[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL64972.1

[Show Plain Result]


## Summary of Sequence Search
    1::251
    3::185     1e-12  30%  189 aa  RES2_CLOPE RecName: Full=Resolvase;
    3::185     1e-10  29%  189 aa  RES1_CLOPE RecName: Full=Resolvase;
    4::134     3e-09  36%  191 aa  TNR6_ENTFC RecName: Full=Transposon Tn1546 resolvase;
    3::136     2e-08  34%  184 aa  PINE_ECOLI RecName: Full=DNA-invertase from lambdoid prophage e14;
    1::187     6e-08  29%  194 aa  TNR0_ECOLX RecName: Full=Transposon Tn2501 resolvase;
    7::186     4e-07  33%  196 aa  PINQ_ECOLI RecName: Full=Putative DNA-invertase from lambdoid
    7::200     9e-07  30%  210 aa  STBA_PSESM RecName: Full=Resolvase;
    7::186     1e-06  32%  196 aa  PINR_ECOLI RecName: Full=Putative DNA-invertase from lambdoid
    7::186     1e-06  32%  196 aa  PINR_ECOL6 RecName: Full=Putative DNA-invertase from lambdoid
    3::136     3e-06  32%  193 aa  DNIV_BPMU RecName: Full=DNA-invertase;
    3::128     8e-06  33%  186 aa  DNIV_BPP7 RecName: Full=DNA-invertase;AltName: Full=Site-specific
    3::128     1e-05  33%  186 aa  DNIV_BPP1 RecName: Full=DNA-invertase;AltName: Full=Site-specific
    6::181     1e-04  27%  185 aa  TNR4_KLEPN RecName: Full=Transposon Tn1331 resolvase;
    6::181     1e-04  27%  185 aa  TNR3_KLEPN RecName: Full=Transposon Tn3 resolvase;
    6::181     1e-04  27%  185 aa  TNR3_ECOLX RecName: Full=Transposon Tn3 resolvase;
    6::182     2e-04  24%  183 aa  TNR1_ECOLI RecName: Full=Transposon gamma-delta resolvase;AltName:
    6::181     2e-04  26%  190 aa  RES4_ECOLX RecName: Full=R46 site-specific recombinase;
  168::345     4e-04  23%  558 aa  SYR_METLZ RecName: Full=Arginyl-tRNA synthetase;       
   17::178     0.001  30%  298 aa  ODC_SCHPO RecName: Full=Probable mitochondrial 2-oxodicarboxylate
    1::251

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MITAVTYIRVSTEEQDPENQRVFLERWAGERGIYIVKHYVDVGVSGATEPWERPAFRQMASEVDKLEPRP
RES2_CLOPE      ----VGYARVSTEEQSLNRQDMLVDYGVDKRNIYQEK------ISGM-----KPNREQLDKMIDELQEGD
RES1_CLOPE      ----VGYARVSTEGQSLNRQDMLVDYGLDKRNIYQEK------ISGTK--LRRDQLDKMIEELQEGD---
TNR6_ENTFC      ----IGYIRVSSTNQNPSRQFQQLN----EIGMDII---YEEKVSGATKDRE-----QLQKVLDDLQ-ED
PINE_ECOLI      ----IGYVRVSTNDQNTDLQRNALN-CAGCELIFEDK------ISGTKS--ERPGLKKLLRTLSAGD---
TNR0_ECOLX      MSRVFAYCRVSTLEQTTENQRREIEA----AGFAIPQRLIEEHISGSVAASERPGFIRL---LDRME-NG
PINQ_ECOLI      ------YCRISTLDQTTENQRREIE----SAGFKIKQQIIEEHISGSAATSERPGFNRLLARLKCGDQ--
STBA_PSESM      ---ARVYLRVSSEDQDLQRQEAIIGN-ARESGYYVAAVYREKA-SGARS--DRPELLRM---IEDLQPG-
PINR_ECOLI      ------YCRISTLDQTTENQRREIE----SAGFKIKQQIIEEHISGSAATSERPGFNRLLARLKCGDQ--
PINR_ECOL6      ------YCRISTLDQTTENQRREIE----SAGFKIKQQIIEEHISGSAATSERPGFNRLLARLKCGDQ--
DNIV_BPMU       ----IGYVRVSTNDQNTDLQRNALV-CAGCEQIFEDK------LSGTRT--DRPGLKRALKRLQKGD---
DNIV_BPP7       ----IGYVRVSTNEQNTALQRNALES-AGCELIFEDK--------ASGKQTERPGLKKVL----RMLSRG
DNIV_BPP1       ----IGYVRVSTNEQNTALQRNALES-AGCELIFEDK--------ASGKKAERPGLKKVL----RMLSRG
TNR4_KLEPN      ------YARVSTSQQSLDIQI----RAVKDAGVKANRIFTDKASGSSTDREGLDLLRMKVEEGD------
TNR3_KLEPN      ------YARVSTSQQSLDIQIRALK----DAGVKANRIFTDKASGSSTDREGLDLLRMKVEEGD------
TNR3_ECOLX      ------YARVSTSQQSLDIQIRALK----DAGVKANRIFTDKASGSSTDREGLDLLRMKVEEGD------
TNR1_ECOLI      ------YARVSTSQQSLDIQVRALK----DAGVKANRIFTDKASGSSSDRKGLDLLRMKVEEGD------
RES4_ECOLX      ------YARVSTSQQSLDIQIKGLK----EAGVKASRIFTDKASGSSTDRKGLDLLRMKVEEGD------
SYR_METLZ       -------------------QNLHYDRIPGEKGDYIVRHYVEANKIAKAKPEIEPEFDLLMEKIEAGDPET
ODC_SCHPO       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RVLLVYEISRLVRSFQELFTLLDVVENRLGLVVVSASEREQALQNLDGVYRQFLRAVLAFVATMEREFIR
RES2_CLOPE      TVIIT-DLTRISRSTKDL---LNIIDRXXXXXXXXXXXXDTWLDSSDNPYNSFLLTVMSGLSQLERDLIS
RES1_CLOPE      -TVIITDLTRISRSTKDLLNIIDRIKEK-GASIKSLKDTWLDTSG-DNPYNSFLLTVMSGLSQLERDLIS
TNR6_ENTFC      DIIYVTDLTRITRSTQDLFELIDNIRDKKASL---KSLKDTWLDSEDNPYSQFLITVMAGVNQLERDLIR
PINE_ECOLI      -TLVVWKLDRLGRSMRHLVVLVEELRER-GINFRSLTDSIDTSTPMG----RFFFHVMGALAEMERELIV
TNR0_ECOLX      DVLIVTKLDRLGRNAMDIRKTVEQLASSLGGVDLTSAAGRMTMQ------------VISAVAEFERDLLL
PINQ_ECOLI      --LIVTKLDRLIRKTVEQLTETGIRVHCLALGGI----------DLTSPTGKMMMQVISAVAEFERDLLL
STBA_PSESM      EVVIAEKIDRISRPLVEAEKLVDAIRAKVDLSQLTEASRGVAKVVLQGVQDMLLRVALQ-IAXXXXXXXX
PINR_ECOLI      --LIVTKLDRLIRKTVEQLTETGIRVHCLALGGI----------DLTSPTGKMMMQVISAVAEFERDLLL
PINR_ECOL6      --LIVTKLDRLIRKTVEQLTETGIRVHCLALGGI----------DLTSPTGKMMMQVISAVAEFERDLLL
DNIV_BPMU       -TLVVWKLDRLGRSMKHLISLVGELRER-GINFRSLTDSIDTSSPMG----RFFFHVMGALAEMERELII
DNIV_BPP7       DTLVVWKLDRLGRSMRHLVVLVEELRDR-GINFRSLTDSIDTSTPMG----RFFFHVMGALAEMERELIV
DNIV_BPP1       DTLVVWKLDRLGRSMRHLVVLVEELRDR-GINFRSLTDSIDTSTPMG----RFFFHVMGALAEMERELIV
TNR4_KLEPN      -VILVKKLDRLGRDTADMIQLIKEFDAQ-GVAVRFIDDGIST----DGDMGQMVVTILSAVAQAERRRIL
TNR3_KLEPN      -VILVKKLDRLGRDTADMIQLIKEFDAQ-GVAVRFIDDGIST----DGDMGQMVVTILSAVAQAERRRIL
TNR3_ECOLX      -VILVKKLDRLGRDTADMIQLIKEFDAQ-GVAVRFIDDGIST----DGDMGQMVVTILSAVAQAERRRIL
TNR1_ECOLI      -VILVKKLDRLGRDTADMIQLIKEFDAQ----GVSIRFIDDGIST-DGEMGKMVVTILSAVAQAERQRIL
RES4_ECOLX      -VTLVKKLDRLGRDTADMIQLTKEFDAQ-GVAVRFIDDGIST----DGEMGKMVVTILSAVAQAERRRIL
SYR_METLZ       VKLFHDSVDICADGIKETLSSMNVVHDKFVRETTSMQDVLNRIEKLPIVHHQMMYLDLSDEGFGNRYVLR
ODC_SCHPO       -----------VAGISEVLTLLDVVKTRMQLSVGKSDYNKKIVKN-EGPHRLY-RGILPPI-------LM


                         +         .         .         .         .         *         .:210
query           QRTKTALERARLQGKVWNVAEKRRDLTQAVVEMYLSGASLRETARAFGLSLYEVRRILSNAGVYRPSPYT
RES2_CLOPE      QRTKEGLKSAKARGRNGGRPSKRNDKADTVGLLYREGYKIVDIVKQTGLSRATVYRVLND----------
RES1_CLOPE      QRTKEGLRSAKARGRNGGRPSKRNDKADTVGLLYREGYKIVDIVKQTELSRATVYRILKD----------
TNR6_ENTFC      MRQREGIELA------------------------------------------------------------
PINE_ECOLI      ERTKAGLETARAQGRI------------------------------------------------------
TNR0_ECOLX      ERTHSGIARAKATGKRFGRPSALNEEQQTVIARINAGISISAIAREFNTTRQTILRV-------------
PINQ_ECOLI      ERTHSGIVRARGAGKVLNEEQK-----QAVFERIKSGVSISAIAREFKTSRQTILR--------------
STBA_PSESM      XXXXXGIDLAKGAGRY---AGRKPDMHERVIALKSGGCSIAETARLAGVSVSQVKRV-------------
PINR_ECOLI      ERTHSGIVRARGAGKVLNEEQK-----QVVFERIKSGVSISAIAREFKTSRQTILR--------------
PINR_ECOL6      ERTHSGIVRARGAGKVLNEEQK-----QVVFERIKSGVSISAIAREFKTSRQTILR--------------
DNIV_BPMU       ERTMAGLAAARNKGRI------------------------------------------------------
DNIV_BPP7       ERTRAGLD--------------------------------------------------------------
DNIV_BPP1       ERTRAGLD--------------------------------------------------------------
TNR4_KLEPN      ERTNEGRQEAKLKGIKFG---RRRTVDRNVVTLHQKGTGATEIAHQLSIARSTVYKILED----------
TNR3_KLEPN      ERTNEGRQEAKLKGIKFG---RRRTVDRNVVTLHQKGTGATEIAHQLSIARSTVYKILED----------
TNR3_ECOLX      ERTNEGRQEAKLKGIKFG---RRRTVDRNVVTLHQKGTGATEIAHQLSIARSTVYKILED----------
TNR1_ECOLI      ERTNEGRQEAMAKGVVF--GRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINES---------
RES4_ECOLX      ERTNEGRQEAKLKG--IRFGRKRIIDRNSVLALHQQGTGATDIARRLSIARSTVYKILED----------
SYR_METLZ       RSNGTSVYAARLAFHLWKNAQCDRSIDVLGADHKLIGAQLQTTLKLIG----------------------
ODC_SCHPO       EAPKRALKFASTYSKLWRKVFKRKDSSPALSILTGSCAGFTETFVVVPFELMKIRQDVKNASKYNGTV--


                         .         .         .         +         .         .         .:280
query           CPRCFSKMKVAERTAKISNGKYTVVERLYCYNCGYxxxxxx
RES2_CLOPE      -----------------------------------------
RES1_CLOPE      -----------------------------------------
TNR6_ENTFC      -----------------------------------------
PINE_ECOLI      -----------------------------------------
TNR0_ECOLX      -----------------------------------------
PINQ_ECOLI      -----------------------------------------
STBA_PSESM      -----------------------------------------
PINR_ECOLI      -----------------------------------------
PINR_ECOL6      -----------------------------------------
DNIV_BPMU       -----------------------------------------
DNIV_BPP7       -----------------------------------------
DNIV_BPP1       -----------------------------------------
TNR4_KLEPN      -----------------------------------------
TNR3_KLEPN      -----------------------------------------
TNR3_ECOLX      -----------------------------------------
TNR1_ECOLI      -----------------------------------------
RES4_ECOLX      -----------------------------------------
SYR_METLZ       -----------------------------------------
ODC_SCHPO       --DCFTKIVKQERILALYNGFEATMWRHVVWNAGY------