------------
FER_CLOTS       ----------------------------------------------------------------------
FER1_DESVM      ----------------------------------------------------------------------
YOX6_SCHPO      ----------------------------------------------------------------------
NUOI_MAGSA      ----------------------------------------------------------------------
FER_CLOBU       ----------------------------------------------------------------------
RNFB_BUCBP      ----------------------------------------------------------------------
NUOI_RICAH      ----------------------------------------------------------------------
NUOI1_MYCPA     ----------------------------------------------------------------------
NDUS8_RECAM     ----------------------------------------------------------------------
FER_CLOAC       ----------------------------------------------------------------------
Y749_METJA      ----------------------------------------------------------------------
PNO_CRYPV       ----------------------------------------------------------------------
PHFL_DESVH      ----------------------------------------------------------------------
NUOI_RICRS      ----------------------------------------------------------------------
NUOI_RICRO      ----------------------------------------------------------------------
NUOI_RICPU      ----------------------------------------------------------------------
NUOI_RICCN      ----------------------------------------------------------------------
NUOI_RICBR      ----------------------------------------------------------------------
NUOI_RICB8      ----------------------------------------------------------------------
NUOI_RICAE      ----------------------------------------------------------------------
FER_ENTHI       ----------------------------------------------------------------------
Y51B_METJA      ----------------------------------------------------------------------
PPD_STRVR       ----------------------------------------------------------------------
PHFL_DESVO      ----------------------------------------------------------------------
NUOI_WOLPM      ----------------------------------------------------------------------
NUOI_RICPR      ----------------------------------------------------------------------
NUOI_RICFE      ----------------------------------------------------------------------
NUOI2_GEOMG     ----------------------------------------------------------------------
NIFJ_ENTAG      ----------------------------------------------------------------------
NDUS8_CAEEL     ----------------------------------------------------------------------
FER9_METJA      ----------------------------------------------------------------------
FER3_ANASP      ----------------------------------------------------------------------
ASRC_SALTY      ----------------------------------------------------------------------
ASRC_SALTI      ----------------------------------------------------------------------
Y208_METJA      ----------------------------------------------------------------------
RNFB_SHISS      ----------------------------------------------------------------------
RNFB_SHIDS      ----------------------------------------------------------------------
RNFB_SHIB3      ----------------------------------------------------------------------
RNFB_SALTY      ----------------------------------------------------------------------
RNFB_SALTI      ----------------------------------------------------------------------
RNFB_SALSV      ----------------------------------------------------------------------
RNFB_SALPK      ----------------------------------------------------------------------
RNFB_SALPC      ----------------------------------------------------------------------
RNFB_SALPB      ----------------------------------------------------------------------
RNFB_SALPA      ----------------------------------------------------------------------
RNFB_SALNS      ----------------------------------------------------------------------
RNFB_SALHS      ----------------------------------------------------------------------
RNFB_SALG2      ----------------------------------------------------------------------
RNFB_SALEP      ----------------------------------------------------------------------
RNFB_SALDC      ----------------------------------------------------------------------
RNFB_SALCH      ----------------------------------------------------------------------
RNFB_SALA4      ----------------------------------------------------------------------
RNFB_RHOCA      ----------------------------------------------------------------------
RNFB_ESCF3      ----------------------------------------------------------------------
RNFB_ECOUT      ----------------------------------------------------------------------
RNFB_ECOSM      ----------------------------------------------------------------------
RNFB_ECOSE      ----------------------------------------------------------------------
RNFB_ECOLU      ----------------------------------------------------------------------
RNFB_ECOLI      ----------------------------------------------------------------------
RNFB_ECOLC      ----------------------------------------------------------------------
RNFB_ECOL6      ----------------------------------------------------------------------
RNFB_ECOL5      ----------------------------------------------------------------------
RNFB_ECOK1      ----------------------------------------------------------------------
RNFB_ECOHS      ----------------------------------------------------------------------
RNFB_ECODH      ----------------------------------------------------------------------
RNFB_ECOBW      ----------------------------------------------------------------------
RNFB_ECO8A      ----------------------------------------------------------------------
RNFB_ECO81      ----------------------------------------------------------------------
RNFB_ECO7I      ----------------------------------------------------------------------
RNFB_ECO5E      ----------------------------------------------------------------------
RNFB_ECO57      ----------------------------------------------------------------------
RNFB_ECO55      ----------------------------------------------------------------------
RNFB_ECO45      ----------------------------------------------------------------------
RNFB_ECO27      ----------------------------------------------------------------------
RNFB_ECO24      ----------------------------------------------------------------------
RNFB_CITK8      ----------------------------------------------------------------------
RNFB_BUCAT      ----------------------------------------------------------------------
RNFB_BUCAI      ----------------------------------------------------------------------
RNFB_BUCA5      ----------------------------------------------------------------------
PORD_METTH      ----------------------------------------------------------------------
PORD_METJA      ----------------------------------------------------------------------
NUOI_THEFY      ----------------------------------------------------------------------
NUOI_RICTY      ----------------------------------------------------------------------
NUOI_HELHP      ----------------------------------------------------------------------
NUOI_FRASN      ----------------------------------------------------------------------
NUOI_FRASC      ----------------------------------------------------------------------
NQO9_THET8      ----------------------------------------------------------------------
NQO9_THET2      ----------------------------------------------------------------------
FER7_METJA      ----------------------------------------------------------------------
FER1_CAUCR      ----------------------------------------------------------------------
FDHL_STAAW      ----------------------------------------------------------------------
FDHL_STAAS      ----------------------------------------------------------------------
FDHL_STAAR      ----------------------------------------------------------------------
FDHL_STAAN      ----------------------------------------------------------------------
FDHL_STAAM      ----------------------------------------------------------------------
FDHL_STAAC      ----------------------------------------------------------------------
FDHL_STAAB      ----------------------------------------------------------------------
FDHL_STAA8      ----------------------------------------------------------------------
FDHL_STAA3      ----------------------------------------------------------------------
RNFB_SALAR      ----------------------------------------------------------------------
PPD_STRHY       ----------------------------------------------------------------------
ODPA_RHIME      ----------------------------------------------------------------------
NUOI_WOLTR      ----------------------------------------------------------------------
NUOI_SACEN      ----------------------------------------------------------------------
NUOI_PROAC      ----------------------------------------------------------------------
NUOI_ORITI      ----------------------------------------------------------------------
NUOI_ORITB      ----------------------------------------------------------------------
NUOI_CAMJR      ----------------------------------------------------------------------
NUOI_CAMJJ      ----------------------------------------------------------------------
NUOI_CAMJE      ----------------------------------------------------------------------
NUOI_CAMJD      ----------------------------------------------------------------------
NUOI_CAMJ8      ----------------------------------------------------------------------
NUOI2_STRCO     ----------------------------------------------------------------------
ILVB_PORUM      ----------------------------------------------------------------------
ILVB_PORPU      ----------------------------------------------------------------------
HYCF_ECOLI      ----------------------------------------------------------------------
HMEA_ARCFU      ----------------------------------------------------------------------
FER_CLOPE       ----------------------------------------------------------------------
FER_CLOPA       ----------------------------------------------------------------------
YCXI_PORPU      ----------------------------------------------------------------------
RNFB_SHIFL      ----------------------------------------------------------------------
RNFB_SHIBS      ----------------------------------------------------------------------
PHSB_SALTY      ----------------------------------------------------------------------
PHSB_SALTI      ----------------------------------------------------------------------
NUOI_CARHZ      ----------------------------------------------------------------------
NUOI_ANAPZ      ----------------------------------------------------------------------
FERA_METJA      ----------------------------------------------------------------------
FDXN_RHOCA      ----------------------------------------------------------------------
AB1E_ARATH      ----------------------------------------------------------------------
VHCB_METVO      ----------------------------------------------------------------------
RPOD_ARCFU      ----------------------------------------------------------------------
RNFB_PECCP      ----------------------------------------------------------------------
RNFB_MAGSM      ----------------------------------------------------------------------
RNFB_HAEDU      ----------------------------------------------------------------------
RLI1_YEAST      ----------------------------------------------------------------------
NUOI_EHRCR      ----------------------------------------------------------------------
NUOI_EHRCJ      ----------------------------------------------------------------------
NUOI_CAUCR      ----------------------------------------------------------------------
NUOI_CAMHC      ----------------------------------------------------------------------
NDUS8_TOBAC     ----------------------------------------------------------------------
NDUS8_SOLTU     ----------------------------------------------------------------------
FRHG_METJA      ----------------------------------------------------------------------
FPRB_MYCTU      ----------------------------------------------------------------------
FPRB_MYCBO      ----------------------------------------------------------------------
FDHL_STAHJ      ----------------------------------------------------------------------
YNFG_ECOLI      ----------------------------------------------------------------------
YNFG_ECOL6      ----------------------------------------------------------------------
Y726_METJA      ----------------------------------------------------------------------
RNFB_TOLAT      ----------------------------------------------------------------------
RNFB_PASMU      ----------------------------------------------------------------------
NUOI_RICM5      ----------------------------------------------------------------------
NUOI_RALEH      ----------------------------------------------------------------------
NUOI_NOCSJ      ----------------------------------------------------------------------
NUOI_CUPTR      ----------------------------------------------------------------------
NUOI2_SYNFM     ----------------------------------------------------------------------
NUOI2_STRAW     ----------------------------------------------------------------------
NUOI1_SYNFM     ----------------------------------------------------------------------
NDUS8_PONAB     ----------------------------------------------------------------------
NDUS8_PANTR     ----------------------------------------------------------------------
NDUS8_MOUSE     ----------------------------------------------------------------------
NDUS8_HUMAN     ----------------------------------------------------------------------
NDUS8_GORGO     ----------------------------------------------------------------------
NDUS8_ARATH     ----------------------------------------------------------------------
NAPH_HAEIN      ----------------------------------------------------------------------
HDRA1_METKA     ----------------------------------------------------------------------
FWDG_METJA      ----------------------------------------------------------------------
FPRB_MYCLE      ----------------------------------------------------------------------
FER_THET8       ----------------------------------------------------------------------
FER4_METJA      ----------------------------------------------------------------------
DPYD_DANRE      ----------------------------------------------------------------------
AB2E_ARATH      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXIQLRALGINTRGKIDGYFPKHGELDINKTXXXXXXXXXXSYAXXXXXXXXXXXXXXXXX
IORA_PYRAB      ----------------------------------------------------------------------
IORA_ARCFU      IVVEEVDPFVELHVRAMGLEVYGKMNGYMPMNYEYNVGRVETGIAKALGIKPSRDYEGIVAESQKLAAKA
IORA_PYRKO      ----------------------------------------------------------------------
IORA_PYRHO      ----------------------------------------------------------------------
IORA_METTH      RVLVVEEVDPIMEREVLAVDVHGKLDGTLPEYNEDILRKAISGLTGAPSVERECDVPDIPERPPSLCPGC
Y514_METJA      ----------------------------------------------------------------------
FWDF_METJA      ----------------------------------------------------------------------
MVHB_METFE      ----------------------------------------------------------------------
FER_METTE       ----------------------------------------------------------------------
MVHB_METTH      ----------------------------------------------------------------------
Y1303_METJA     ----------------------------------------------------------------------
VORD_PYRFU      ----------------------------------------------------------------------
Y870_METJA      ----------------------------------------------------------------------
VORD_PYRAB      ----------------------------------------------------------------------
VHUB_METJA      ----------------------------------------------------------------------
VORD_PYRHO      ----------------------------------------------------------------------
HDRA_METMA      ----------------------------------------------------------------------
HDRA_METAC      ----------------------------------------------------------------------
VHUB_METVO      ----------------------------------------------------------------------
HDRA2_METKA     ----------------------------------------------------------------------
PORD_PYRAB      ----------------------------------------------------------------------
Y264_METJA      ----------------------------------------------------------------------
RNFB_AZOSB      ----------------------------------------------------------------------
FER2_DESNO      ----------------------------------------------------------------------
NUOI_MYCA1      ----------------------------------------------------------------------
NUOI2_MYCPA     ----------------------------------------------------------------------
FER_CLOST       ----------------------------------------------------------------------
RNFB_AZOSE      ----------------------------------------------------------------------
PORD_METBF      ----------------------------------------------------------------------
NUOI_MYCUA      ----------------------------------------------------------------------
NUOI_MYCTU      ----------------------------------------------------------------------
NUOI_MYCTA      ----------------------------------------------------------------------
NUOI_MYCSS      ----------------------------------------------------------------------
NUOI_MYCSK      ----------------------------------------------------------------------
NUOI_MYCSJ      ----------------------------------------------------------------------
NUOI_MYCS2      ----------------------------------------------------------------------
NUOI_MYCMM      ----------------------------------------------------------------------
NUOI_MYCBT      ----------------------------------------------------------------------
NUOI_MYCBP      ----------------------------------------------------------------------
NUOI_MYCBO      ----------------------------------------------------------------------
YEIA_ECOLI      ----------------------------------------------------------------------
FER6_METJA      ----------------------------------------------------------------------
FER2_METJA      ----------------------------------------------------------------------
ODPA_ZYMMO      ----------------------------------------------------------------------
NUOI_SULDN      ----------------------------------------------------------------------
NUOI_RHOE4      ----------------------------------------------------------------------
NUOI_MAGSM      ----------------------------------------------------------------------
NUOI_HELPY      ----------------------------------------------------------------------
NUOI_HELPS      ----------------------------------------------------------------------
NUOI_HELPJ      ----------------------------------------------------------------------
NUOI_HELPH      ----------------------------------------------------------------------
NUOI_HELPG      ----------------------------------------------------------------------
NUOI_HELP2      ----------------------------------------------------------------------
NUOI_HELAH      ----------------------------------------------------------------------
FER_ALIAC       ----------------------------------------------------------------------
Y1043_HAEIN     ----------------------------------------------------------------------
PORD_PYRHO      ----------------------------------------------------------------------
PORD_PYRFU      ----------------------------------------------------------------------
ODBA_THET8      ----------------------------------------------------------------------
ODBA_THET2      ----------------------------------------------------------------------
NUOI_RHOSR      ----------------------------------------------------------------------
NUOI_RHOOB      ----------------------------------------------------------------------
NUOI_MYCVP      ----------------------------------------------------------------------
NUOI_MYCGI      ----------------------------------------------------------------------
HYFA_ECOLI      ----------------------------------------------------------------------
FDHL_STAS1      ----------------------------------------------------------------------
NUOI1_GEOSL     ----------------------------------------------------------------------
NUOHI_NOCFA     ----------------------------------------------------------------------
FER_BUTME       ----------------------------------------------------------------------
Y578_METJA      ----------------------------------------------------------------------
HMC2_DESVH      ----------------------------------------------------------------------
HDRA_METTM      ----------------------------------------------------------------------
HDRA_METTH      ----------------------------------------------------------------------
RNFB_HAEIN      ----------------------------------------------------------------------
RNFB_HAEIE      ----------------------------------------------------------------------
RNFB_HAEI8      ----------------------------------------------------------------------
RNFB_BUCAP      ----------------------------------------------------------------------
NUOI_PARUW      ----------------------------------------------------------------------
FDHL_BACSU      ----------------------------------------------------------------------
YJGC_BACSU      ----------------------------------------------------------------------
Y934_METJA      ----------------------------------------------------------------------
NUOI_WOLSU      ----------------------------------------------------------------------
NUOI_RICCK      ----------------------------------------------------------------------
NUOI2_RHIME     ----------------------------------------------------------------------
NUOI2_RHIEC     ----------------------------------------------------------------------
FER3_DESAF      ----------------------------------------------------------------------
DPYD_DICDI      ----------------------------------------------------------------------
NUOI1_STRCO     ----------------------------------------------------------------------
NUOI1_STRAW     ----------------------------------------------------------------------
FRHG_METVO      ----------------------------------------------------------------------
FER_CLOTS       ----------------------------------------------------------------------
FER1_DESVM      ----------------------------------------------------------------------
YOX6_SCHPO      ----------------------------------------------------------------------
NUOI_MAGSA      ----------------------------------------------------------------------
FER_CLOBU       ----------------------------------------------------------------------
RNFB_BUCBP      ----------------------------------------------------------------------
NUOI_RICAH      ----------------------------------------------------------------------
NUOI1_MYCPA     ----------------------------------------------------------------------
NDUS8_RECAM     ----------------------------------------------------------------------
FER_CLOAC       ----------------------------------------------------------------------
Y749_METJA      ----------------------------------------------------------------------
PNO_CRYPV       ----------------------------------------------------------------------
PHFL_DESVH      ----------------------------------------------------------------------
NUOI_RICRS      ----------------------------------------------------------------------
NUOI_RICRO      ----------------------------------------------------------------------
NUOI_RICPU      ----------------------------------------------------------------------
NUOI_RICCN      ----------------------------------------------------------------------
NUOI_RICBR      ----------------------------------------------------------------------
NUOI_RICB8      ----------------------------------------------------------------------
NUOI_RICAE      ----------------------------------------------------------------------
FER_ENTHI       ----------------------------------------------------------------------
Y51B_METJA      ----------------------------------------------------------------------
PPD_STRVR       ----------------------------------------------------------------------
PHFL_DESVO      ----------------------------------------------------------------------
NUOI_WOLPM      ----------------------------------------------------------------------
NUOI_RICPR      ----------------------------------------------------------------------
NUOI_RICFE      ----------------------------------------------------------------------
NUOI2_GEOMG     ----------------------------------------------------------------------
NIFJ_ENTAG      ----------------------------------------------------------------------
NDUS8_CAEEL     ----------------------------------------------------------------------
FER9_METJA      ----------------------------------------------------------------------
FER3_ANASP      ----------------------------------------------------------------------
ASRC_SALTY      ----------------------------------------------------------------------
ASRC_SALTI      ----------------------------------------------------------------------
Y208_METJA      ----------------------------------------------------------------------
RNFB_SHISS      ----------------------------------------------------------------------
RNFB_SHIDS      ----------------------------------------------------------------------
RNFB_SHIB3      ----------------------------------------------------------------------
RNFB_SALTY      ----------------------------------------------------------------------
RNFB_SALTI      ----------------------------------------------------------------------
RNFB_SALSV      ----------------------------------------------------------------------
RNFB_SALPK      ----------------------------------------------------------------------
RNFB_SALPC      ----------------------------------------------------------------------
RNFB_SALPB      ----------------------------------------------------------------------
RNFB_SALPA      ----------------------------------------------------------------------
RNFB_SALNS      ----------------------------------------------------------------------
RNFB_SALHS      ----------------------------------------------------------------------
RNFB_SALG2      ----------------------------------------------------------------------
RNFB_SALEP      ----------------------------------------------------------------------
RNFB_SALDC      ----------------------------------------------------------------------
RNFB_SALCH      ----------------------------------------------------------------------
RNFB_SALA4      ----------------------------------------------------------------------
RNFB_RHOCA      ----------------------------------------------------------------------
RNFB_ESCF3      ----------------------------------------------------------------------
RNFB_ECOUT      ----------------------------------------------------------------------
RNFB_ECOSM      ----------------------------------------------------------------------
RNFB_ECOSE      ----------------------------------------------------------------------
RNFB_ECOLU      ----------------------------------------------------------------------
RNFB_ECOLI      ----------------------------------------------------------------------
RNFB_ECOLC      ----------------------------------------------------------------------
RNFB_ECOL6      ----------------------------------------------------------------------
RNFB_ECOL5      ----------------------------------------------------------------------
RNFB_ECOK1      ----------------------------------------------------------------------
RNFB_ECOHS      ----------------------------------------------------------------------
RNFB_ECODH      ----------------------------------------------------------------------
RNFB_ECOBW      ----------------------------------------------------------------------
RNFB_ECO8A      ----------------------------------------------------------------------
RNFB_ECO81      ----------------------------------------------------------------------
RNFB_ECO7I      ----------------------------------------------------------------------
RNFB_ECO5E      ----------------------------------------------------------------------
RNFB_ECO57      ----------------------------------------------------------------------
RNFB_ECO55      ----------------------------------------------------------------------
RNFB_ECO45      ----------------------------------------------------------------------
RNFB_ECO27      ----------------------------------------------------------------------
RNFB_ECO24      ----------------------------------------------------------------------
RNFB_CITK8      ----------------------------------------------------------------------
RNFB_BUCAT      ----------------------------------------------------------------------
RNFB_BUCAI      ----------------------------------------------------------------------
RNFB_BUCA5      ----------------------------------------------------------------------
PORD_METTH      ----------------------------------------------------------------------
PORD_METJA      ----------------------------------------------------------------------
NUOI_THEFY      ----------------------------------------------------------------------
NUOI_RICTY      ----------------------------------------------------------------------
NUOI_HELHP      ----------------------------------------------------------------------
NUOI_FRASN      ----------------------------------------------------------------------
NUOI_FRASC      ----------------------------------------------------------------------
NQO9_THET8      ----------------------------------------------------------------------
NQO9_THET2      ----------------------------------------------------------------------
FER7_METJA      ----------------------------------------------------------------------
FER1_CAUCR      ----------------------------------------------------------------------
FDHL_STAAW      ----------------------------------------------------------------------
FDHL_STAAS      ----------------------------------------------------------------------
FDHL_STAAR      ----------------------------------------------------------------------
FDHL_STAAN      ----------------------------------------------------------------------
FDHL_STAAM      ----------------------------------------------------------------------
FDHL_STAAC      ----------------------------------------------------------------------
FDHL_STAAB      ----------------------------------------------------------------------
FDHL_STAA8      ----------------------------------------------------------------------
FDHL_STAA3      ----------------------------------------------------------------------
RNFB_SALAR      ----------------------------------------------------------------------
PPD_STRHY       ----------------------------------------------------------------------
ODPA_RHIME      ----------------------------------------------------------------------
NUOI_WOLTR      ----------------------------------------------------------------------
NUOI_SACEN      ----------------------------------------------------------------------
NUOI_PROAC      ----------------------------------------------------------------------
NUOI_ORITI      ----------------------------------------------------------------------
NUOI_ORITB      ----------------------------------------------------------------------
NUOI_CAMJR      ----------------------------------------------------------------------
NUOI_CAMJJ      ----------------------------------------------------------------------
NUOI_CAMJE      ----------------------------------------------------------------------
NUOI_CAMJD      ----------------------------------------------------------------------
NUOI_CAMJ8      ----------------------------------------------------------------------
NUOI2_STRCO     ----------------------------------------------------------------------
ILVB_PORUM      ----------------------------------------------------------------------
ILVB_PORPU      ----------------------------------------------------------------------
HYCF_ECOLI      ----------------------------------------------------------------------
HMEA_ARCFU      ----------------------------------------------------------------------
FER_CLOPE       ----------------------------------------------------------------------
FER_CLOPA       ----------------------------------------------------------------------
YCXI_PORPU      ----------------------------------------------------------------------
RNFB_SHIFL      ----------------------------------------------------------------------
RNFB_SHIBS      ----------------------------------------------------------------------
PHSB_SALTY      ----------------------------------------------------------------------
PHSB_SALTI      ----------------------------------------------------------------------
NUOI_CARHZ      ----------------------------------------------------------------------
NUOI_ANAPZ      ----------------------------------------------------------------------
FERA_METJA      ----------------------------------------------------------------------
FDXN_RHOCA      ----------------------------------------------------------------------
AB1E_ARATH      ----------------------------------------------------------------------
VHCB_METVO      ----------------------------------------------------------------------
RPOD_ARCFU      ----------------------------------------------------------------------
RNFB_PECCP      ----------------------------------------------------------------------
RNFB_MAGSM      ----------------------------------------------------------------------
RNFB_HAEDU      ----------------------------------------------------------------------
RLI1_YEAST      ----------------------------------------------------------------------
NUOI_EHRCR      ----------------------------------------------------------------------
NUOI_EHRCJ      ----------------------------------------------------------------------
NUOI_CAUCR      ----------------------------------------------------------------------
NUOI_CAMHC      ----------------------------------------------------------------------
NDUS8_TOBAC     ----------------------------------------------------------------------
NDUS8_SOLTU     ----------------------------------------------------------------------
FRHG_METJA      ----------------------------------------------------------------------
FPRB_MYCTU      ----------------------------------------------------------------------
FPRB_MYCBO      ----------------------------------------------------------------------
FDHL_STAHJ      ----------------------------------------------------------------------
YNFG_ECOLI      ----------------------------------------------------------------------
YNFG_ECOL6      ----------------------------------------------------------------------
Y726_METJA      ----------------------------------------------------------------------
RNFB_TOLAT      ----------------------------------------------------------------------
RNFB_PASMU      ----------------------------------------------------------------------
NUOI_RICM5      ----------------------------------------------------------------------
NUOI_RALEH      ----------------------------------------------------------------------
NUOI_NOCSJ      ----------------------------------------------------------------------
NUOI_CUPTR      ----------------------------------------------------------------------
NUOI2_SYNFM     ----------------------------------------------------------------------
NUOI2_STRAW     ----------------------------------------------------------------------
NUOI1_SYNFM     ----------------------------------------------------------------------
NDUS8_PONAB     ----------------------------------------------------------------------
NDUS8_PANTR     ----------------------------------------------------------------------
NDUS8_MOUSE     ----------------------------------------------------------------------
NDUS8_HUMAN     ----------------------------------------------------------------------
NDUS8_GORGO     ----------------------------------------------------------------------
NDUS8_ARATH     ----------------------------------------------------------------------
NAPH_HAEIN      ----------------------------------------------------------------------
HDRA1_METKA     ----------------------------------------------------------------------
FWDG_METJA      ----------------------------------------------------------------------
FPRB_MYCLE      ----------------------------------------------------------------------
FER_THET8       ----------------------------------------------------------------------
FER4_METJA      ----------------------------------------------------------------------
DPYD_DANRE      ----------------------------------------------------------------------
AB2E_ARATH      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXHMATFYILRLATAGLNPVWSGDIGCYSLGINTGQQDLITHMGSSVGLGAGIALATGQFVVATVG
IORA_PYRAB      ------HRNTFFALRKA-ATPRAIYPSDIGCYTLGVLPPLKDTTIAMGGSIGVAHGLSIATGKIIAATIG
IORA_ARCFU      XXXXXXHSASFYAIRRVVDELDAALPSDIGCYTLGINKPLEDITICMGASVGVSNGLAHVLNNKIIATIG
IORA_PYRKO      ------HRNSFFAIRKA-AGPKAIYPSDIGCYTLGVLPPLRDTTVAMGASIGIGHGLSIAMNQIIVATIG
IORA_PYRHO      ------HRNTFFAIRKA-ATPRAIFPSDIGCYTLGVLPPLKDTTIAMGGSIGVAHGLSIATGKIIVATIG
IORA_METTH      PHXXXXXXXXXXXDELELSGDEIIFPTDIGCYTLGIEPSAADYLLSMGSSIGTSCGFSAATTQRIVSFIG
Y514_METJA      ----------------------------------------------------------------------
FWDF_METJA      ----------------------------------------------------------------------
MVHB_METFE      ----------------------------------------------------------------------
FER_METTE       ----------------------------------------------------------------------
MVHB_METTH      ----------------------------------------------------------------------
Y1303_METJA     ----------------------------------------------------------------------
VORD_PYRFU      ----------------------------------------------------------------------
Y870_METJA      ----------------------------------------------------------------------
VORD_PYRAB      ----------------------------------------------------------------------
VHUB_METJA      ----------------------------------------------------------------------
VORD_PYRHO      ----------------------------------------------------------------------
HDRA_METMA      ----------------------------------------------------------------------
HDRA_METAC      ----------------------------------------------------------------------
VHUB_METVO      ----------------------------------------------------------------------
HDRA2_METKA     ----------------------------------------------------------------------
PORD_PYRAB      ----------------------------------------------------------------------
Y264_METJA      ----------------------------------------------------------------------
RNFB_AZOSB      ----------------------------------------------------------------------
FER2_DESNO      ----------------------------------------------------------------------
NUOI_MYCA1      ----------------------------------------------------------------------
NUOI2_MYCPA     ----------------------------------------------------------------------
FER_CLOST       ----------------------------------------------------------------------
RNFB_AZOSE      ----------------------------------------------------------------------
PORD_METBF      ----------------------------------------------------------------------
NUOI_MYCUA      ----------------------------------------------------------------------
NUOI_MYCTU      ----------------------------------------------------------------------
NUOI_MYCTA      ----------------------------------------------------------------------
NUOI_MYCSS      ----------------------------------------------------------------------
NUOI_MYCSK      ----------------------------------------------------------------------
NUOI_MYCSJ      ----------------------------------------------------------------------
NUOI_MYCS2      ----------------------------------------------------------------------
NUOI_MYCMM      ----------------------------------------------------------------------
NUOI_MYCBT      ----------------------------------------------------------------------
NUOI_MYCBP      ----------------------------------------------------------------------
NUOI_MYCBO      ----------------------------------------------------------------------
YEIA_ECOLI      ----------------------------------------------------------------------
FER6_METJA      ----------------------------------------------------------------------
FER2_METJA      ----------------------------------------------------------------------
ODPA_ZYMMO      ----------------------------------------------VGAQVPLGAGLAFADGGCSAAYFG
NUOI_SULDN      ----------------------------------------------------------------------
NUOI_RHOE4      ----------------------------------------------------------------------
NUOI_MAGSM      ----------------------------------------------------------------------
NUOI_HELPY      ----------------------------------------------------------------------
NUOI_HELPS      ----------------------------------------------------------------------
NUOI_HELPJ      ----------------------------------------------------------------------
NUOI_HELPH      ----------------------------------------------------------------------
NUOI_HELPG      ----------------------------------------------------------------------
NUOI_HELP2      ----------------------------------------------------------------------
NUOI_HELAH      ----------------------------------------------------------------------
FER_ALIAC       ----------------------------------------------------------------------
Y1043_HAEIN     ----------------------------------------------------------------------
PORD_PYRHO      ----------------------------------------------------------------------
PORD_PYRFU      ----------------------------------------------------------------------
ODBA_THET8      -----------------------------GSKALNFFTVASPIASHVPPAAGAAISMKLLTGQVAVCTFG
ODBA_THET2      -----------------------------GSKALNFFTVASPIASHVPPAAGAAISMKLLTGQVAVCTFG
NUOI_RHOSR      ----------------------------------------------------------------------
NUOI_RHOOB      ----------------------------------------------------------------------
NUOI_MYCVP      ----------------------------------------------------------------------
NUOI_MYCGI      ----------------------------------------------------------------------
HYFA_ECOLI      ----------------------------------------------------------------------
FDHL_STAS1      ----------------------------------------------------------------------
NUOI1_GEOSL     ----------------------------------------------------------------------
NUOHI_NOCFA     ----------------------------------------------------------------------
FER_BUTME       ----------------------------------------------------------------------
Y578_METJA      ----------------------------------------------------------------------
HMC2_DESVH      ----------------------------------------------------------------------
HDRA_METTM      ----------------------------------------------------------------------
HDRA_METTH      ----------------------------------------------------------------------
RNFB_HAEIN      ----------------------------------------------------------------------
RNFB_HAEIE      ----------------------------------------------------------------------
RNFB_HAEI8      ----------------------------------------------------------------------
RNFB_BUCAP      ----------------------------------------------------------------------
NUOI_PARUW      ----------------------------------------------------------------------
FDHL_BACSU      ----------------------------------------------------------------------
YJGC_BACSU      ----------------------------------------------------------------------
Y934_METJA      ----------------------------------------------------------------------
NUOI_WOLSU      ----------------------------------------------------------------------
NUOI_RICCK      ----------------------------------------------------------------------
NUOI2_RHIME     ----------------------------------------------------------------------
NUOI2_RHIEC     ----------------------------------------------------------------------
FER3_DESAF      ----------------------------------------------------------------------
DPYD_DICDI      ----------------------------------------------------------------------
NUOI1_STRCO     ----------------------------------------------------------------------
NUOI1_STRAW     ----------------------------------------------------------------------
FRHG_METVO      ----------------------------------------------------------------------
FER_CLOTS       ----------------------------------------------------------------------
FER1_DESVM      ----------------------------------------------------------------------
YOX6_SCHPO      ----------------------------------------------------------------------
NUOI_MAGSA      ----------------------------------------------------------------------
FER_CLOBU       ----------------------------------------------------------------------
RNFB_BUCBP      ----------------------------------------------------------------------
NUOI_RICAH      ----------------------------------------------------------------------
NUOI1_MYCPA     ----------------------------------------------------------------------
NDUS8_RECAM     ----------------------------------------------------------------------
FER_CLOAC       ----------------------------------------------------------------------
Y749_METJA      ----------------------------------------------------------------------
PNO_CRYPV       ----------------------------------------------------------------------
PHFL_DESVH      ----------------------------------------------------------------------
NUOI_RICRS      ----------------------------------------------------------------------
NUOI_RICRO      ----------------------------------------------------------------------
NUOI_RICPU      ----------------------------------------------------------------------
NUOI_RICCN      ----------------------------------------------------------------------
NUOI_RICBR      ----------------------------------------------------------------------
NUOI_RICB8      ----------------------------------------------------------------------
NUOI_RICAE      ----------------------------------------------------------------------
FER_ENTHI       ----------------------------------------------------------------------
Y51B_METJA      ----------------------------------------------------------------------
PPD_STRVR       ------------------------------------------MVGAMGSAATVGLGVALHTPRPVVVVDG
PHFL_DESVO      ----------------------------------------------------------------------
NUOI_WOLPM      ----------------------------------------------------------------------
NUOI_RICPR      ----------------------------------------------------------------------
NUOI_RICFE      ----------------------------------------------------------------------
NUOI2_GEOMG     ----------------------------------------------------------------------
NIFJ_ENTAG      ----------------------------------------------------------------------
NDUS8_CAEEL     ----------------------------------------------------------------------
FER9_METJA      ----------------------------------------------------------------------
FER3_ANASP      ----------------------------------------------------------------------
ASRC_SALTY      ----------------------------------------------------------------------
ASRC_SALTI      ----------------------------------------------------------------------
Y208_METJA      ----------------------------------------------------------------------
RNFB_SHISS      ----------------------------------------------------------------------
RNFB_SHIDS      ----------------------------------------------------------------------
RNFB_SHIB3      ----------------------------------------------------------------------
RNFB_SALTY      ----------------------------------------------------------------------
RNFB_SALTI      ----------------------------------------------------------------------
RNFB_SALSV      ----------------------------------------------------------------------
RNFB_SALPK      ----------------------------------------------------------------------
RNFB_SALPC      ----------------------------------------------------------------------
RNFB_SALPB      ----------------------------------------------------------------------
RNFB_SALPA      ----------------------------------------------------------------------
RNFB_SALNS      ----------------------------------------------------------------------
RNFB_SALHS      ----------------------------------------------------------------------
RNFB_SALG2      ----------------------------------------------------------------------
RNFB_SALEP      ----------------------------------------------------------------------
RNFB_SALDC      ----------------------------------------------------------------------
RNFB_SALCH      ----------------------------------------------------------------------
RNFB_SALA4      ----------------------------------------------------------------------
RNFB_RHOCA      ----------------------------------------------------------------------
RNFB_ESCF3      ----------------------------------------------------------------------
RNFB_ECOUT      ----------------------------------------------------------------------
RNFB_ECOSM      ----------------------------------------------------------------------
RNFB_ECOSE      ----------------------------------------------------------------------
RNFB_ECOLU      ----------------------------------------------------------------------
RNFB_ECOLI      ----------------------------------------------------------------------
RNFB_ECOLC      ----------------------------------------------------------------------
RNFB_ECOL6      ----------------------------------------------------------------------
RNFB_ECOL5      ----------------------------------------------------------------------
RNFB_ECOK1      ----------------------------------------------------------------------
RNFB_ECOHS      ----------------------------------------------------------------------
RNFB_ECODH      ----------------------------------------------------------------------
RNFB_ECOBW      ----------------------------------------------------------------------
RNFB_ECO8A      ----------------------------------------------------------------------
RNFB_ECO81      ----------------------------------------------------------------------
RNFB_ECO7I      ----------------------------------------------------------------------
RNFB_ECO5E      ----------------------------------------------------------------------
RNFB_ECO57      ----------------------------------------------------------------------
RNFB_ECO55      ----------------------------------------------------------------------
RNFB_ECO45      ----------------------------------------------------------------------
RNFB_ECO27      ----------------------------------------------------------------------
RNFB_ECO24      ----------------------------------------------------------------------
RNFB_CITK8      ----------------------------------------------------------------------
RNFB_BUCAT      ----------------------------------------------------------------------
RNFB_BUCAI      ----------------------------------------------------------------------
RNFB_BUCA5      ----------------------------------------------------------------------
PORD_METTH      ----------------------------------------------------------------------
PORD_METJA      ----------------------------------------------------------------------
NUOI_THEFY      ----------------------------------------------------------------------
NUOI_RICTY      ----------------------------------------------------------------------
NUOI_HELHP      ----------------------------------------------------------------------
NUOI_FRASN      ----------------------------------------------------------------------
NUOI_FRASC      ----------------------------------------------------------------------
NQO9_THET8      ----------------------------------------------------------------------
NQO9_THET2      ----------------------------------------------------------------------
FER7_METJA      ----------------------------------------------------------------------
FER1_CAUCR      ----------------------------------------------------------------------
FDHL_STAAW      ----------------------------------------------------------------------
FDHL_STAAS      ----------------------------------------------------------------------
FDHL_STAAR      ----------------------------------------------------------------------
FDHL_STAAN      ----------------------------------------------------------------------
FDHL_STAAM      ----------------------------------------------------------------------
FDHL_STAAC      ----------------------------------------------------------------------
FDHL_STAAB      ----------------------------------------------------------------------
FDHL_STAA8      ----------------------------------------------------------------------
FDHL_STAA3      ----------------------------------------------------------------------
RNFB_SALAR      ----------------------------------------------------------------------
PPD_STRHY       ------------------------------------------MVGAMGSAATVGLGVALHTPRPVVVVDG
ODPA_RHIME      ----------------------------------------------VGAQVSLGTGLAFANDNVSLAYFG
NUOI_WOLTR      ----------------------------------------------------------------------
NUOI_SACEN      ----------------------------------------------------------------------
NUOI_PROAC      ----------------------------------------------------------------------
NUOI_ORITI      ----------------------------------------------------------------------
NUOI_ORITB      ----------------------------------------------------------------------
NUOI_CAMJR      ----------------------------------------------------------------------
NUOI_CAMJJ      ----------------------------------------------------------------------
NUOI_CAMJE      ----------------------------------------------------------------------
NUOI_CAMJD      ----------------------------------------------------------------------
NUOI_CAMJ8      ----------------------------------------------------------------------
NUOI2_STRCO     ----------------------------------------------------------------------
ILVB_PORUM      ---------------------------------------------HWISSAGLGTGLPAAIGELVICVSG
ILVB_PORPU      ---------------------------------------------HWISSAGLGTGLPAAIGELVICVSG
HYCF_ECOLI      ----------------------------------------------------------------------
HMEA_ARCFU      ----------------------------------------------------------------------
FER_CLOPE       ----------------------------------------------------------------------
FER_CLOPA       ----------------------------------------------------------------------
YCXI_PORPU      ----------------------------------------------------------------------
RNFB_SHIFL      ----------------------------------------------------------------------
RNFB_SHIBS      ----------------------------------------------------------------------
PHSB_SALTY      ----------------------------------------------------------------------
PHSB_SALTI      ----------------------------------------------------------------------
NUOI_CARHZ      ----------------------------------------------------------------------
NUOI_ANAPZ      ----------------------------------------------------------------------
FERA_METJA      ----------------------------------------------------------------------
FDXN_RHOCA      ----------------------------------------------------------------------
AB1E_ARATH      ----------------------------------------------------------------------
VHCB_METVO      ----------------------------------------------------------------------
RPOD_ARCFU      ----------------------------------------------------------------------
RNFB_PECCP      ----------------------------------------------------------------------
RNFB_MAGSM      ----------------------------------------------------------------------
RNFB_HAEDU      ----------------------------------------------------------------------
RLI1_YEAST      ----------------------------------------------------------------------
NUOI_EHRCR      ----------------------------------------------------------------------
NUOI_EHRCJ      ----------------------------------------------------------------------
NUOI_CAUCR      ----------------------------------------------------------------------
NUOI_CAMHC      ----------------------------------------------------------------------
NDUS8_TOBAC     ----------------------------------------------------------------------
NDUS8_SOLTU     ----------------------------------------------------------------------
FRHG_METJA      ----------------------------------------------------------------------
FPRB_MYCTU      ----------------------------------------------------------------------
FPRB_MYCBO      ----------------------------------------------------------------------
FDHL_STAHJ      ----------------------------------------------------------------------
YNFG_ECOLI      ----------------------------------------------------------------------
YNFG_ECOL6      ----------------------------------------------------------------------
Y726_METJA      ----------------------------------------------------------------------
RNFB_TOLAT      ----------------------------------------------------------------------
RNFB_PASMU      ----------------------------------------------------------------------
NUOI_RICM5      ----------------------------------------------------------------------
NUOI_RALEH      ----------------------------------------------------------------------
NUOI_NOCSJ      ----------------------------------------------------------------------
NUOI_CUPTR      ----------------------------------------------------------------------
NUOI2_SYNFM     ----------------------------------------------------------------------
NUOI2_STRAW     ----------------------------------------------------------------------
NUOI1_SYNFM     ----------------------------------------------------------------------
NDUS8_PONAB     ----------------------------------------------------------------------
NDUS8_PANTR     ----------------------------------------------------------------------
NDUS8_MOUSE     ----------------------------------------------------------------------
NDUS8_HUMAN     ----------------------------------------------------------------------
NDUS8_GORGO     ----------------------------------------------------------------------
NDUS8_ARATH     ----------------------------------------------------------------------
NAPH_HAEIN      ----------------------------------------------------------------------
HDRA1_METKA     ----------------------------------------------------------------------
FWDG_METJA      ----------------------------------------------------------------------
FPRB_MYCLE      ----------------------------------------------------------------------
FER_THET8       ----------------------------------------------------------------------
FER4_METJA      ----------------------------------------------------------------------
DPYD_DANRE      ----------------------------------------------------------------------
AB2E_ARATH      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DSTFYHAVLPQLVDIATRSVPILIVVMDNAYTAMTGGQPSPSRAIPAERITEAFGISTFVIDPIDVKKSV
IORA_PYRAB      DSTFFHTGLPALANAIYNRSNVLIVVLDNLVTAMTGDQPNPGKRILIEEVAKAMGADVAVVDPYDIKETY
IORA_ARCFU      DSTFIHAGIPPLINAVYNHADFVLVILDNSTTGMTGHQPHPGKAVRIEDIVRGCGVEVEVVNPYNVRKMV
IORA_PYRKO      DSTFYHTGLPALANAIYNRSNVLIVVLDNLVTAMTGDQPNPGKRIPIEDVAKAMGADVAVVDPYDIKATY
IORA_PYRHO      DSTFFHTGLPALANAIYNRSNVLIVVMDNMVTAMTGDQPNPGKRILIEEVARAMGADVAVVDPYDIKETY
IORA_METTH      DSTFFHAGIPPLINAVHNKQRFVLVVLDNRTTAMTGGQPHPAPEISIEEIVRASGVEVETVNPMNIKRTS
Y514_METJA      ----------------------------------------------------------------------
FWDF_METJA      ----------------------------------------------------------------------
MVHB_METFE      ---------------------------DVIYCDMCGGEPKPNDALRHEDITLEGGIKKKKISPEKCDKCG
FER_METTE       ----------------------------------------------------------------------
MVHB_METTH      ----------------------------------------------------------------------
Y1303_METJA     ----------------------------------------------------------------------
VORD_PYRFU      ----------------------------------------------------------------------
Y870_METJA      ----------------------------------------------------------------------
VORD_PYRAB      ----------------------------------------------------------------------
VHUB_METJA      ----------------------------------------------------------------------
VORD_PYRHO      ----------------------------------------------------------------------
HDRA_METMA      ----------------------------------------------------------------------
HDRA_METAC      ----------------------------------------------------------------------
VHUB_METVO      ----------------------------------------------------------------------
HDRA2_METKA     ----------------------------------------------------------------------
PORD_PYRAB      ----------------------------------------------------------------------
Y264_METJA      ----------------------------------------------------------------------
RNFB_AZOSB      ----------------------------------------------------------------------
FER2_DESNO      ----------------------------------------------------------------------
NUOI_MYCA1      ----------------------------------------------------------------------
NUOI2_MYCPA     ----------------------------------------------------------------------
FER_CLOST       ----------------------------------------------------------------------
RNFB_AZOSE      ----------------------------------------------------------------------
PORD_METBF      ----------------------------------------------------------------------
NUOI_MYCUA      ----------------------------------------------------------------------
NUOI_MYCTU      ----------------------------------------------------------------------
NUOI_MYCTA      ----------------------------------------------------------------------
NUOI_MYCSS      ----------------------------------------------------------------------
NUOI_MYCSK      ----------------------------------------------------------------------
NUOI_MYCSJ      ----------------------------------------------------------------------
NUOI_MYCS2      ----------------------------------------------------------------------
NUOI_MYCMM      ----------------------------------------------------------------------
NUOI_MYCBT      ----------------------------------------------------------------------
NUOI_MYCBP      ----------------------------------------------------------------------
NUOI_MYCBO      ----------------------------------------------------------------------
YEIA_ECOLI      ----------------------------------------------------------------------
FER6_METJA      ----------------------------------------------------------------------
FER2_METJA      ----------------------------------------------------------------------
ODPA_ZYMMO      DGSANQGQVYEAYNMAALKLPVIFVIENNGYAMGTSIQRANAHTALSER-GAGFGIPALVVDGMDVLEVR
NUOI_SULDN      ----------------------------------------------------------------------
NUOI_RHOE4      ----------------------------------------------------------------------
NUOI_MAGSM      ----------------------------------------------------------------------
NUOI_HELPY      ----------------------------------------------------------------------
NUOI_HELPS      ----------------------------------------------------------------------
NUOI_HELPJ      ----------------------------------------------------------------------
NUOI_HELPH      ----------------------------------------------------------------------
NUOI_HELPG      ----------------------------------------------------------------------
NUOI_HELP2      ----------------------------------------------------------------------
NUOI_HELAH      ----------------------------------------------------------------------
FER_ALIAC       ----------------------------------------------------------------------
Y1043_HAEIN     ----------------------------------------------------------------------
PORD_PYRHO      ----------------------------------------------------------------------
PORD_PYRFU      ----------------------------------------------------------------------
ODBA_THET8      DGATSEGDWYAGINFAAQGAPAVFIAENNFYAISVDYRHQTHSPTIADK-AHAFGIPGYLVDGMDVLASY
ODBA_THET2      DGATSEGDWYAGINFAAQGAPAVFVCENNFYAISVDYRHQTHSPTIADK-AHAFGIPGYLVDGMDVLASY
NUOI_RHOSR      ----------------------------------------------------------------------
NUOI_RHOOB      ----------------------------------------------------------------------
NUOI_MYCVP      ----------------------------------------------------------------------
NUOI_MYCGI      ----------------------------------------------------------------------
HYFA_ECOLI      ----------------------------------------------------------------------
FDHL_STAS1      ----------------------------------------------------------------------
NUOI1_GEOSL     ----------------------------------------------------------------------
NUOHI_NOCFA     ----------------------------------------------------------------------
FER_BUTME       ----------------------------------------------------------------------
Y578_METJA      ----------------------------------------------------------------------
HMC2_DESVH      ----------------------------------------------------------------------
HDRA_METTM      ----------------------------------------------------------------------
HDRA_METTH      ----------------------------------------------------------------------
RNFB_HAEIN      ------------------------------------------------------------------KPYA
RNFB_HAEIE      ------------------------------------------------------------------KPYA
RNFB_HAEI8      ------------------------------------------------------------------KPYA
RNFB_BUCAP      ----------------------------------------------------------------------
NUOI_PARUW      -----------------------------------------------------------------IHKVI
FDHL_BACSU      ----------------------------------------------------------------------
YJGC_BACSU      ----------------------------------------------------------------------
Y934_METJA      ----------------------------------------------------------------------
NUOI_WOLSU      ----------------------------------------------------------------------
NUOI_RICCK      ----------------------------------------------------------------------
NUOI2_RHIME     ----------------------------------------------------------------------
NUOI2_RHIEC     ----------------------------------------------------------------------
FER3_DESAF      ----------------------------------------------------------------------
DPYD_DICDI      ----------------------------------------------------------------------
NUOI1_STRCO     ----------------------------------------------------------------------
NUOI1_STRAW     ----------------------------------------------------------------------
FRHG_METVO      ----------------------------------------------------------------------
FER_CLOTS       ----------------------------------------------------------------------
FER1_DESVM      ----------------------------------------------------------------------
YOX6_SCHPO      ----------------------------------------------------------------------
NUOI_MAGSA      ----------------------------------------------------------------------
FER_CLOBU       ----------------------------------------------------------------------
RNFB_BUCBP      ----------------------------------------------------------------------
NUOI_RICAH      ----------------------------------------------------------------------
NUOI1_MYCPA     ----------------------------------------------------------------------
NDUS8_RECAM     ----------------------------------------------------------------------
FER_CLOAC       ----------------------------------------------------------------------
Y749_METJA      ----------------------------------------------------------------------
PNO_CRYPV       ----------------------------------------------------------------DVNQFV
PHFL_DESVH      ----------------------------------------------------------------------
NUOI_RICRS      ----------------------------------------------------------------------
NUOI_RICRO      ----------------------------------------------------------------------
NUOI_RICPU      ----------------------------------------------------------------------
NUOI_RICCN      ----------------------------------------------------------------------
NUOI_RICBR      ----------------------------------------------------------------------
NUOI_RICB8      ----------------------------------------------------------------------
NUOI_RICAE      ----------------------------------------------------------------------
FER_ENTHI       ----------------------------------------------------------------------
Y51B_METJA      ----------------------------------------------------------------------
PPD_STRVR       DG----SVLMRLGSLATVGANLVHLVLDNGVHDSTGGQRTLSSAVDLPAVAAACG---------------
PHFL_DESVO      ----------------------------------------------------------------------
NUOI_WOLPM      ---------------------------------------------------------------------V
NUOI_RICPR      ----------------------------------------------------------------------
NUOI_RICFE      ----------------------------------------------------------------------
NUOI2_GEOMG     ----------------------------------------------------------------------
NIFJ_ENTAG      ----------------------------------------------------------------------
NDUS8_CAEEL     ----------------------------------------------------------------------
FER9_METJA      ----------------------------------------------------------------------
FER3_ANASP      ----------------------------------------------------------------------
ASRC_SALTY      ----------------------------------------------------------------------
ASRC_SALTI      ----------------------------------------------------------------------
Y208_METJA      ----------------------------------------------------------------------
RNFB_SHISS      ----------------------------------------------------------------------
RNFB_SHIDS      ----------------------------------------------------------------------
RNFB_SHIB3      ----------------------------------------------------------------------
RNFB_SALTY      ----------------------------------------------------------------------
RNFB_SALTI      ----------------------------------------------------------------------
RNFB_SALSV      ----------------------------------------------------------------------
RNFB_SALPK      ----------------------------------------------------------------------
RNFB_SALPC      ----------------------------------------------------------------------
RNFB_SALPB      ----------------------------------------------------------------------
RNFB_SALPA      ----------------------------------------------------------------------
RNFB_SALNS      ----------------------------------------------------------------------
RNFB_SALHS      ----------------------------------------------------------------------
RNFB_SALG2      ----------------------------------------------------------------------
RNFB_SALEP      ----------------------------------------------------------------------
RNFB_SALDC      ----------------------------------------------------------------------
RNFB_SALCH      ----------------------------------------------------------------------
RNFB_SALA4      ----------------------------------------------------------------------
RNFB_RHOCA      ----------------------------------------------------------------------
RNFB_ESCF3      ----------------------------------------------------------------------
RNFB_ECOUT      ----------------------------------------------------------------------
RNFB_ECOSM      ----------------------------------------------------------------------
RNFB_ECOSE      ----------------------------------------------------------------------
RNFB_ECOLU      ----------------------------------------------------------------------
RNFB_ECOLI      ----------------------------------------------------------------------
RNFB_ECOLC      ----------------------------------------------------------------------
RNFB_ECOL6      ----------------------------------------------------------------------
RNFB_ECOL5      ----------------------------------------------------------------------
RNFB_ECOK1      ----------------------------------------------------------------------
RNFB_ECOHS      ----------------------------------------------------------------------
RNFB_ECODH      ----------------------------------------------------------------------
RNFB_ECOBW      ----------------------------------------------------------------------
RNFB_ECO8A      ----------------------------------------------------------------------
RNFB_ECO81      ----------------------------------------------------------------------
RNFB_ECO7I      ----------------------------------------------------------------------
RNFB_ECO5E      ----------------------------------------------------------------------
RNFB_ECO57      ----------------------------------------------------------------------
RNFB_ECO55      ----------------------------------------------------------------------
RNFB_ECO45      ----------------------------------------------------------------------
RNFB_ECO27      ----------------------------------------------------------------------
RNFB_ECO24      ----------------------------------------------------------------------
RNFB_CITK8      ----------------------------------------------------------------------
RNFB_BUCAT      ----------------------------------------------------------------------
RNFB_BUCAI      ----------------------------------------------------------------------
RNFB_BUCA5      ----------------------------------------------------------------------
PORD_METTH      ----------------------------------------------------------------------
PORD_METJA      ----------------------------------------------------------------------
NUOI_THEFY      ----------------------------------------------------------------------
NUOI_RICTY      ----------------------------------------------------------------------
NUOI_HELHP      ----------------------------------------------------------------------
NUOI_FRASN      ----------------------------------------------------------------------
NUOI_FRASC      ----------------------------------------------------------------------
NQO9_THET8      ----------------------------------------------------------------------
NQO9_THET2      ----------------------------------------------------------------------
FER7_METJA      ----------------------------------------------------------------------
FER1_CAUCR      ----------------------------------------------------------------------
FDHL_STAAW      ----------------------------------------------------------------------
FDHL_STAAS      ----------------------------------------------------------------------
FDHL_STAAR      ----------------------------------------------------------------------
FDHL_STAAN      ----------------------------------------------------------------------
FDHL_STAAM      ----------------------------------------------------------------------
FDHL_STAAC      ----------------------------------------------------------------------
FDHL_STAAB      ----------------------------------------------------------------------
FDHL_STAA8      ----------------------------------------------------------------------
FDHL_STAA3      ----------------------------------------------------------------------
RNFB_SALAR      ----------------------------------------------------------------------
PPD_STRHY       DGSALMR-LGSLATVAAHAPGNLVLILDNGVHDSTGGQRTLSSAVDLPAVAAACG---------------
ODPA_RHIME      DGAANQGQVYESFNMAALKLPVIYIVENNRYAMGTSVSRASAQTDFSQR-GASFGIPGYQVDGMDVRAVK
NUOI_WOLTR      ---------------------------------------------------------------------V
NUOI_SACEN      ----------------------------------------------------------------------
NUOI_PROAC      ----------------------------------------------------------------------
NUOI_ORITI      ----------------------------------------------------------------------
NUOI_ORITB      ----------------------------------------------------------------------
NUOI_CAMJR      ----------------------------------------------------------------------
NUOI_CAMJJ      ----------------------------------------------------------------------
NUOI_CAMJE      ----------------------------------------------------------------------
NUOI_CAMJD      ----------------------------------------------------------------------
NUOI_CAMJ8      ----------------------------------------------------------------------
NUOI2_STRCO     ----------------------------------------------------------------------
ILVB_PORUM      DSSF-QMNMQELGTIAQYKLPIKIVIINNRWQGMVGERYSHSRAPNFQKLAEAFGIKAFTVN--------
ILVB_PORPU      DSSF-QMNMQELGTIAQYKLPIKIVIINNRWQGMVGERYSHSRAPNFQKLAEAFGIKAFTVN--------
HYCF_ECOLI      ----------------------------------------------------------------------
HMEA_ARCFU      ----------------------------------------------------------------------
FER_CLOPE       ----------------------------------------------------------------------
FER_CLOPA       ----------------------------------------------------------------------
YCXI_PORPU      ----------------------------------------------------------------------
RNFB_SHIFL      ----------------------------------------------------------------------
RNFB_SHIBS      ----------------------------------------------------------------------
PHSB_SALTY      ----------------------------------------------------------------------
PHSB_SALTI      ----------------------------------------------------------------------
NUOI_CARHZ      ----------------------------------------------------------------------
NUOI_ANAPZ      ----------------------------------------------------------------------
FERA_METJA      ----------------------------------------------------------------------
FDXN_RHOCA      ----------------------------------------------------------------------
AB1E_ARATH      ----------------------------------------------------------------------
VHCB_METVO      ----------------------------------------------------------------------
RPOD_ARCFU      ----------------------------------------------------------------------
RNFB_PECCP      ----------------------------------------------------------------------
RNFB_MAGSM      ----------------------------------------------------------------------
RNFB_HAEDU      ----------------------------------------------------------------------
RLI1_YEAST      ----------------------------------------------------------------------
NUOI_EHRCR      ----------------------------------------------------------------------
NUOI_EHRCJ      ----------------------------------------------------------------------
NUOI_CAUCR      ----------------------------------------------------------------------
NUOI_CAMHC      ----------------------------------------------------------------------
NDUS8_TOBAC     ----------------------------------------------------------------------
NDUS8_SOLTU     ----------------------------------------------------------------------
FRHG_METJA      ----------------------------------------------------------------------
FPRB_MYCTU      ----------------------------------------------------------------------
FPRB_MYCBO      ----------------------------------------------------------------------
FDHL_STAHJ      ----------------------------------------------------------------------
YNFG_ECOLI      ----------------------------------------------------------------------
YNFG_ECOL6      ----------------------------------------------------------------------
Y726_METJA      ----------------------------------------------------------------------
RNFB_TOLAT      ----------------------------------------------------------------------
RNFB_PASMU      ----------------------------------------------------------------------
NUOI_RICM5      ----------------------------------------------------------------------
NUOI_RALEH      ----------------------------------------------------------------------
NUOI_NOCSJ      ----------------------------------------------------------------------
NUOI_CUPTR      ----------------------------------------------------------------------
NUOI2_SYNFM     ----------------------------------------------------------------------
NUOI2_STRAW     ----------------------------------------------------------------------
NUOI1_SYNFM     ----------------------------------------------------------------------
NDUS8_PONAB     ----------------------------------------------------------------------
NDUS8_PANTR     ----------------------------------------------------------------------
NDUS8_MOUSE     ----------------------------------------------------------------------
NDUS8_HUMAN     ----------------------------------------------------------------------
NDUS8_GORGO     ----------------------------------------------------------------------
NDUS8_ARATH     ----------------------------------------------------------------------
NAPH_HAEIN      ----------------------------------------------------------------------
HDRA1_METKA     ----------------------------------------------------------------------
FWDG_METJA      ----------------------------------------------------------------------
FPRB_MYCLE      ----------------------------------------------------------------------
FER_THET8       ----------------------------------------------------------------------
FER4_METJA      ----------------------------------------------------------------------
DPYD_DANRE      ----------------------------------------------------------------------
AB2E_ARATH      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EIIKKAVEIVKSGRPAVVVSRRPCALIGVRKARRAGIQLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDR
IORA_PYRAB      ETFKKALEVEGV---SVVVARRACALYRIGQLRRAGKQWPIYQVNEDKCTGCKICINAYGCPAIYWDPEK
IORA_ARCFU      DVLRRA---LNHDGVAVVIARQPCAILWSRARRREG-KIVTYKV-TEDCTLCMECVNTFACPALI-FDGE
IORA_PYRKO      ETIKKA---LXXXXXXXXXXRQVCALYKIGQMRRRGMKWPIYHVVEDKCTGCKICINAYGCPAIYWDPEK
IORA_PYRHO      ETIKKALXXXXXXXXXXXXA---CALYRIGQLRREGKQWPIYQVNEEKCTGCKICINAYGCPAIYDAEKK
IORA_METTH      ETVKRALE---HESVAVVISKYPCML------SSGAVRGRPMAVDGEKCDLCLECIRDLACPAMVTR-EG
Y514_METJA      ------------------------------------IRLKKYELDENTCIKCGICARFCPTNAIKAVRRK
FWDF_METJA      -------------------------------------------IDVNACNACGACISICPCSALFPKPKD
MVHB_METFE      ECVKVCLKLVNDGKASRVPLEGFCVLCGVKEPARVEIKIDKYIVD---CVGCGLCVPECPVNAILPKYGE
FER_METTE       ------------------------------------------KVNVDLCTGCGSCVDECPAAAISLNDDG
MVHB_METTH      --------------------------ISGRKPEKRAKEIKKFELDEDACIGCNTCVEACPGDFIVPRTSN
Y1303_METJA     -----------------------------------------YYVDRRRCNGCGICANVCPIGIIKIVEKD
VORD_PYRFU      -------------------------------------------VNEEKCVKCYICWKYCPEPAIYIKPDG
Y870_METJA      ----------------------------------AGVKYPK--VNEEKCNGCGRCAEVCKVEAIDIRGE-
VORD_PYRAB      -------------------------------------------IDESKCVKCYICWKFCPEPAIYIKEDG
VHUB_METJA      ------------------------------------------------CVGCGICVPECPVNAITLE-NN
VORD_PYRHO      -------------------------------------------IDESKCVKCYICWKYCPEPAIYIKEDG
HDRA_METMA      -------------------------------------------VDPDKCIGCRTCVEVCKFGKI-SIVDK
HDRA_METAC      -------------------------------------------VDPDKCIGCRTCVEVCKFGKI-SIENK
VHUB_METVO      ------------------------------------VTIPQEPIKVTECVGCSECVPVCPVDAI-SIEDE
HDRA2_METKA     ------------------------------------------EVDEEICGGCGTCVELCPYGAIEKDGKL
PORD_PYRAB      ---------------------------------------PEFKKD--KCVRCFLCYIYCPEPAIYLDEEG
Y264_METJA      --VKSFLLLAIDGEKMVVVNVGSC--IGCRRCERSGITFNEFPI---KCMHCDRNPCLYACPEAIERINN
RNFB_AZOSB      -------------------------------------------IDENVCIGCTLCLQACPVDAIVGAAKQ
FER2_DESNO      -------------------------------------------VDSDKCIGCGECVDVCPVEVYELQNGK
NUOI_MYCA1      -------------------------------------QLNRYPDGLEKCIGCELCAWACPADAIYERYGR
NUOI2_MYCPA     -------------------------------------QLNRYPDGLEKCIGCELCAWACPADAIYERYGR
FER_CLOST       ----------------------------------------------DSCISCGACEPECPVNAITAGDDK
RNFB_AZOSE      ------------------------------------------RIDEQLCIGCTLCIQACPVDAIVGAAKH
PORD_METBF      -----------------------------------------------KCTKCGICHIVCPDMSVKPRENG
NUOI_MYCUA      -------------------------------------QLNRYPDGLEKCIGCELCAWACPADAIYERYGR
NUOI_MYCTU      -------------------------------------QLNRYPDGLEKCIGCELCAWACPADAIYERYGR
NUOI_MYCTA      -------------------------------------QLNRYPDGLEKCIGCELCAWACPADAIYERYGR
NUOI_MYCSS      -------------------------------------QLNRYPDGLEKCIGCELCAWACPADAIYVEGDR
NUOI_MYCSK      -------------------------------------QLNRYPDGLEKCIGCELCAWACPADAIYVEGDR
NUOI_MYCSJ      -------------------------------------QLNRYPDGLEKCIGCELCAWACPADAIYVEGDR
NUOI_MYCS2      -------------------------------------QLNRYPDGLEKCIGCELCAWACPADAIYERYGR
NUOI_MYCMM      -------------------------------------QLNRYPDGLEKCIGCELCAWACPADAIYERYGR
NUOI_MYCBT      -------------------------------------QLNRYPDGLEKCIGCELCAWACPADAIYERYGR
NUOI_MYCBP      -------------------------------------QLNRYPDGLEKCIGCELCAWACPADAIYERYGR
NUOI_MYCBO      -------------------------------------QLNRYPDGLEKCIGCELCAWACPADAIYERYGR
YEIA_ECOLI      ------------------------------------------RINLDKCVGCGRCY--ISCAMEWSEKTR
FER6_METJA      ---------------------------------------------LEKCVGCGNCVVFCPRRAI--KTYG
FER2_METJA      --------------------------------------------DLEKCVHCGCCITQCPINVIYMDEDY
ODPA_ZYMMO      GAATVAVDWVQAGKGPIILEMK------------------------------------------------
NUOI_SULDN      -----------------------------------------WESDTERCIGCGLCEKICNCIRIDTKLDE
NUOI_RHOE4      -------------------------------------QLNRYADGLEKCIGCELCAWACPADAIYERYGQ
NUOI_MAGSM      --------------------------------------LRRYEGGEERCVACKLCEAICPAQAIYIEIDT
NUOI_HELPY      -----------------------------------------------RCIGCGLCEKICTSNCIHKGEDN
NUOI_HELPS      -----------------------------------------------RCIGCGLCEKICTSNCIHKGEDN
NUOI_HELPJ      -----------------------------------------------RCIGCGLCEKICTSNCIHKGEDN
NUOI_HELPH      -----------------------------------------------RCIGCGLCEKICTSNCIHKGEDN
NUOI_HELPG      -----------------------------------------------RCIGCGLCEKICTSNCIHKGEDN
NUOI_HELP2      -----------------------------------------------RCIGCGLCEKICTSNCIHKGEDN
NUOI_HELAH      -----------------------------------------------RCIGCGLCEKICTSNCIHKGEDN
FER_ALIAC       ------------------------------------------------------CVETCPVDAIHEGPDQ
Y1043_HAEIN     ------------------------------------------------CNGCGECASACPNGLIQKQQQA
PORD_PYRHO      ---------------------------------------PEFHKD--KCVRCFLCYIYCPEPAIYLDEEG
PORD_PYRFU      ----------------------------------------KPEFNRDKCVRCYLCYIYCPEPAIYLDEEG
ODBA_THET8      YVVKEAVERARRGEGPSLVELR------------------------------------------------
ODBA_THET2      YVVKEAVERARRGEGPSLVELR------------------------------------------------
NUOI_RHOSR      -------------------------------------QLNRYADGLEKCIGCELCAWACPADAIYERYGQ
NUOI_RHOOB      -------------------------------------QLNRYADGLEKCIGCELCAWACPADAIFERYGR
NUOI_MYCVP      -------------------------------------QLNRYPDGLEKCIGCELCAWACPADAIFERYGR
NUOI_MYCGI      -------------------------------------QLNRYADGLEKCIGCELCAWACPADAIFERYGR
HYFA_ECOLI      ------------------------------------------------------CLQVCPVNAISQRDDA
FDHL_STAS1      ---------------------------------------PFYRYDPNQCILCGRCVEVCQDVQVNEQPDN
NUOI1_GEOSL     -----------------------------------GLHALKVSHDKAKCVACYLCPTVCKCITVEAGEDE
NUOHI_NOCFA     -------------------------------------QLNRHPDGLEKCIGCELCAWACPADAIYERYGR
FER_BUTME       ----------------------------------------------DECIACGSCADQCPVEAISEGSIY
Y578_METJA      -----------------------------------------YEIN-DDCIRCGKCLDVCQFDAI---GDF
HMC2_DESVH      ----------------------------VNRYNAAGLDHPVFRKQ--QCNHCPACASACFVKAFTKNPDG
HDRA_METTM      --------------------------------------------DSDVCGGCEVCIELCPFGAI-SIEEG
HDRA_METTH      --------------------------------------------DSDVCGGCEVCIELCPFGAI-SIEEG
RNFB_HAEIN      EAICNGDEITKGGQTTIV---KIAEILGVDVPTMEGIEEPIEKVDENMCIGCTKCIQACPVDAIIGTNKA
RNFB_HAEIE      EAICNGDEITKGGQTTIV---KIAEILGVDVPTMEGIEEPIEKVDENMCIGCTKCIQACPVDAIIGTNKA
RNFB_HAEI8      EAICNGDEITKGGQTTIV---KIAEILGVDVPTMEGIEEPIEKVDENMCIGCTKCIQACPVDAIIGTNKA
RNFB_BUCAP      -------------------------------------------IDEKNCVGCSKCASFCPVDAIIGTPNF
NUOI_PARUW      TMMKGLIIVLKHAFQTPVTLRYPEEKRILPARSRGRHYLTKWNDGLERCVGCELCAIVCPAQAIYVKPER
FDHL_BACSU      ---------------------------------------PFYRYDPNQCIACGVCQNLLSIDWERERPDE
YJGC_BACSU      ---------------------------------------PFYRYDPDQCILCGRCVEACQDVQVTKRPDN
Y934_METJA      -------------------------------------------IQLTECIGCGLCVDVCPTNAIKIFSFR
NUOI_WOLSU      -----------------------------------------------RCIGCGLCENCIRMETSYGEDGR
NUOI_RICCK      --------------------------------------LRRYENGVERCIACKLCEAICPAQAIVSRRTT
NUOI2_RHIME     -----------------------------------------------KCVACELCARICPCDCIENRRPA
NUOI2_RHIEC     -----------------------------------------------KCVACELCARICPCDCIENRHPA
FER3_DESAF      ----------------------------------------KITIDTDKCTGDGECVDVCPVE-VYELQDG
DPYD_DICDI      -------------------------------------------IDEDKCINCGKCYMTCNDSGYQAKFDG
NUOI1_STRCO     -------------------------------------QLNRHPDGLEKCVGCELCAWACPADAIYERYGR
NUOI1_STRAW     -------------------------------------QLNRHPDGLEKCVGCELCAWACPADAIYERYGR
FRHG_METVO      -----------------------------------GCDVIKEVINKSLCMGCGTCAAACQVNAI-DMVEA
FER_CLOTS       ----------------------------------------------DECISCGACAAECPVEAIHEGTG-
FER1_DESVM      -------------------------------------------VDTDKCTGDGECVDVCPVE-VYELQDG
YOX6_SCHPO      --------------------------------------------------------------------DR
NUOI_MAGSA      --------------------------------------LRRYPNGEERCIACKLCEAICPAQAITIEPER
FER_CLOBU       ----------------------------------------------DSCVSCGACAGECPVSAI-TQGDT
RNFB_BUCBP      ------------------------------------------EIDENNCVGCSKCRLVCPVDAVVGTYNF
NUOI_RICAH      --------------------------------------LRRYESGEERCIACKLCEAICPAQAIVIEADE
NUOI1_MYCPA     -------------------------------------QLNRWPDGLEKCIGCELCAWACPADAIFERYGR
NDUS8_RECAM     --------------------------------------LRRYQTGEERCIACKLCEAICPAQAITSRRTT
FER_CLOAC       ------------------------------------------------CISCGACEPECPVNAISSGDDR
Y749_METJA      ----------------------------------------KLKLDENKCVGCRLCER--KCPMQIKITEK
PNO_CRYPV       KDILGPVNALKGDEPVSMFEPTGTVPLGTTAYEKRGIAMSIPIVDMNKCTQCNYCSIVCPHAAIFKNAPE
PHFL_DESVH      ------------------------------------------QIDEAKCIGCDTCSQYCPTAAIFGEPHS
NUOI_RICRS      --------------------------------------LRRYEHGEERCIACKLCEAICPAQAIVIEADE
NUOI_RICRO      --------------------------------------LRRYEHGEERCIACKLCEAICPAQAIVIEADE
NUOI_RICPU      --------------------------------------LRRYENGEERCIACKLCEAICPAQAIVIEADE
NUOI_RICCN      --------------------------------------LRRYENGEERCIACKLCEAICPAQAIVIEADE
NUOI_RICBR      --------------------------------------LRRYENGEERCIACKLCEAICPAQAIVIEADE
NUOI_RICB8      --------------------------------------LRRYENGEERCIACKLCEAICPAQAIVIEADE
NUOI_RICAE      --------------------------------------LRRYENGEERCIACKLCEAICPAQAIVIEADE
FER_ENTHI       -------------------------------------------VNIDDCVACGACSGTCPQSVLEVN-DH
Y51B_METJA      ---------------------------------------PKYSIDEEVCVRCGNCERACPINVI-ERKEG
PPD_STRVR       ----------------------------------------------------------------------
PHFL_DESVO      ------------------------------------------QIDESKCIGCDSCQQYCPTGAIF-GDTG
NUOI_WOLPM      ELIKGFVITLKYMFKPKVTLRYPMEKGPLSPRFRGEHALRRYPNGEERCIACKLCEVICPAQAIVSRRTT
NUOI_RICPR      --------------------------------------LRRYENGEERCIACKLCEAICPAQAIVIESDE
NUOI_RICFE      --------------------------------------LRRYENGEERCIACKLCEAICPAQAIVIEADE
NUOI2_GEOMG     -----------------------------------GLHALKVSHSKAKCVCCYLCPTVCKCITVEAGEDQ
NIFJ_ENTAG      --------------------------------RGVAINVPVWQTD--KCTQCNQCAFICPHAAIRKRASG
NDUS8_CAEEL     --------------------------------------LRRYPSGEERCIACKLCEAICPAQAITTRPDT
FER9_METJA      ------------------------------------------------------CKEVCPVSAI-EHKDG
FER3_ANASP      ---------------------------------------PKFSIDKDKCIGCGRCYPVLDLKALXXXXXR
ASRC_SALTY      ------------------------------------IGVAKMRFTADRCIGCGACHHAVGCLAL---KNG
ASRC_SALTI      ------------------------------------IGVAKMRFTADRCIGCGACHHAVGCLAL---KNG
Y208_METJA      ---------------------------------KAGIVTTKYAIDXXXXXXXXXXINVCPNGAIVKR-DN
RNFB_SHISS      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_SHIDS      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_SHIB3      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_SALTY      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_SALTI      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_SALSV      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_SALPK      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_SALPC      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_SALPB      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_SALPA      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_SALNS      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_SALHS      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_SALG2      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_SALEP      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_SALDC      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_SALCH      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_SALA4      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_RHOCA      ------------------------------------------------CTGCQKCFKRCPTDAIVGGAKQ
RNFB_ESCF3      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_ECOUT      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_ECOSM      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_ECOSE      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_ECOLU      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_ECOLI      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_ECOLC      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_ECOL6      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_ECOL5      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_ECOK1      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_ECOHS      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_ECODH      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_ECOBW      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_ECO8A      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_ECO81      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_ECO7I      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_ECO5E      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_ECO57      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_ECO55      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_ECO45      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_ECO27      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_ECO24      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_CITK8      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRA
RNFB_BUCAT      -------------------------------------------INESNCVGCSKCASFCPVDAIVGAPNF
RNFB_BUCAI      -------------------------------------------INESNCVGCSKCASFCPVDAIVGAPNF
RNFB_BUCA5      -------------------------------------------INESNCVGCSKCASFCPVDAIVGAPNF
PORD_METTH      --------------------------------------------------------------------NR
PORD_METJA      -------------------------------------------LDNEKCVKCENCYIFCPEGAIQEDENG
NUOI_THEFY      -------------------------------------QLNRWPDGLEKCIGCELCAWACPADAIYERYGR
NUOI_RICTY      --------------------------------------LRRYENGEERCIACKLCEAVCPAQAIVIESDE
NUOI_HELHP      -----------------------------------------------RCIGCGLCEKICTSNCIRIITDK
NUOI_FRASN      -------------------------------------QLNRHPDGLEKCVGCELCAWACPADAIYERYGR
NUOI_FRASC      -------------------------------------QLNRHPDGLEKCVGCELCAWACPADAIYERYGR
NQO9_THET8      --------------------------------------LTRHPNGLEKCIGCSLCAAACPAYAIYVEPAE
NQO9_THET2      --------------------------------------LTRHPNGLEKCIGCSLCAAACPAYAIYVEPAE
FER7_METJA      -------------------------------------------VDREKCIGCGRCYDVCPKGPLIWTKDE
FER1_CAUCR      ----------------------------------------------------------------------
FDHL_STAAW      ---------------------------------------PFYRYDPNQCILCGRCVEACQDIEVNETIDN
FDHL_STAAS      ---------------------------------------PFYRYDPNQCILCGRCVEACQDIEVNETIDN
FDHL_STAAR      ---------------------------------------PFYRYDPNQCILCGRCVEAIRIDWDREHPDN
FDHL_STAAN      ---------------------------------------PFYRYDPNQCILCGRCVEACQDIEVNETIDN
FDHL_STAAM      ---------------------------------------PFYRYDPNQCILCGRCVEACQDIEVNETIDN
FDHL_STAAC      ---------------------------------------PFYRYDPNQCILCGRCVEACQDIEVNETIDN
FDHL_STAAB      ---------------------------------------PFYRYDPNQCILCGRCVEACQDIEVNETIDN
FDHL_STAA8      ---------------------------------------PFYRYDPNQCILCGRCVEACQDIEVNETIDN
FDHL_STAA3      ---------------------------------------PFYRYDPNQCILCGRCVEACQDIEVNETIDN
RNFB_SALAR      -------------------------------------------IDENHCIGCTKCIQACPVDAIVGATRA
PPD_STRHY       ----------------------------------------------------------------------
ODPA_RHIME      AAADEAVEHCRSGKGPIIL---------------------------------------------------
NUOI_WOLTR      ELIKGFIITLRYAFKPKVTLKYPMEKGPLSPRFRGEHALRRYSNGEERCIACKLCEVICPAQAIVSRRTT
NUOI_SACEN      -------------------------------------QLNRHPDGLEKCVGCELCAWACPADAIFVEPGE
NUOI_PROAC      -------------------------------------QLNRWPDGLEKCVGCELCAWACPADAIYERYGR
NUOI_ORITI      --------------------------------------LRRYPDGEERCIACKLCEAICPAQAITSRRTT
NUOI_ORITB      --------------------------------------LRRYPDGEERCIACKLCEAICPAQAITSRRTT
NUOI_CAMJR      -------ELLKRNNSATI--KYPFEKVKLDNRYRAVHRLMRFIESENRCIGCGLCENCIRMETSLDENGR
NUOI_CAMJJ      -------ELLKRNNSATI--KYPFEKVKLDNRYRAVHRLMRFIESENRCIGCGLCENCIRMETSLDENGR
NUOI_CAMJE      -------ELLKRNNSATI--KYPFEKVKLDNRYRAVHRLMRFIESENRCIGCGLCENCIRMETSLDENGR
NUOI_CAMJD      -------ELLKRNNSATI--KYPFEKVKLDNRYRAVHRLMRFIESENRCIGCGLCENCIRMETSLDENGR
NUOI_CAMJ8      -------ELLKRNNSATI--KYPFEKVKLDNRYRAVHRLMRFIESENRCIGCGLCENCIRMETSLDENGR
NUOI2_STRCO     ----------------------------------------------------------------------
ILVB_PORUM      ----------------------------------------------------------------------
ILVB_PORPU      ----------------------------------------------------------------------
HYCF_ECOLI      -------KVIKTG---TATSSYPLEPIAVDKNFRG-----KPEQNPQQCIGCAACVNACPSNALTVETDL
HMEA_ARCFU      ------------------------------------------------------CVQVCLTKASFKRPDG
FER_CLOPE       ---------------------------------------------LDTCVSCGACAAECPVDAI-SQGDT
FER_CLOPA       ----------------------------------------------DSCVSCGACASECPVNAI-SQGDS
YCXI_PORPU      -----------------------------------------HTIVTEKCIGVAECVNACPVSCIHKGEGK
RNFB_SHIFL      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRV
RNFB_SHIBS      -------------------------------------------IDENNCIGCTKCIQACPVDAIVGATRV
PHSB_SALTY      --------------------------VQIRAPEQASNALTHFQFVRVSCQHCAPCVSVCPTGASYRDENG
PHSB_SALTI      --------------------------VQIRAPEQASNALTHFQFVRVSCQHCAPCVSVCPTGASYRDENG
NUOI_CARHZ      -----------------------------------------------KCIACGLCQQVIKVGSIKKRKLA
NUOI_ANAPZ      --------------------------------------LRRYESGEERCIACKLCEAICPAQAITIEAEE
FERA_METJA      ------------------------------------------KIDYKKCGYCGACVGVCEKLAI-NLIEH
FDXN_RHOCA      ----------------------------------------------------------------------
AB1E_ARATH      ---------------------------------------------------------------------K
VHCB_METVO      ----------------------PCAIKAIMVVNPKGLELPSRAKEFKMCDLCGTCVSACPTEALQKEYDR
RPOD_ARCFU      --------------------------------------IPEIVVNEN-CNGCGDCIEACPRNVFEKDGDK
RNFB_PECCP      ----------------------------------ADVQAPARQVDESNCIGCTKCIQACPVDAIIGSTKA
RNFB_MAGSM      ----EAINLCTPGGKAVMESI--AAMLGVSPAAMDDEGPKVAYIDEEACIGCTACIKVCPVDAIVGANKQ
RNFB_HAEDU      ---------VPGGQPLVV---KIAELMGVDVPSMDNTAVPEVKVALDMCIGCTKCIQACPVDAIIGTNKA
RLI1_YEAST      ----------------------------------------------------------------------
NUOI_EHRCR      --------------------------------------LRKYKNGEERCIACKLCEAICPAQAITSRRTV
NUOI_EHRCJ      --------------------------------------LRKYKNGEERCIACKLCEAICPAQAITSRRTV
NUOI_CAUCR      --------------------------------------LRRYPSGEERCIACKLCEAICPAQAITSRRTT
NUOI_CAMHC      -----------------------------------------------RCIGCGLCENCIRMETTLGDDGR
NDUS8_TOBAC     --------------------------------------LRRYPTGEERCIACKLCEAICPAQAITSRRTT
NDUS8_SOLTU     --------------------------------------LRRYATGEERCIACKLCEAICPAQAITSRRTT
FRHG_METJA      ---------------------QPYAELAEKGSEACGCDVIYKVVNKSLCMGCGTCAAACPTRAI-EMLDG
FPRB_MYCTU      -------------------------------------------VITQSCCNDASCVFACPVNCIHPTPDE
FPRB_MYCBO      -------------------------------------------VITQSCCNDASCVFACPVNCIHPTPDE
FDHL_STAHJ      ---------------------------------------PFYRYDPDQCILCGRCVEACQISIDWNREDN
YNFG_ECOLI      ------------------------------------------------CNHCDACTKVCPSGAMHKREDG
YNFG_ECOL6      ------------------------------------------------CNHCDACTKVCPSGAMHKREDG
Y726_METJA      ------------------------------------------------CTGCGTC--VAKCPANALTIDE
RNFB_TOLAT      ----------------------------------------------NLCIGCTKCIQACPVDAIIGAPKL
RNFB_PASMU      -------------------------------------------IDEDMCIGCTKCIQACPVDAIIGTNKA
NUOI_RICM5      --------------------------------------LRRYENGEERCIACKLCEAICPAQAIVIEADE
NUOI_RALEH      --------------------------------------LRRYPNGEERCIACKLCEAVCPALAITIESDA
NUOI_NOCSJ      -------------------------------------QLNRWPDGLEKCVGCELCAWACPADAIYERYGR
NUOI_CUPTR      --------------------------------------LRRYPNGEERCIACKLCEAVCPALAITIESDA
NUOI2_SYNFM     ---------------------------------RAVIVLTRDPDGGERCVACYLCSAVCPVSCISEREDG
NUOI2_STRAW     ----------------------------------------------------------------------
NUOI1_SYNFM     -------------RPVVTV-QYPREVVTLSPAFRGHIELKSFDTGTHKCIACGTCERMCPSNVI-KVQGT
NDUS8_PONAB     --------------------------------------LRRYPSGEERCIACKLCEAICPAQAITIEAEP
NDUS8_PANTR     --------------------------------------LRRYPSGEERCIACKLCEAICPAQAITIEAEP
NDUS8_MOUSE     --------------------------------------LRRYPSGEERCIACKLCEAICPAQAITIEAEP
NDUS8_HUMAN     --------------------------------------LRRYPSGEERCIACKLCEAICPAQAITIEAEP
NDUS8_GORGO     --------------------------------------LRRYPSGEERCIACKLCEAICPAQAITIEAEP
NDUS8_ARATH     --------------------------------------LRRYPTGEERCIACKLCEAVCPAQAITSRRTT
NAPH_HAEIN      -------------------------------------------IDRAKCDNCMDCYNVCPEAQVLRSPDE
HDRA1_METKA     ---------------------------------------------------------------IEKKP--
FWDG_METJA      -----------------------------------------------RCHGCGNC--VVSCPVNAKHPET
FPRB_MYCLE      ------------------------------------------------CCNDGSCVFACPVNCIHPTPDE
FER_THET8       ------------------------------------------------------CVEVCPVECIYDGGDQ
FER4_METJA      -------------------------------------------IDYSLCKGCAECVNNCPMEVFEIEGDK
DPYD_DANRE      -------------------------------------------VDPEMCINCGKCYMTCNDSAIKFDPET
AB2E_ARATH      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           KAHVDPALCVGCGICAEVCPFNAFKPEGKREAWLELWRQA
IORA_PYRAB      KAKVDPLMCWGCGGCAQVCPFDAFE---------------
IORA_ARCFU      KVSIDQSLCVGCAVCAKICPNRAIKP--------------
IORA_PYRKO      KAKVDPTMCWGCGGCAQVCPFDAFEP--------------
IORA_PYRHO      KARVDPLMCWGCGGCAQVCPFGAFE---------------
IORA_METTH      EVFIDPLKCRGCSVCLQICPAGAIKPEGK-----------
Y514_METJA      SIEVNLDLCMGCGACAEVCPKKCIKVE-------------
FWDF_METJA      KAEVNQNLCVLCGACAKACPVNAFEREPKAIAWKEAFKK-
MVHB_METFE      SIEIDEEKCIKCGICAQTCPWNSVYISGKK----------
FER_METTE       IATVDESECLDCGSCEDACPNNAITIE-------------
MVHB_METTH      LTVELPAICTACGLCEQLCPVDAIDLE-------------
Y1303_METJA     GKKFPMGICSMCGVCVEVCPYNATKREGLAERYLKV----
VORD_PYRFU      YVAIDYDYCKGCGICANECPTKA-----------------
Y870_METJA      TSYTNYNVCVGCGKCIKNCPNEA--REVKEEGYL------
VORD_PYRAB      FVAIDYDYCKGCGICANECPTKA-----------------
VHUB_METJA      KAVIDKSKCIYCSICAQTCPWNAIFVAGK-----------
VORD_PYRHO      FVAIDYDYCKGCGICANECPTKA-----------------
HDRA_METMA      KAVVDEVSCYGCGDCSAACPVGAIQ---------------
HDRA_METAC      KAVVDEVSCYGCGDCSAACPVGAIQ---------------
VHUB_METVO      LAVIDTEKCIYCSVCAQTCPWNAIYVAGKK----------
HDRA2_METKA     VAEVTAALCKGCGTCAAACPSGAME---------------
PORD_PYRAB      YPVFDYDYCKGCGICANECPTNAIE---------------
Y264_METJA      KVVVIKDKCVGCGLCALACPFGAIRIDG------------
RNFB_AZOSB      MHTVVDPLCTGCELCVAPCPVDCIYMEPVRET-VQTWR--
FER2_DESNO      AVPVNEEECLGCESCIEVCPQNA-----------------
NUOI_MYCA1      VYQINYLRCIGCGLCVEACPTRA-----------------
NUOI2_MYCPA     VYQINYLRCIGCGLCVEACPTRA-----------------
FER_CLOST       YV-IDAATCIDCGACAGVCPVDAPQPE-------------
RNFB_AZOSE      MHTVVPALCTGCELCVAPCPVDCIAMTPLPET-LETWK--
PORD_METBF      FFEYDYDYCKGCGICANECPADAIE---------------
NUOI_MYCUA      VYQINYLRCIGCGLCIEACPTRA-----------------
NUOI_MYCTU      VYQINYLRCIGCGLCIEACPTRA-----------------
NUOI_MYCTA      VYQINYLRCIGCGLCIEACPTRA-----------------
NUOI_MYCSS      VYQINYLRCIGCGLCIEACPTRA-----------------
NUOI_MYCSK      VYQINYLRCIGCGLCIEACPTRA-----------------
NUOI_MYCSJ      VYQINYLRCIGCGLCIEACPTRA-----------------
NUOI_MYCS2      VYQINYLRCIGCGLCIEACPTRA-----------------
NUOI_MYCMM      VYQINYLRCIGCGLCIEACPTRA-----------------
NUOI_MYCBT      VYQINYLRCIGCGLCIEACPTRA-----------------
NUOI_MYCBP      VYQINYLRCIGCGLCIEACPTRA-----------------
NUOI_MYCBO      VYQINYLRCIGCGLCIEACPTRA-----------------
YEIA_ECOLI      TPHCNTEKCVGCLLCGHVCP--------------------
FER6_METJA      VAIVDENKCSNCGICARYCPINAIK---------------
FER2_METJA      NVVFKEEDCVGCKNCLKACPFKAIE---------------
ODPA_ZYMMO      ----------------------------------------
NUOI_SULDN      NSRINLGRCIFCGYCAEVCPELAITHGGEYE---------
NUOI_RHOE4      VYQINYLRCIGCGLCVEACPTRA-----------------
NUOI_MAGSM      ESRADKRLCIYCGLCEEACPVEA-----------------
NUOI_HELPY      RKKIDSGRCIYCGLCAEVCP--------------------
NUOI_HELPS      RKKIDSGRCIYCGLCAEVCP--------------------
NUOI_HELPJ      RKKIDSGRCIYCGLCAEVCP--------------------
NUOI_HELPH      RKKIDSGRCIYCGLCAEVCP--------------------
NUOI_HELPG      RKKIDSGRCIYCGLCAEVCP--------------------
NUOI_HELP2      RKKIDSGRCIYCGLCAEVCP--------------------
NUOI_HELAH      RKKIDSGRCIYCGLCAEVCP--------------------
FER_ALIAC       Y-YIDPDLCIDCAACEPVCPVNAFVPEDEKE---------
Y1043_HAEIN     TLEIDYAPCDLCGKCAEVCPTNALHP--------------
PORD_PYRHO      YPVFDYDYCKGCGICANECPTKAIE---------------
PORD_PYRFU      YPVFDYDYCKGCGICANECPTKAIE---------------
ODBA_THET8      ----------------------------------------
ODBA_THET2      ----------------------------------------
NUOI_RHOSR      VYQINYLRCIGCGLCIEACPTRA-----------------
NUOI_RHOOB      VYQINYLRCIGCGLCIEACPTRA-----------------
NUOI_MYCVP      VYQINYLRCIGCGLCIEACPTRA-----------------
NUOI_MYCGI      VYQINYLRCIGCGLCIEACPTRA-----------------
HYFA_ECOLI      -IQLNESLCIGCKLCAVVCPFGAISASGSR----------
FDHL_STAS1      DTSINDSSCVGCGQCATVCPCNA-----------------
NUOI1_GEOSL     RYEIDMLRCIFCGYCVEACPVDALKMTGQFE---------
NUOHI_NOCFA     VYQINYLRCIGCGLCIEACPTRA-----------------
FER_BUTME       E--IDEALCTDCGACADQCPVEAIVPE-------------
Y578_METJA      K--INPILCEGCGACELICEFDAIEPI-KRES--------
HMC2_DESVH      SVTYDGSLCVGCRYCMVACPFN------------------
HDRA_METTM      HANVNVALCKGCGTCVAACPSGA-----------------
HDRA_METTH      HANVNVALCKGCGTCVAACPSGA-----------------
RNFB_HAEIN      MHTIIPDLCTGCELCVAPCP--------------------
RNFB_HAEIE      MHTIIPDLCTGCELCVAPCP--------------------
RNFB_HAEI8      MHTIIPDLCTGCELCVAPCP--------------------
RNFB_BUCAP      MHTVLQKFCTGCNICLLHCPTNCIK---------------
NUOI_PARUW      YAQINMLRCIFCGYCEEACPTGA-----------------
FDHL_BACSU      GVPINESSCVSCGQCVTVCPCNA-----------------
YJGC_BACSU      DVPINESSCVSCGHCSTVCPCNAMMEKG------------
Y934_METJA      ET-----ICSVCGTCVDVCPNNA-----------------
NUOI_WOLSU      KKTINFGRCIFCGFCAEVCPELAIVHGGRYE---------
NUOI_RICCK      RYDIDMTKCIYCGLCQEACPVDA-----------------
NUOI2_RHIME     KFEIDTARCLFCGLCEDACPADA-----------------
NUOI2_RHIEC     KFEIDTARCLFCGLCEDACPADA-----------------
FER3_DESAF      KAAVNEDECLGCESCVEVCEQDALTVE-------------
DPYD_DICDI      KTHIPLVLCTGCDLCLSVCP--------------------
NUOI1_STRCO     VYQINYARCILCGLCIEACPTRA-----------------
NUOI1_STRAW     VYQINYARCILCGLCIEACPTRA-----------------
FRHG_METVO      KPNINSEFCIKCGICSAQCP--------------------
FER_CLOTS       KYEVDADTCIDCGACEAVCPTGAVKAE-------------
FER1_DESVM      KAPVNEEECLGCESCVEVCEAGAITVE-------------
YOX6_SCHPO      IAFISETLCIGCGICVKKCPFGA-----------------
NUOI_MAGSA      RYDLDMTKCIYCGLCQEACPVDA-----------------
FER_CLOBU       QFVIDADTCIDCGNCANVCPVGA-----------------
RNFB_BUCBP      RHTVLIDSCTGCNLCIPLCPTNCIK---------------
NUOI_RICAH      REDIDMTKCIYCGLCQEACPVDA-----------------
NUOI1_MYCPA     VYQINYLRCIGCGFCIEACPTRA-----------------
NDUS8_RECAM     RYDIDMTKCIYCGFCQEACPVDA-----------------
FER_CLOAC       YV-IDADTCIDCGACAGVCPVDA-----------------
Y749_METJA      ---IDQMECIRCFECMSVCSFSAFTKNTKKE---------
PNO_CRYPV       TMHVTPLDCTGCELCVHACPDDALHMEG------------
PHFL_DESVH      IPHIE--ACINCGQCLTHCPENA-----------------
NUOI_RICRS      REDIDMTKCIYCGLCQEACPVDA-----------------
NUOI_RICRO      REDIDMTKCIYCGLCQEACPVDA-----------------
NUOI_RICPU      REDIDMTKCIYCGLCQEACPVDA-----------------
NUOI_RICCN      REDIDMTKCIYCGLCQEACPVDA-----------------
NUOI_RICBR      REDIDMTKCIYCGLCQEACPVDA-----------------
NUOI_RICB8      REDIDMTKCIYCGLCQEACPVDA-----------------
NUOI_RICAE      REDIDMTKCIYCGLCQEACPVDA-----------------
FER_ENTHI       VEIKNPDDCIGCGACVDACPQGVLKVE-------------
Y51B_METJA      KYVINMALCISCKECIKVCP--------------------
PPD_STRVR       ----------------------------------------
PHFL_DESVO      DAHKIPELCINCGQCLTHCPVGA-----------------
NUOI_WOLPM      RYDIDMIKCIYCGLCQEACPVDA-----------------
NUOI_RICPR      RDDIDMTKCIYCGLCQEACPVDA-----------------
NUOI_RICFE      RDDIDMTKCIYCGLCQEACPVDA-----------------
NUOI2_GEOMG     EHNIDMLRCIFCGYCVEACPVDALKMTGEFE---------
NIFJ_ENTAG      RLAVSPLDCSGCGNCADVCPVKSMQPLESQEHEIELWEYA
NDUS8_CAEEL     RYDIDMTKCIYCGLCQEACPVDA-----------------
FER9_METJA      YVYLNEDVCIGCGLCALACPFGAILMEDK-----------
FER3_ANASP      KVMVHPENCIGCQACARICPKNCY----------------
ASRC_SALTY      KAVKEESACIGCGECVLACPTLAWQ---------------
ASRC_SALTI      KAVKEESACIGCGECVLACPTLAWQ---------------
Y208_METJA      FVEILLSKCLGCGNCKKVCPYNAI-IEGK-----------
RNFB_SHISS      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_SHIDS      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_SHIB3      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_SALTY      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_SALTI      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_SALSV      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_SALPK      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_SALPC      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_SALPB      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_SALPA      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_SALNS      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_SALHS      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_SALG2      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_SALEP      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_SALDC      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_SALCH      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_SALA4      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_RHOCA      IHTVVMDACIGCDACIEVCPTEAIVSRVKPKT-LKTW---
RNFB_ESCF3      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_ECOUT      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_ECOSM      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_ECOSE      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_ECOLU      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_ECOLI      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_ECOLC      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_ECOL6      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_ECOL5      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_ECOK1      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_ECOHS      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_ECODH      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_ECOBW      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_ECO8A      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_ECO81      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_ECO7I      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_ECO5E      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_ECO57      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_ECO55      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_ECO45      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_ECO27      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_ECO24      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_CITK8      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_BUCAT      IHTVLQEFCTGCNICLLHCPTNCI--EIKKETYEE-----
RNFB_BUCAI      IHTVLQEFCTGCNICLLHCPTNCI--EIKKETYEE-----
RNFB_BUCA5      IHTVLQEFCTGCNICLLHCPTNCI--EIKKETYEE-----
PORD_METTH      EHEIDYDYCKGCGICAEKCPVKAIKMEREK----------
PORD_METJA      NFKIDYDYCKGCLICMNECPVNA-----------------
NUOI_THEFY      VYQINYLRCILCGLCVEACPTRA-----------------
NUOI_RICTY      RDDIDMTKCIYCGLCQEACPVDA-----------------
NUOI_HELHP      NYSINFGRCIYCGLCAEVCP--------------------
NUOI_FRASN      VYQINYLRCILCGLCIEACPTRA-----------------
NUOI_FRASC      VYQINYLRCILCGLCIEACPTRA-----------------
NQO9_THET8      NDPENPVSCIFCGLCEEACPTGA-----------------
NQO9_THET2      NDPENPVSCIFCGLCEEACPTGA-----------------
FER7_METJA      NGKYDVEYCHNCKFCAGRCPTNA-----------------
FER1_CAUCR      ---INPDECIDCGVCEPECPVDAIKPDTEDEAWLKI----
FDHL_STAAW      DVPINESSCVSCGQCATVCPCNA-----------------
FDHL_STAAS      DVPINESSCVSCGQCATVCPCNA-----------------
FDHL_STAAR      DVPINESSCVSCGQCATVCPCNA-----------------
FDHL_STAAN      DVPINESSCVSCGQCATVCPCNA-----------------
FDHL_STAAM      DVPINESSCVSCGQCATVCPCNA-----------------
FDHL_STAAC      DVPINESSCVSCGQCATVCPCNA-----------------
FDHL_STAAB      DVPINESSCVSCGQCATVCPCNA-----------------
FDHL_STAA8      DVPINESSCVSCGQCATVCPCNA-----------------
FDHL_STAA3      DVPINESSCVSCGQCATVCPCNA-----------------
RNFB_SALAR      MHTVMSDLCTGCNLCVDPCP--------------------
PPD_STRHY       ----------------------------------------
ODPA_RHIME      ----------------------------------------
NUOI_WOLTR      RYDIDMTKCIYCGLCQEACPVDA-----------------
NUOI_SACEN      RYGMDYQICIGCGLCIEACP--------------------
NUOI_PROAC      VYEINYLRCILCGMCIEACPTRA-----------------
NUOI_ORITI      KYDIDMTKCIYCGLCQEACPVDA-----------------
NUOI_ORITB      KYDIDMTKCIYCGLCQEACPVDA-----------------
NUOI_CAMJR      KKSINLGRCIYCGFCAEVCP--------------------
NUOI_CAMJJ      KKSINLGRCIYCGFCAEVCP--------------------
NUOI_CAMJE      KKSINLGRCIYCGFCAEVCP--------------------
NUOI_CAMJD      KKSINLGRCIYCGFCAEVCP--------------------
NUOI_CAMJ8      KKSINLGRCIYCGFCAEVCP--------------------
NUOI2_STRCO     ---IDFALCMYCGICIEVCPFDA-----------------
ILVB_PORUM      ----------------------------------------
ILVB_PORPU      ----------------------------------------
HYCF_ECOLI      ATEFNLGHCIFCGRCEEVCPTAAIKLSQEYE--LAVWKK-
HMEA_ARCFU      IVEIDMHRCIGCRYCMIACPYGA-----------------
FER_CLOPE       QFVIDADTCIDCGNCANVCPVGA-----------------
FER_CLOPA       IFVIDADTCIDCGNCANVCPVGA-----------------
YCXI_PORPU      NTWIDFAACIDCSICIQVCP--------------------
RNFB_SHIFL      MHTVMSDLCTGCNLCVDPCP--------------------
RNFB_SHIBS      MHTVMSDLCTGCNLCVDPCP--------------------
PHSB_SALTY      IVQVDKSRCIGCDYCVAACPFH------------------
PHSB_SALTI      IVQVDKSRCIGCDYCVAACPFH------------------
NUOI_CARHZ      SYEMEMKYCLFCGLCVEACPTNA-----------------
NUOI_ANAPZ      RSDIDMTKCIYCGFCQEACPVDA-----------------
FERA_METJA      IIVIDEKKCNNCKLCTIVCPLNALEGE-------------
FDXN_RHOCA      ---IDPELCTSCGDCEPVCPTNAIAPK-------------
AB1E_ARATH      SAFISEELCIGCGICVKKCPFEAIQ---------------
VHCB_METVO      -IEFTPSLCDSCGACVEICPQNVLK---------------
RPOD_ARCFU      VRVKNVMACSMCGECVEVCEMNA-----------------
RNFB_PECCP      VHTVVSDLCTGCDLCVAPCP--------------------
RNFB_MAGSM      SHTVIVAECTSCQLCLEPCP--------------------
RNFB_HAEDU      MHTVVADLCTGCELCVAPCPTNCIE---------------
RLI1_YEAST      -AFISEILCIGCGICVKKCPFDAIQ---------------
NUOI_EHRCR      RYDIDMTKCIYCGFCQEACPVDA-----------------
NUOI_EHRCJ      RYDIDMTKCIYCGFCQEACPVDA-----------------
NUOI_CAUCR      RYDIDMVKCIYCGLCQEACPVDA-----------------
NUOI_CAMHC      KKVLNYSICVYCGLCADVCP--------------------
NDUS8_TOBAC     RYDIDMTKCIYCGFCQEACPVDA-----------------
NDUS8_SOLTU     RYDIDMTKCIYCGFCQEACPVDA-----------------
FRHG_METJA      RPNVLKELCIKCGACSVQCP--------------------
FPRB_MYCTU      PGYIDPVACVDCGACVTACPVSAIAP--------------
FPRB_MYCBO      PGYIDPVACVDCGACVTACPVSAIAP--------------
FDHL_STAHJ      DVPINESSCVSCGQCATVCPCNA-----------------
YNFG_ECOLI      FVVVDEDVCIGCRYCHMACPYGA-----------------
YNFG_ECOL6      FVVVDEDVCIGCRYCHMACPYGA-----------------
Y726_METJA      KPKVNISKCIKCGTCFFNC---------------------
RNFB_TOLAT      MHTILRSECTGCDLCVDPCPTNCIE---------------
RNFB_PASMU      MHTIIPDLCTGCELCVPPCP--------------------
NUOI_RICM5      REDIDMTKCIYCGLCQAACPVDA-----------------
NUOI_RALEH      RADIDLTKCIFCGFCEEACPVDA-----------------
NUOI_NOCSJ      VYQINYLRCILCGLCIEACPTRA-----------------
NUOI_CUPTR      RADIDLTKCIFCGFCEEACPVDA-----------------
NUOI2_SYNFM     RRHINFARCIYCGLCEEACPTSAIQ---------------
NUOI2_STRAW     ---IDFSLCMYCGICIEVCPFDA-----------------
NUOI1_SYNFM     KAQIDFTRCSLCGICVESCP--------------------
NDUS8_PONAB     RADIDMTKCIYCGFCQEACPVDA-----------------
NDUS8_PANTR     RADIDMTKCIYCGFCQEACPVDA-----------------
NDUS8_MOUSE     RADIDMTKCIYCGFCQEACPVDA-----------------
NDUS8_HUMAN     RADIDMTKCIYCGFCQEACPVDA-----------------
NDUS8_GORGO     RADIDMTKCIYCGFCQEACPVDA-----------------
NDUS8_ARATH     RYDIDMTKCIYCGFCQEACPVDA-----------------
NAPH_HAEIN      SLLVLSKDCISCGRCIDVCAEKVFK---------------
HDRA1_METKA     -RYVDEDACTGCGVCAEVCP--------------------
FWDG_METJA      WGGKGPYLCGGCGACIEACPVNAIELVFKRK---------
FPRB_MYCLE      PGYIDPVACVDCGACVSACPVGA-----------------
FER_THET8       -FYIHPEECIDCGACVPACPVNAIYPE-------------
FER4_METJA      VVVARPDDCTYCGVCEDVCPTGAVKVE-------------
DPYD_DANRE      HLPVITDSCTGCTLCLSVCP--------------------
AB2E_ARATH      -AFISEELCIGCGICVKKCPFEAIQ---------------