[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL65054.1

[Show Plain Result]


## Summary of Sequence Search
    1::346
    8::330     9e-45  31%  647 aa  NOG1_YEAST RecName: Full=Nucleolar GTP-binding protein 1;
    8::353     1e-43  31%  643 aa  NOG1_KLULA RecName: Full=Nucleolar GTP-binding protein 1;
    8::329     2e-43  30%  642 aa  NOG1_ASHGO RecName: Full=Nucleolar GTP-binding protein 1;
    8::353     8e-43  31%  645 aa  NOG1_CANGA RecName: Full=Nucleolar GTP-binding protein 1;
   16::305     7e-42  33%  528 aa  NOG1_ENCCU RecName: Full=Nucleolar GTP-binding protein 1;
   62::350     7e-42  35%  652 aa  NOG1_DROME RecName: Full=Probable nucleolar GTP-binding protein 1;
   63::351     2e-41  34%  681 aa  NOG1_CAEEL RecName: Full=Probable nucleolar GTP-binding protein 1;
    1::299     2e-40  31%  674 aa  NOG1_DICDI RecName: Full=Probable nucleolar GTP-binding protein 1;
    8::331     4e-40  32%  634 aa  NOG1_MOUSE RecName: Full=Nucleolar GTP-binding protein 1;AltName:
    8::331     2e-39  31%  634 aa  NOG1_HUMAN RecName: Full=Nucleolar GTP-binding protein 1;AltName:
    8::331     4e-39  31%  637 aa  NOG1_RAT RecName: Full=Nucleolar GTP-binding protein 1;AltName:
   70::301     5e-37  35%  671 aa  NOG1_ARATH RecName: Full=Probable nucleolar GTP-binding protein 1;
   10::320     9e-37  30%  350 aa  Y1408_METJA RecName: Full=Uncharacterized protein MJ1408;
   45::300     9e-37  33%  655 aa  NOG1_TRYBB RecName: Full=Nucleolar GTP-binding protein 1;
   64::301     1e-36  35%  642 aa  NOG1_SCHPO RecName: Full=Probable nucleolar GTP-binding protein 1;
  154::340     2e-15  37%  563 aa  OBG_BIFLO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  154::340     3e-15  37%  563 aa  OBG_BIFLI RecName: Full=GTPase obg;AltName: Full=GTP-binding
  154::340     7e-15  36%  563 aa  OBG_BIFLD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::343     3e-14  36%  385 aa  OBG_SYNJA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::326     1e-13  38%  390 aa  OBG_VIBF1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::335     1e-13  37%  370 aa  OBG_BURP8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::336     2e-13  38%  356 aa  OBG_PELCD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::332     2e-13  38%  398 aa  OBG_CELJU RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::324     2e-13  33%  328 aa  OBG_RICBR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::324     2e-13  33%  328 aa  OBG_RICB8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::326     3e-13  37%  390 aa  OBG_VIBFM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::322     3e-13  35%  334 aa  OBG_FRATM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::345     3e-13  33%  427 aa  OBG_CALS8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::324     4e-13  29%  330 aa  OBG_RICCN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::305     4e-13  37%  392 aa  OBG_ERWT9 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::340     4e-13  34%  363 aa  OBG_DECAR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::345     4e-13  33%  427 aa  OBG_ANATD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::324     5e-13  35%  347 aa  OBG_SYNJB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::305     5e-13  41%  405 aa  OBG_PSYCK RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::324     7e-13  40%  388 aa  OBG_SHEDO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::332     7e-13  39%  389 aa  OBG_SHEB9 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::332     7e-13  39%  389 aa  OBG_SHEB8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::332     7e-13  39%  389 aa  OBG_SHEB5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::332     7e-13  39%  389 aa  OBG_SHEB2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::322     7e-13  35%  334 aa  OBG_FRATW RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::322     7e-13  35%  334 aa  OBG_FRATT RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::322     7e-13  35%  334 aa  OBG_FRATN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::322     7e-13  35%  334 aa  OBG_FRAT1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::346     7e-13  35%  570 aa  OBG_BIFA0 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::305     9e-13  40%  405 aa  OBG_PSYA2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::326     9e-13  35%  404 aa  OBG_AZOSE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::324     1e-12  29%  330 aa  OBG_RICFE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::295     2e-12  36%  389 aa  OBG_SHEWM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::324     2e-12  37%  388 aa  OBG_SHEPW RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::339     2e-12  35%  406 aa  OBG_PSEMY RecName: Full=GTPase obg;AltName: Full=GTP-binding
  145::330     2e-12  37%  485 aa  OBG_MYCSS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  145::330     2e-12  37%  485 aa  OBG_MYCSK RecName: Full=GTPase obg;AltName: Full=GTP-binding
  145::330     2e-12  37%  485 aa  OBG_MYCSJ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::332     2e-12  35%  369 aa  OBG_HERAR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::324     2e-12  36%  334 aa  OBG_VESOH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::295     2e-12  38%  387 aa  OBG_SHEHH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::324     2e-12  31%  330 aa  OBG_RICAH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::324     2e-12  35%  389 aa  OBG_PROMH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::332     2e-12  37%  391 aa  OBG_PHOLL RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::333     2e-12  40%  485 aa  OBG_MYCS2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::289     2e-12  34%  435 aa  OBG_DICT6 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  220::349     2e-12  44%  406 aa  GTPB5_HUMAN RecName: Full=GTP-binding protein 5;AltName:
  159::332     3e-12  35%  362 aa  OBG_POLSQ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::322     3e-12  41%  396 aa  OBG_MARMS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::340     3e-12  32%  369 aa  OBG_JANMA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::329     3e-12  36%  402 aa  OBG_SACD2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::324     3e-12  28%  330 aa  OBG_RICM5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::325     3e-12  32%  419 aa  OBG_COPPD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::324     4e-12  36%  390 aa  OBG_VIBPA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::324     4e-12  28%  330 aa  OBG_RICRS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::324     4e-12  28%  330 aa  OBG_RICRO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::331     4e-12  37%  386 aa  OBG_PSYIN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::329     4e-12  38%  387 aa  OBG_COLP3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::292     4e-12  37%  391 aa  OBG_ACTSZ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     4e-12  36%  406 aa  OBG_ACIBY RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     4e-12  36%  406 aa  OBG_ACIBT RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     4e-12  36%  406 aa  OBG_ACIBS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     4e-12  36%  406 aa  OBG_ACIBC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     4e-12  36%  406 aa  OBG_ACIB5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     4e-12  36%  406 aa  OBG_ACIB3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::328     6e-12  35%  346 aa  OBG_THICR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::299     6e-12  40%  435 aa  OBG_THESQ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::299     6e-12  40%  435 aa  OBG_THEP1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::299     6e-12  40%  435 aa  OBG_THEMA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::324     6e-12  37%  387 aa  OBG_SHEPA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::332     6e-12  38%  480 aa  OBG_MYCVP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::297     6e-12  33%  340 aa  OBG_BLOPB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::339     6e-12  36%  400 aa  OBG_ACIAD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::324     7e-12  37%  390 aa  OBG_VIBSL RecName: Full=GTPase obg;AltName: Full=GTP-binding
  167::297     7e-12  36%  434 aa  OBG_THEM4 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::324     7e-12  38%  407 aa  OBG_PSEU2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::324     7e-12  38%  407 aa  OBG_PSE14 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::333     7e-12  35%  373 aa  OBG_BURXL RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::332     7e-12  35%  370 aa  OBG_BURCM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::332     7e-12  35%  370 aa  OBG_BURCJ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::332     7e-12  35%  370 aa  OBG_BURCH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::332     7e-12  35%  370 aa  OBG_BURCC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::332     7e-12  35%  370 aa  OBG_BURCA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::332     7e-12  35%  370 aa  OBG_BURA4 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  220::349     7e-12  42%  406 aa  GTPB5_PONAB RecName: Full=GTP-binding protein 5;
  163::332     1e-11  33%  337 aa  OBG_SOLUE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::348     1e-11  40%  492 aa  OBG_SACEN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::322     1e-11  34%  334 aa  OBG_FRATO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::322     1e-11  34%  334 aa  OBG_FRATH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::322     1e-11  34%  334 aa  OBG_FRATF RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::298     1e-11  39%  366 aa  OBG_DESDA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  197::350     1e-11  33%  460 aa  MNME_SYNP2 RecName: Full=tRNA modification GTPase mnmE;       
  168::324     1e-11  33%  388 aa  OBG_VIBVY RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::293     1e-11  34%  349 aa  OBG_RHOP5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::294     1e-11  32%  356 aa  OBG_OLICO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::298     1e-11  32%  517 aa  OBG_CLAMS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::298     1e-11  32%  512 aa  OBG_CLAM3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::325     1e-11  35%  373 aa  OBG_BURPP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::328     1e-11  35%  430 aa  OBG_ALKOO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::335     2e-11  34%  342 aa  OBG_SYNAS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::340     2e-11  29%  349 aa  OBG_RHOPB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     2e-11  36%  408 aa  OBG_PSEPK RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     2e-11  36%  408 aa  OBG_PSEP1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::332     2e-11  37%  397 aa  OBG_PSEA6 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  145::333     2e-11  36%  482 aa  OBG_MYCGI RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::295     2e-11  36%  390 aa  OBG_MANSM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::305     2e-11  36%  392 aa  OBG_HAES2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  167::289     2e-11  34%  434 aa  OBG_DICTD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::339     2e-11  38%  386 aa  OBG_CHRVO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::334     2e-11  37%  377 aa  OBG_BORPE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::334     2e-11  37%  377 aa  OBG_BORPA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::334     2e-11  37%  377 aa  OBG_BORBR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  144::275     2e-11  34%  328 aa  OBG2_ANAMM RecName: Full=GTPase obg 2;AltName: Full=GTP-binding
  144::275     2e-11  34%  328 aa  OBG2_ANAMF RecName: Full=GTPase obg 2;AltName: Full=GTP-binding
  164::295     2e-11  34%  348 aa  OBG1_ANAMM RecName: Full=GTPase obg 1;AltName: Full=GTP-binding
  164::295     2e-11  34%  348 aa  OBG1_ANAMF RecName: Full=GTPase obg 1;AltName: Full=GTP-binding
  158::319     2e-11  34%  419 aa  OBG_SYNWW RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::319     2e-11  32%  351 aa  OBG_RHOCS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     2e-11  36%  408 aa  OBG_PSEPG RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::324     2e-11  37%  390 aa  OBG_PHOPR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::299     2e-11  33%  344 aa  OBG_JANSC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  169::328     2e-11  35%  366 aa  OBG_DESVV RecName: Full=GTPase obg;AltName: Full=GTP-binding
  169::328     2e-11  35%  366 aa  OBG_DESVH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::334     2e-11  33%  372 aa  OBG_BURP6 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::325     2e-11  37%  427 aa  OBG_ALKMQ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::305     3e-11  40%  390 aa  OBG_YERPY RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::305     3e-11  40%  390 aa  OBG_YERPS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::305     3e-11  40%  390 aa  OBG_YERPP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::305     3e-11  40%  390 aa  OBG_YERPN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::305     3e-11  40%  390 aa  OBG_YERPG RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::305     3e-11  40%  390 aa  OBG_YERPE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::305     3e-11  40%  390 aa  OBG_YERPB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::305     3e-11  40%  390 aa  OBG_YERPA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::305     3e-11  40%  390 aa  OBG_YERP3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::324     3e-11  35%  391 aa  OBG_VIBHB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::324     3e-11  35%  391 aa  OBG_VIBHA RecName: Full=GTPase obg/cgtA;AltName: Full=GTP-binding
  166::290     3e-11  31%  330 aa  OBG_RICCK RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::330     3e-11  38%  402 aa  OBG_PSYWF RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::334     3e-11  35%  378 aa  OBG_BORPD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::324     3e-11  35%  400 aa  OBG_AERS4 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::305     4e-11  38%  390 aa  OBG_YERE8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::333     4e-11  32%  350 aa  OBG_THIDA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::330     4e-11  35%  438 aa  OBG_THENN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::319     4e-11  34%  344 aa  OBG_SILPO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::326     4e-11  38%  389 aa  OBG_SHEAM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::293     4e-11  35%  358 aa  OBG_NITWN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::331     4e-11  36%  345 aa  OBG_NITOC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::330     4e-11  33%  397 aa  OBG_MARAV RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::331     4e-11  33%  338 aa  OBG_GEOLS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::322     4e-11  34%  334 aa  OBG_FRAP2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::328     4e-11  33%  424 aa  OBG_CLOTH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::332     4e-11  34%  370 aa  OBG_BURVG RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::334     4e-11  34%  372 aa  OBG_BURPS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::334     4e-11  34%  372 aa  OBG_BURP1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::334     4e-11  34%  372 aa  OBG_BURP0 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::334     4e-11  34%  372 aa  OBG_BURMS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::334     4e-11  34%  372 aa  OBG_BURMA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::334     4e-11  34%  372 aa  OBG_BURM9 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::334     4e-11  34%  372 aa  OBG_BURM7 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  165::251     5e-11  43%  407 aa  OBG_RHOBA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::287     5e-11  41%  407 aa  OBG_PSEE4 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::302     5e-11  39%  479 aa  OBG_MYCMM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::291     5e-11  33%  346 aa  OBG_METSB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  161::296     5e-11  32%  340 aa  OBG_EHRCR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::296     5e-11  31%  340 aa  OBG_EHRCJ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  169::303     5e-11  37%  366 aa  OBG_DESDG RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::331     5e-11  34%  503 aa  OBG_CORJK RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::316     5e-11  31%  338 aa  OBG_CHLL2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::332     5e-11  34%  370 aa  OBG_BURS3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::324     6e-11  33%  389 aa  OBG_VIBVU RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::328     6e-11  32%  337 aa  OBG_PARUW RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::305     6e-11  36%  392 aa  OBG_HAES1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  103::336     6e-11  32%  353 aa  OBG_ANADF RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::324     6e-11  37%  400 aa  OBG_AERHH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::292     8e-11  35%  478 aa  OBG_STRCO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::305     8e-11  36%  385 aa  OBG_SODGM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::324     8e-11  37%  386 aa  OBG_SHESH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::332     8e-11  38%  407 aa  OBG_PSEPF RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::293     8e-11  37%  358 aa  OBG_NITHX RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::332     8e-11  34%  369 aa  OBG_BURM1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::286     8e-11  38%  392 aa  OBG_ALTMD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  180::332     8e-11  39%  350 aa  OBG_AKKM8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  169::289     1e-10  40%  433 aa  OBG_THELT RecName: Full=GTPase obg;AltName: Full=GTP-binding
  141::324     1e-10  29%  330 aa  OBG_RICTY RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::326     1e-10  36%  365 aa  OBG_RALME RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::302     1e-10  39%  479 aa  OBG_MYCUA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::329     1e-10  34%  368 aa  OBG_DESVM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::316     1e-10  36%  338 aa  OBG_CHLCH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::293     1e-10  33%  356 aa  OBG_BRASO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     1e-10  47%  341 aa  OBG_BART1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::308     1e-10  34%  408 aa  OBG_AZOSB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::324     1e-10  37%  392 aa  OBG_ALISL RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::286     1e-10  40%  391 aa  OBG_ACTPJ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::286     1e-10  40%  391 aa  OBG_ACTP7 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::286     1e-10  40%  391 aa  OBG_ACTP2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
   68::375     1e-10  32%  448 aa  MNME_AQUAE RecName: Full=tRNA modification GTPase mnmE;       
  162::321     1e-10  31%  478 aa  OBG_STRGR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::321     1e-10  31%  478 aa  OBG_STRGG RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::332     1e-10  36%  387 aa  OBG_SHELP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::326     1e-10  35%  365 aa  OBG_RALEJ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::254     1e-10  42%  408 aa  OBG_PSEPW RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::282     1e-10  31%  421 aa  OBG_PHYMT RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::282     1e-10  35%  343 aa  OBG_PARDP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::294     1e-10  35%  344 aa  OBG_METEP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::294     1e-10  35%  344 aa  OBG_METC4 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::290     1e-10  37%  390 aa  OBG_HAEIN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::290     1e-10  37%  390 aa  OBG_HAEI8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::294     1e-10  39%  350 aa  OBG_GLUDA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::324     2e-10  30%  335 aa  OBG_RUTMC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::293     2e-10  31%  353 aa  OBG_RHOP2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::332     2e-10  34%  364 aa  OBG_RALPJ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::326     2e-10  35%  365 aa  OBG_RALEH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::217     2e-10  41%  329 aa  OBG_ORITI RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::217     2e-10  41%  329 aa  OBG_ORITB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::332     2e-10  34%  384 aa  OBG_IDILO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::290     2e-10  37%  403 aa  OBG_HAEIG RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::290     2e-10  37%  403 aa  OBG_HAEIE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::293     2e-10  32%  356 aa  OBG_BRASB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  153::306     2e-10  33%  383 aa  GTPBA_XENLA RecName: Full=GTP-binding protein 10;
  164::293     2e-10  31%  353 aa  OBG_RHOPT RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::293     2e-10  31%  353 aa  OBG_RHOPA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::286     2e-10  42%  405 aa  OBG_PSEU5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::301     2e-10  33%  384 aa  OBG_NEIMF RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::301     2e-10  33%  384 aa  OBG_NEIMB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::328     2e-10  31%  513 aa  OBG_KINRD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::327     2e-10  35%  439 aa  OBG_FERNB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::307     2e-10  39%  343 aa  OBG_BDEBA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     2e-10  29%  357 aa  OBG_ACISJ RecName: Full=GTPase obg;AltName: Full=GTP-binding
   99::385     2e-10  31%  464 aa  MNME_PROM1 RecName: Full=tRNA modification GTPase mnmE;       
  163::288     3e-10  34%  419 aa  OBG_UNCTG RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::322     3e-10  32%  479 aa  OBG_STRAW RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     3e-10  37%  344 aa  OBG_ROSDO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::317     3e-10  30%  342 aa  OBG_RHOSK RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::293     3e-10  34%  353 aa  OBG_RHOPS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::329     3e-10  34%  385 aa  OBG_PSEHT RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::326     3e-10  34%  359 aa  OBG_CYAP4 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::326     3e-10  35%  365 aa  OBG_CUPTR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::332     3e-10  33%  372 aa  OBG_BURTA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::293     3e-10  31%  346 aa  OBG_BRAJA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::319     3e-10  35%  371 aa  OBG_AGRRK RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::317     4e-10  30%  342 aa  OBG_RHOS4 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::317     4e-10  30%  342 aa  OBG_RHOS1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::301     4e-10  33%  384 aa  OBG_NEIMA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::301     4e-10  32%  384 aa  OBG_NEIM0 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::301     4e-10  33%  384 aa  OBG_NEIG2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::301     4e-10  33%  384 aa  OBG_NEIG1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::290     4e-10  38%  423 aa  OBG_MOOTA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     4e-10  32%  341 aa  OBG_LEGPH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     4e-10  32%  341 aa  OBG_LEGPC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     4e-10  32%  341 aa  OBG_LEGPA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::298     4e-10  35%  335 aa  OBG_GLOVI RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::292     4e-10  39%  338 aa  OBG_GEOMG RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::331     4e-10  35%  339 aa  OBG_COXBU RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::331     4e-10  35%  339 aa  OBG_COXBR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::331     4e-10  35%  339 aa  OBG_COXBN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::331     4e-10  35%  339 aa  OBG_COXB2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::331     4e-10  35%  339 aa  OBG_COXB1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::292     4e-10  35%  424 aa  OBG_CLONN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::325     4e-10  34%  395 aa  OBG_CHRSD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::316     4e-10  35%  335 aa  OBG_CHLP8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::285     4e-10  35%  680 aa  OBG_BRAHW RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::298     4e-10  33%  365 aa  OBG_ACIBL RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::324     5e-10  33%  424 aa  OBG_THETN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::346     5e-10  35%  388 aa  OBG_SHEFN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::293     5e-10  31%  342 aa  OBG_RHOS5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::249     5e-10  41%  407 aa  OBG_PSEF5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::324     5e-10  30%  340 aa  OBG_PERMH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     5e-10  32%  341 aa  OBG_LEGPL RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     5e-10  28%  357 aa  OBG_DIAST RecName: Full=GTPase obg;AltName: Full=GTP-binding
  142::241     5e-10  35%  508 aa  OBG_CORDI RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::316     5e-10  32%  335 aa  OBG_CHLTE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::315     5e-10  31%  337 aa  OBG_CHLPD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::334     5e-10  34%  372 aa  OBG_BORA1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::217     5e-10  47%  419 aa  OBG_AYWBP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::289     5e-10  35%  352 aa  OBG_ANAPZ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  142::217     5e-10  41%  476 aa  OBG_ACIC1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
   99::385     5e-10  31%  464 aa  MNME_PROMT RecName: Full=tRNA modification GTPase mnmE;       
  166::324     7e-10  33%  390 aa  OBG_VIBCH RecName: Full=GTPase obg/cgtA;AltName: Full=GTP-binding
  162::291     7e-10  36%  416 aa  OBG_THET8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::291     7e-10  36%  416 aa  OBG_THET2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::217     7e-10  41%  331 aa  OBG_RICPR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     7e-10  27%  361 aa  OBG_POLSJ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::302     7e-10  38%  492 aa  OBG_MYCPA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::329     7e-10  35%  482 aa  OBG_MYCA9 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::302     7e-10  38%  492 aa  OBG_MYCA1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::294     7e-10  38%  396 aa  OBG_HAHCH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::336     7e-10  29%  345 aa  OBG_DESAH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::323     7e-10  31%  425 aa  OBG_CLOTE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::321     7e-10  35%  429 aa  OBG_CARHZ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::326     7e-10  34%  350 aa  OBG_ACAM1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  221::393     7e-10  31%  457 aa  MNME_BAUCH RecName: Full=tRNA modification GTPase mnmE;       
  163::288     9e-10  33%  339 aa  OBG_SALRD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::331     9e-10  33%  338 aa  OBG_PELPD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::305     9e-10  35%  390 aa  OBG_PASMU RecName: Full=GTPase obg;AltName: Full=GTP-binding
  161::219     9e-10  47%  422 aa  OBG_ONYPE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  165::336     9e-10  31%  452 aa  OBG_NATTJ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  165::324     9e-10  34%  426 aa  OBG_HALOH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::332     9e-10  30%  371 aa  OBG_DELAS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::288     9e-10  36%  329 aa  OBG_CYAP8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::302     9e-10  38%  501 aa  OBG_CORGB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::349     9e-10  31%  475 aa  MNME_RALEJ RecName: Full=tRNA modification GTPase mnmE;       
  166::219     1e-09  47%  363 aa  OBG_VEREI RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::306     1e-09  37%  343 aa  OBG_SYNP6 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::306     1e-09  37%  343 aa  OBG_SYNE7 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::322     1e-09  32%  481 aa  OBG_SALAI RecName: Full=GTPase obg;AltName: Full=GTP-binding
  167::340     1e-09  30%  439 aa  OBG_ROSS1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  148::341     1e-09  32%  391 aa  OBG_RHORT RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::316     1e-09  34%  422 aa  OBG_MYCAP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::339     1e-09  30%  342 aa  OBG_METRJ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     1e-09  30%  353 aa  OBG_METFK RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::290     1e-09  31%  412 aa  OBG_MAGSA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::294     1e-09  35%  365 aa  OBG_LEPBL RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::294     1e-09  35%  365 aa  OBG_LEPBJ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::332     1e-09  32%  531 aa  OBG_KOCRD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::305     1e-09  37%  391 aa  OBG_HAEDU RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::323     1e-09  31%  428 aa  OBG_CLOPS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::323     1e-09  31%  428 aa  OBG_CLOPE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::323     1e-09  31%  428 aa  OBG_CLOP1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  156::329     1e-09  33%  329 aa  OBG_BORGA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  152::328     1e-09  32%  328 aa  OBG_BORBZ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  152::328     1e-09  32%  328 aa  OBG_BORBU RecName: Full=GTPase obg;AltName: Full=GTP-binding
  171::340     1e-09  34%  563 aa  OBG_BIFAA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     1e-09  45%  339 aa  OBG_BARBK RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::294     1e-09  38%  391 aa  OBG_ALCBS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::219     2e-09  51%  357 aa  OBG_XYLFT RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::219     2e-09  51%  357 aa  OBG_XYLFM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::219     2e-09  51%  357 aa  OBG_XYLFA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::219     2e-09  51%  357 aa  OBG_XYLF2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::293     2e-09  31%  344 aa  OBG_XANP2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::323     2e-09  31%  358 aa  OBG_WOLSU RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::296     2e-09  34%  354 aa  OBG_NITMU RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::294     2e-09  36%  356 aa  OBG_LEPIN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::294     2e-09  36%  356 aa  OBG_LEPIC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::321     2e-09  33%  369 aa  OBG_LEPCP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::284     2e-09  34%  458 aa  OBG_ELUMP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::302     2e-09  38%  501 aa  OBG_CORGL RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     2e-09  44%  341 aa  OBG_BRUSU RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     2e-09  44%  341 aa  OBG_BRUSI RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     2e-09  44%  341 aa  OBG_BRUO2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     2e-09  44%  341 aa  OBG_BRUME RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     2e-09  44%  341 aa  OBG_BRUC2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     2e-09  44%  341 aa  OBG_BRUAB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     2e-09  44%  341 aa  OBG_BRUA2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     2e-09  44%  341 aa  OBG_BRUA1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::322     2e-09  36%  336 aa  OBG_BAUCH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     2e-09  45%  340 aa  OBG_BARHE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::293     2e-09  35%  334 aa  OBG_AMOA5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
    8::175     2e-09  34%  462 aa  ENGA_HELP2 RecName: Full=GTP-binding protein engA;
  158::326     2e-09  32%  423 aa  OBG_THEPX RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::326     2e-09  32%  423 aa  OBG_THEP3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  150::302     2e-09  35%  483 aa  OBG_RHOE4 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::323     2e-09  32%  394 aa  OBG_PORGI RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::323     2e-09  32%  394 aa  OBG_PORG3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     2e-09  44%  341 aa  OBG_OCHA4 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::342     2e-09  34%  342 aa  OBG_NOSP7 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::323     2e-09  26%  516 aa  OBG_NOCSJ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::302     2e-09  38%  479 aa  OBG_MYCLE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::302     2e-09  38%  479 aa  OBG_MYCLB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::292     2e-09  36%  387 aa  OBG_MAGSM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::219     2e-09  47%  338 aa  OBG_GEOSL RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::287     2e-09  41%  529 aa  OBG_FRASC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::287     2e-09  38%  390 aa  OBG_ERWCT RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::240     2e-09  41%  345 aa  OBG_DINSH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::319     2e-09  34%  425 aa  OBG_BREBN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::294     2e-09  35%  348 aa  OBG_BEII9 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     2e-09  28%  357 aa  OBG_ACIAC RecName: Full=GTPase obg;AltName: Full=GTP-binding
   95::344     2e-09  30%  454 aa  MNME_HAHCH RecName: Full=tRNA modification GTPase mnmE;       
  138::306     2e-09  36%  383 aa  GTPBA_XENTR RecName: Full=GTP-binding protein 10;
  162::290     2e-09  39%  383 aa  GTPBA_DROME RecName: Full=GTP-binding protein 10 homolog;
   11::166     2e-09  29%  297 aa  ERA_GEOSM RecName: Full=GTP-binding protein era homolog;
    8::164     2e-09  36%  458 aa  ENGA_HELPY RecName: Full=GTP-binding protein engA;
   66::163     3e-09  32%  368 aa  YG3Y_YEAST RecName: Full=Uncharacterized GTP-binding protein
   63::194     3e-09  33%  370 aa  Y1111_HALSA RecName: Full=Uncharacterized GTP-binding protein
  169::289     3e-09  38%  434 aa  OBG_THEAB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::325     3e-09  35%  368 aa  OBG_SYNY3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::327     3e-09  32%  436 aa  OBG_OENOB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  151::252     3e-09  39%  333 aa  OBG_BUCAP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::218     3e-09  47%  341 aa  OBG_BARQU RecName: Full=GTPase obg;AltName: Full=GTP-binding
  138::235     3e-09  38%  387 aa  GTPBA_HUMAN RecName: Full=GTP-binding protein 10;AltName:
    3::129     3e-09  30%  442 aa  ENGA_KOSOT RecName: Full=GTP-binding protein engA;
    8::175     3e-09  34%  461 aa  ENGA_HELPH RecName: Full=GTP-binding protein engA;
    8::175     3e-09  34%  460 aa  ENGA_HELPG RecName: Full=GTP-binding protein engA;
  168::333     3e-09  32%  350 aa  OBG_STRM5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::322     3e-09  29%  481 aa  OBG_SALTO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  169::327     3e-09  31%  439 aa  OBG_ROSCS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     3e-09  35%  406 aa  OBG_PSEAE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     3e-09  35%  406 aa  OBG_PSEAB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     3e-09  35%  406 aa  OBG_PSEA8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::297     3e-09  34%  440 aa  OBG_PETMO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::316     3e-09  29%  326 aa  OBG_CHLPB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::294     3e-09  35%  354 aa  OBG_CAUSK RecName: Full=GTPase obg;AltName: Full=GTP-binding
  148::222     3e-09  42%  386 aa  OBG_BACFR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  148::222     3e-09  42%  388 aa  OBG_BACFN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  165::331     3e-09  37%  343 aa  OBG_AQUAE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::295     3e-09  38%  332 aa  OBG_ACICJ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::336     3e-09  31%  343 aa  OBG_ACIC5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
    4::157     3e-09  34%  441 aa  ENGA_DEIDV RecName: Full=GTP-binding protein engA;
  159::321     5e-09  30%  347 aa  OBG_ZYMMO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::219     5e-09  51%  350 aa  OBG_XANOR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::219     5e-09  51%  350 aa  OBG_XANOP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::219     5e-09  51%  350 aa  OBG_XANOM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::333     5e-09  32%  350 aa  OBG_STRMK RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::281     5e-09  35%  348 aa  OBG_SILST RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::287     5e-09  39%  390 aa  OBG_SERP5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::336     5e-09  31%  426 aa  OBG_OCEIH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::309     5e-09  35%  342 aa  OBG_MICAN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::290     5e-09  32%  343 aa  OBG_METS4 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::290     5e-09  31%  344 aa  OBG_METPB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  184::264     5e-09  42%  365 aa  OBG_METI4 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::321     5e-09  33%  432 aa  OBG_GEOKA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::322     5e-09  33%  428 aa  OBG_FUSNN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::218     5e-09  44%  425 aa  OBG_DESAP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::331     5e-09  30%  504 aa  OBG_CORU7 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::316     5e-09  30%  333 aa  OBG_CHLT3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::284     5e-09  33%  327 aa  OBG_BORHD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::321     5e-09  34%  428 aa  OBG_ANOFW RecName: Full=GTPase obg;AltName: Full=GTP-binding
    8::164     5e-09  36%  461 aa  ENGA_HELPS RecName: Full=GTP-binding protein engA;
    8::175     5e-09  33%  462 aa  ENGA_HELPJ RecName: Full=GTP-binding protein engA;
    4::161     5e-09  33%  438 aa  ENGA_DEIRA RecName: Full=GTP-binding protein engA;
    5::163     5e-09  34%  437 aa  ENGA_BACTN RecName: Full=GTP-binding protein engA;
  159::331     6e-09  26%  355 aa  OBG_RHOFD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     6e-09  34%  406 aa  OBG_PSEA7 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::332     6e-09  34%  370 aa  OBG_POLNS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::331     6e-09  26%  364 aa  OBG_POLNA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  143::218     6e-09  38%  348 aa  OBG_PARL1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::303     6e-09  32%  341 aa  OBG_NEOSM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::245     6e-09  42%  479 aa  OBG_MYCTU RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::245     6e-09  42%  479 aa  OBG_MYCTA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::245     6e-09  42%  479 aa  OBG_MYCBP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::245     6e-09  42%  479 aa  OBG_MYCBO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::218     6e-09  43%  349 aa  OBG_MESSB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::321     6e-09  34%  541 aa  OBG_FRASN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::291     6e-09  35%  424 aa  OBG_DESHD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  156::218     6e-09  45%  328 aa  OBG_BORAP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  147::295     6e-09  37%  428 aa  OBG_BACLD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     6e-09  42%  345 aa  OBG_AZOC5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::335     6e-09  30%  358 aa  OBG_ALHEH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::294     6e-09  37%  374 aa  OBG_ACIF5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::294     6e-09  37%  374 aa  OBG_ACIF2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  224::339     6e-09  30%  456 aa  MNME_SYNY3 RecName: Full=tRNA modification GTPase mnmE;       
  228::349     6e-09  34%  459 aa  MNME_SYNJA RecName: Full=tRNA modification GTPase mnmE;       
  198::382     6e-09  31%  459 aa  MNME_FERNB RecName: Full=tRNA modification GTPase mnmE;       
  220::383     6e-09  28%  459 aa  MNME_BACSU RecName: Full=tRNA modification GTPase mnmE;       
    1::159     6e-09  32%  445 aa  ENGA_SULSY RecName: Full=GTP-binding protein engA;
    5::161     6e-09  30%  437 aa  ENGA_PORGI RecName: Full=GTP-binding protein engA;
  160::297     8e-09  39%  437 aa  OBG_STRP1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  150::245     8e-09  39%  486 aa  OBG_RHOSR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::316     8e-09  32%  343 aa  OBG_PELLD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::222     8e-09  43%  386 aa  OBG_PARD8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::293     8e-09  34%  343 aa  OBG_NITEU RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::310     8e-09  32%  424 aa  OBG_MYCS5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::219     8e-09  49%  351 aa  OBG_MARMM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     8e-09  36%  390 aa  OBG_ECO7I RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::319     8e-09  30%  327 aa  OBG_BORT9 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  148::222     8e-09  41%  388 aa  OBG_BACTN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  193::344     8e-09  31%  454 aa  MNME_MANSM RecName: Full=tRNA modification GTPase mnmE;       
  168::338     1e-08  35%  355 aa  OBG_XANC5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::331     1e-08  37%  437 aa  OBG_STRA5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::331     1e-08  37%  437 aa  OBG_STRA3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::331     1e-08  37%  437 aa  OBG_STRA1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_SHISS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_SHIFL RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_SHIF8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_SHIDS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_SHIBS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_SHIB3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  161::219     1e-08  41%  421 aa  OBG_PHYAS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::289     1e-08  31%  342 aa  OBG_METNO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_ESCF3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::287     1e-08  35%  390 aa  OBG_ENTS8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::322     1e-08  30%  340 aa  OBG_EHRRG RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  386 aa  OBG_ECOUT RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_ECOSM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_ECOSE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_ECOLU RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_ECOLI RecName: Full=GTPase obgE/cgtA;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_ECOLC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_ECOL6 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_ECOL5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_ECOK1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_ECOHS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_ECODH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_ECO8A RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_ECO81 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_ECO5E RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_ECO57 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_ECO55 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_ECO45 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_ECO27 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     1e-08  36%  390 aa  OBG_ECO24 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::320     1e-08  30%  338 aa  OBG_CYAP7 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  165::286     1e-08  39%  425 aa  OBG_CLOD6 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  148::222     1e-08  42%  394 aa  OBG_BACV8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  147::321     1e-08  35%  428 aa  OBG_BACSU RecName: Full=GTPase obgE;AltName: Full=GTP-binding
  163::325     1e-08  35%  427 aa  OBG_BACHD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  150::218     1e-08  39%  354 aa  OBG_ANASK RecName: Full=GTPase obg;AltName: Full=GTP-binding
  150::218     1e-08  39%  354 aa  OBG_ANADE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  150::218     1e-08  39%  354 aa  OBG_ANAD2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     1e-08  42%  355 aa  OBG_AGRT5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
   65::150     1e-08  30%  364 aa  DRG2_HUMAN RecName: Full=Developmentally-regulated GTP-binding
  166::332     1e-08  34%  388 aa  OBG_SHESW RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::332     1e-08  34%  388 aa  OBG_SHEPC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     1e-08  42%  343 aa  OBG_RHILO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::295     1e-08  32%  329 aa  OBG_PROM4 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::327     1e-08  33%  429 aa  OBG_LISW6 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::327     1e-08  33%  429 aa  OBG_LISIN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::287     1e-08  35%  392 aa  OBG_KLEP7 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::287     1e-08  35%  392 aa  OBG_KLEP3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::301     1e-08  32%  360 aa  OBG_HELPY RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::211     1e-08  49%  391 aa  OBG_HAEPS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::322     1e-08  30%  340 aa  OBG_EHRRW RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::291     1e-08  31%  342 aa  OBG_CYAA5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::286     1e-08  31%  424 aa  OBG_CLOBK RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::286     1e-08  31%  424 aa  OBG_CLOBH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::286     1e-08  31%  424 aa  OBG_CLOB1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::287     1e-08  35%  390 aa  OBG_CITK8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::293     1e-08  32%  334 aa  OBG_BUCAT RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::293     1e-08  32%  334 aa  OBG_BUCAI RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::293     1e-08  32%  334 aa  OBG_BUCA5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::321     1e-08  34%  428 aa  OBG_BACSK RecName: Full=GTPase obg;AltName: Full=GTP-binding
  149::321     1e-08  34%  428 aa  OBG_BACC4 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::218     1e-08  40%  529 aa  OBG_ARTS2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::218     1e-08  40%  529 aa  OBG_ARTCA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::218     1e-08  40%  528 aa  OBG_ARTAT RecName: Full=GTPase obg;AltName: Full=GTP-binding
  171::349     1e-08  31%  475 aa  MNME_RALME RecName: Full=tRNA modification GTPase mnmE;       
    5::163     1e-08  36%  437 aa  ENGA_BACV8 RecName: Full=GTP-binding protein engA;
   65::150     1e-08  29%  364 aa  DRG2_BOVIN RecName: Full=Developmentally-regulated GTP-binding
  168::219     2e-08  51%  350 aa  OBG_XANCP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::219     2e-08  51%  350 aa  OBG_XANCB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::219     2e-08  51%  350 aa  OBG_XANC8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::219     2e-08  51%  355 aa  OBG_XANAC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::308     2e-08  34%  369 aa  OBG_SULDN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::297     2e-08  38%  437 aa  OBG_STRPZ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::297     2e-08  38%  437 aa  OBG_STRPM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::297     2e-08  38%  437 aa  OBG_STRPD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::297     2e-08  38%  437 aa  OBG_STRPC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::297     2e-08  38%  437 aa  OBG_STRPB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::297     2e-08  38%  437 aa  OBG_STRP8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::297     2e-08  38%  437 aa  OBG_STRP6 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     2e-08  36%  390 aa  OBG_SALTY RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     2e-08  36%  390 aa  OBG_SALTI RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     2e-08  36%  390 aa  OBG_SALSV RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     2e-08  36%  390 aa  OBG_SALPK RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     2e-08  36%  390 aa  OBG_SALPC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     2e-08  36%  390 aa  OBG_SALPB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     2e-08  36%  390 aa  OBG_SALPA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     2e-08  36%  390 aa  OBG_SALNS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     2e-08  36%  390 aa  OBG_SALHS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     2e-08  36%  390 aa  OBG_SALG2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     2e-08  36%  390 aa  OBG_SALEP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     2e-08  36%  390 aa  OBG_SALDC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     2e-08  36%  390 aa  OBG_SALCH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     2e-08  36%  391 aa  OBG_SALAR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::287     2e-08  36%  390 aa  OBG_SALA4 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::218     2e-08  40%  534 aa  OBG_RENSM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::332     2e-08  31%  366 aa  OBG_RALSO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::293     2e-08  31%  343 aa  OBG_NITEC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::327     2e-08  33%  429 aa  OBG_LISMO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::327     2e-08  33%  429 aa  OBG_LISMH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::327     2e-08  33%  429 aa  OBG_LISMF RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::283     2e-08  40%  343 aa  OBG_GRABC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::321     2e-08  33%  433 aa  OBG_GEOTN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::287     2e-08  35%  392 aa  OBG_ENT38 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::291     2e-08  34%  424 aa  OBG_DESHY RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::223     2e-08  40%  439 aa  OBG_CHLAD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     2e-08  37%  427 aa  OBG_BACWK RecName: Full=GTPase obg;AltName: Full=GTP-binding
  147::321     2e-08  35%  428 aa  OBG_BACP2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  184::361     2e-08  34%  441 aa  MNME_THEM4 RecName: Full=tRNA modification GTPase mnmE;       
   92::341     2e-08  33%  452 aa  MNME_COXBU RecName: Full=tRNA modification GTPase mnmE;       
   92::341     2e-08  33%  452 aa  MNME_COXBR RecName: Full=tRNA modification GTPase mnmE;       
   92::341     2e-08  33%  452 aa  MNME_COXBN RecName: Full=tRNA modification GTPase mnmE;       
  219::343     2e-08  34%  453 aa  MNME_BUCMP RecName: Full=tRNA modification GTPase mnmE;       
  220::385     2e-08  27%  459 aa  MNME_BACP2 RecName: Full=tRNA modification GTPase mnmE;       
  148::290     2e-08  35%  383 aa  GTPBA_DROPS RecName: Full=GTP-binding protein 10 homolog;
    8::169     2e-08  34%  300 aa  ERA_THEP1 RecName: Full=GTP-binding protein era homolog;
    5::163     2e-08  34%  437 aa  ENGA_BACFR RecName: Full=GTP-binding protein engA;
    5::163     2e-08  34%  437 aa  ENGA_BACFN RecName: Full=GTP-binding protein engA;
  160::297     2e-08  38%  437 aa  OBG_STRPG RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::297     2e-08  38%  437 aa  OBG_STRPF RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::321     2e-08  35%  430 aa  OBG_STACT RecName: Full=GTPase obg;AltName: Full=GTP-binding
  165::220     2e-08  43%  505 aa  OBG_PROAC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  150::245     2e-08  37%  485 aa  OBG_NOCFA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::325     2e-08  29%  433 aa  OBG_MYCGE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::321     2e-08  36%  429 aa  OBG_LYSSC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::328     2e-08  35%  439 aa  OBG_LEUMM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::284     2e-08  35%  440 aa  OBG_LACDB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::284     2e-08  35%  440 aa  OBG_LACDA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::346     2e-08  31%  428 aa  OBG_LACC3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::283     2e-08  39%  372 aa  OBG_DESPS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::286     2e-08  31%  424 aa  OBG_CLOBM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::223     2e-08  40%  439 aa  OBG_CHLSY RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::223     2e-08  40%  439 aa  OBG_CHLAA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  229::384     2e-08  28%  467 aa  MNME_TRIEI RecName: Full=tRNA modification GTPase mnmE;       
  181::343     2e-08  32%  454 aa  MNME_PHOLL RecName: Full=tRNA modification GTPase mnmE;       
  109::372     2e-08  27%  452 aa  MNME_HAEI8 RecName: Full=tRNA modification GTPase mnmE;       
   11::168     2e-08  32%  297 aa  ERA_GEOUR RecName: Full=GTP-binding protein era homolog;
  163::218     3e-08  49%  425 aa  OBG_SYMTH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::216     3e-08  47%  345 aa  OBG_SPHWW RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     3e-08  40%  336 aa  OBG_RHISN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::311     3e-08  31%  434 aa  OBG_MYCGA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::320     3e-08  33%  428 aa  OBG_LACGA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::346     3e-08  31%  428 aa  OBG_LACCB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::296     3e-08  34%  437 aa  OBG_HERA2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::289     3e-08  37%  360 aa  OBG_HELPH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::331     3e-08  34%  442 aa  OBG_HELMI RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::293     3e-08  32%  333 aa  OBG_DESOH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::302     3e-08  35%  502 aa  OBG_COREF RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::322     3e-08  37%  425 aa  OBG_CLOCE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::286     3e-08  31%  424 aa  OBG_CLOBL RecName: Full=GTPase obg;AltName: Full=GTP-binding
  149::291     3e-08  36%  428 aa  OBG_BACHK RecName: Full=GTPase obg;AltName: Full=GTP-binding
  149::291     3e-08  36%  428 aa  OBG_BACCZ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  149::291     3e-08  36%  428 aa  OBG_BACCR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  149::291     3e-08  36%  428 aa  OBG_BACCQ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  149::291     3e-08  36%  428 aa  OBG_BACC7 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  149::291     3e-08  36%  428 aa  OBG_BACC3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  149::291     3e-08  36%  428 aa  OBG_BACC2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  149::291     3e-08  36%  428 aa  OBG_BACC1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  149::291     3e-08  36%  428 aa  OBG_BACC0 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  149::291     3e-08  36%  428 aa  OBG_BACAN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  149::291     3e-08  36%  428 aa  OBG_BACAH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::199     3e-08  56%  405 aa  OBG_AZOVD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::218     3e-08  40%  419 aa  OBG_ACHLI RecName: Full=GTPase obg;AltName: Full=GTP-binding
  225::386     3e-08  30%  469 aa  MNME_THEEB RecName: Full=tRNA modification GTPase mnmE;       
  225::386     3e-08  30%  469 aa  MNME_SYNEL RecName: Full=tRNA modification GTPase mnmE;       
  207::371     3e-08  31%  453 aa  MNME_SHEFN RecName: Full=tRNA modification GTPase mnmE;       
  169::371     3e-08  28%  459 aa  MNME_OCEIH RecName: Full=tRNA modification GTPase mnmE;       
  225::344     3e-08  34%  457 aa  MNME_MICAN RecName: Full=tRNA modification GTPase mnmE;       
  191::342     3e-08  32%  452 aa  MNME_HAEDU RecName: Full=tRNA modification GTPase mnmE;       
  188::340     3e-08  36%  461 aa  MNME_CARHZ RecName: Full=tRNA modification GTPase mnmE;       
    8::153     3e-08  34%  300 aa  ERA_THEMA RecName: Full=GTP-binding protein era homolog;
  145::329     4e-08  32%  435 aa  OBG_UREU1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  152::296     4e-08  35%  382 aa  OBG_TREDE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::292     4e-08  30%  329 aa  OBG_SYNSC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::292     4e-08  33%  346 aa  OBG_SULSY RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::297     4e-08  37%  437 aa  OBG_STRP3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  165::283     4e-08  31%  348 aa  OBG_SPHAL RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::316     4e-08  32%  337 aa  OBG_PELPB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::282     4e-08  31%  419 aa  OBG_MYCHJ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::326     4e-08  32%  432 aa  OBG_LACS1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::320     4e-08  33%  428 aa  OBG_LACJO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::332     4e-08  31%  353 aa  OBG_DICNV RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::331     4e-08  28%  336 aa  OBG_DESAA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::290     4e-08  30%  430 aa  OBG_CLOB8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  189::340     4e-08  33%  456 aa  MNME_PSE14 RecName: Full=tRNA modification GTPase mnmE;       
  228::383     4e-08  29%  462 aa  MNME_GEOKA RecName: Full=tRNA modification GTPase mnmE;       
  163::347     4e-08  29%  467 aa  MNME_DESPS RecName: Full=tRNA modification GTPase mnmE;       
  217::350     4e-08  36%  443 aa  MNME_CHLCV RecName: Full=tRNA modification GTPase mnmE;       
  190::370     4e-08  27%  458 aa  MNME_BACHD RecName: Full=tRNA modification GTPase mnmE;       
  169::383     4e-08  25%  459 aa  MNME_BACA2 RecName: Full=tRNA modification GTPase mnmE;       
  224::343     4e-08  31%  459 aa  MNME_ANASP RecName: Full=tRNA modification GTPase mnmE;       
  222::341     4e-08  33%  461 aa  MNME_ALKOO RecName: Full=tRNA modification GTPase mnmE;       
  222::373     4e-08  26%  455 aa  MNME_ACAM1 RecName: Full=tRNA modification GTPase mnmE;       
  153::208     4e-08  44%  380 aa  GTPBA_DANRE RecName: Full=GTP-binding protein 10;
  151::244     4e-08  40%  387 aa  GTPBA_BOVIN RecName: Full=GTP-binding protein 10;
    5::162     4e-08  31%  494 aa  ENGA_VIBCM RecName: Full=GTP-binding protein engA;
    5::162     4e-08  31%  494 aa  ENGA_VIBCH RecName: Full=GTP-binding protein engA;
    5::162     4e-08  31%  494 aa  ENGA_VIBC3 RecName: Full=GTP-binding protein engA;
    4::171     4e-08  31%  441 aa  ENGA_DEIGD RecName: Full=GTP-binding protein engA;
  159::217     5e-08  39%  340 aa  OBG_WOLTR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  142::219     5e-08  42%  352 aa  OBG_TRIEI RecName: Full=GTPase obg;AltName: Full=GTP-binding
  155::297     5e-08  35%  454 aa  OBG_THEFY RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::293     5e-08  38%  438 aa  OBG_STRU0 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::307     5e-08  33%  346 aa  OBG_SORC5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::291     5e-08  30%  327 aa  OBG_PROMS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::282     5e-08  31%  419 aa  OBG_MYCH7 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::282     5e-08  31%  419 aa  OBG_MYCH2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  150::218     5e-08  35%  327 aa  OBG_HYDS0 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::289     5e-08  37%  360 aa  OBG_HELP2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::286     5e-08  36%  360 aa  OBG_HELAH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::293     5e-08  36%  346 aa  OBG_HALHL RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::286     5e-08  38%  429 aa  OBG_CLOPH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::268     5e-08  36%  347 aa  OBG_CAMLR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  233::390     5e-08  31%  470 aa  MNME_SYNFM RecName: Full=tRNA modification GTPase mnmE;       
  109::344     5e-08  30%  452 aa  MNME_HAEIN RecName: Full=tRNA modification GTPase mnmE;       
  163::385     5e-08  24%  459 aa  MNME_BACLD RecName: Full=tRNA modification GTPase mnmE;       
  228::347     5e-08  31%  463 aa  MNME_ANAVT RecName: Full=tRNA modification GTPase mnmE;       
   13::165     5e-08  28%  452 aa  ENGA_RICBR RecName: Full=GTP-binding protein engA;
    1::160     5e-08  32%  447 aa  ENGA_PERMH RecName: Full=GTP-binding protein engA;
    6::160     5e-08  30%  436 aa  ENGA_GEMAT RecName: Full=GTP-binding protein engA;
   65::161     5e-08  32%  364 aa  DRG2_DICDI RecName: Full=Developmentally-regulated GTP-binding
  229::381     7e-08  33%  419 aa  YLWB_SCHPO RecName: Full=Uncharacterized GTP-binding protein
  150::328     7e-08  30%  348 aa  OBG_SYNFM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::293     7e-08  33%  437 aa  OBG_STRTD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::293     7e-08  33%  437 aa  OBG_STRT2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::293     7e-08  33%  437 aa  OBG_STRT1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::288     7e-08  36%  485 aa  OBG_MYXXD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::310     7e-08  31%  364 aa  OBG_LAWIP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     7e-08  32%  431 aa  OBG_LACBA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::286     7e-08  34%  336 aa  OBG_GLUOX RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::246     7e-08  42%  544 aa  OBG_FRAAA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  165::218     7e-08  47%  422 aa  OBG_DESRM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  147::295     7e-08  37%  428 aa  OBG_BACA2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  228::347     7e-08  33%  459 aa  MNME_SYNJB RecName: Full=tRNA modification GTPase mnmE;       
  207::371     7e-08  30%  453 aa  MNME_SHEDO RecName: Full=tRNA modification GTPase mnmE;       
  189::340     7e-08  33%  456 aa  MNME_PSESM RecName: Full=tRNA modification GTPase mnmE;       
  193::342     7e-08  31%  455 aa  MNME_PSEA7 RecName: Full=tRNA modification GTPase mnmE;       
  121::375     7e-08  30%  455 aa  MNME_PROMA RecName: Full=tRNA modification GTPase mnmE;       
  191::342     7e-08  31%  456 aa  MNME_MARAV RecName: Full=tRNA modification GTPase mnmE;       
  109::372     7e-08  28%  452 aa  MNME_HAEIG RecName: Full=tRNA modification GTPase mnmE;       
    6::166     7e-08  31%  299 aa  ERA_THEM4 RecName: Full=GTP-binding protein era homolog;
   11::173     7e-08  30%  296 aa  ERA_NITEC RecName: Full=GTP-binding protein era homolog;
   13::173     7e-08  34%  305 aa  ERA_LYSSC RecName: Full=GTP-binding protein era homolog;
    8::140     7e-08  37%  462 aa  ENGA_HELAH RecName: Full=GTP-binding protein engA;
    5::90      7e-08  35%  504 aa  ENGA_HAEPS RecName: Full=GTP-binding protein engA;
  164::319     9e-08  30%  336 aa  OBG_SINMW RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::217     9e-08  48%  411 aa  OBG_RUBXD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::316     9e-08  27%  336 aa  OBG_PROVI RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::291     9e-08  29%  327 aa  OBG_PROM0 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::219     9e-08  47%  432 aa  OBG_MESFL RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::283     9e-08  36%  360 aa  OBG_HELPS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::222     9e-08  40%  335 aa  OBG_FLAPJ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::222     9e-08  40%  333 aa  OBG_FLAJ1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::334     9e-08  27%  424 aa  OBG_DEHE1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  195::360     9e-08  30%  459 aa  MNME_STAS1 RecName: Full=tRNA modification GTPase mnmE;       
  155::349     9e-08  29%  475 aa  MNME_RALEH RecName: Full=tRNA modification GTPase mnmE;       
  189::340     9e-08  33%  456 aa  MNME_PSEU2 RecName: Full=tRNA modification GTPase mnmE;       
  109::372     9e-08  27%  452 aa  MNME_HAEIE RecName: Full=tRNA modification GTPase mnmE;       
  221::352     9e-08  30%  453 aa  MNME_GLOVI RecName: Full=tRNA modification GTPase mnmE;       
    5::162     9e-08  32%  489 aa  ENGA_PSESM RecName: Full=GTP-binding protein engA;
    5::162     9e-08  32%  490 aa  ENGA_PSE14 RecName: Full=GTP-binding protein engA;
  164::217     1e-07  39%  340 aa  OBG_WOLWR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::217     1e-07  39%  340 aa  OBG_WOLPM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     1e-07  34%  431 aa  OBG_STAS1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::215     1e-07  51%  388 aa  OBG_SHESR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::215     1e-07  51%  388 aa  OBG_SHESM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::215     1e-07  51%  388 aa  OBG_SHESA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::215     1e-07  51%  388 aa  OBG_SHEON RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     1e-07  40%  364 aa  OBG_RHILW RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     1e-07  40%  364 aa  OBG_RHIL3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     1e-07  40%  362 aa  OBG_RHIE6 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::219     1e-07  42%  329 aa  OBG_PROMA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::291     1e-07  29%  327 aa  OBG_PROM9 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::295     1e-07  35%  430 aa  OBG_PEDPA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  156::325     1e-07  31%  422 aa  OBG_MYCMO RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::199     1e-07  62%  345 aa  OBG_METCA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::245     1e-07  39%  347 aa  OBG_HELHP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::325     1e-07  33%  342 aa  OBG_ANASP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     1e-07  40%  366 aa  OBG_AGRVS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  226::346     1e-07  30%  462 aa  MNME_SYNE7 RecName: Full=tRNA modification GTPase mnmE;       
  218::342     1e-07  33%  456 aa  MNME_PSEPF RecName: Full=tRNA modification GTPase mnmE;       
  152::378     1e-07  26%  457 aa  MNME_LISW6 RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-07  31%  454 aa  MNME_KLEP7 RecName: Full=tRNA modification GTPase mnmE;       
  225::343     1e-07  29%  460 aa  MNME_CYAP4 RecName: Full=tRNA modification GTPase mnmE;       
  191::342     1e-07  29%  452 aa  MNME_ACTSZ RecName: Full=tRNA modification GTPase mnmE;       
  151::309     1e-07  28%  439 aa  ENGA_THESQ RecName: Full=GTP-binding protein engA;
    5::130     1e-07  34%  440 aa  ENGA_CALS8 RecName: Full=GTP-binding protein engA;
    5::122     1e-07  30%  453 aa  ENGA_BUCAP RecName: Full=GTP-binding protein engA;
    4::160     1e-07  39%  442 aa  ENGA_AZOSB RecName: Full=GTP-binding protein engA;
   86::170     1e-07  33%  391 aa  Y1326_METJA RecName: Full=Uncharacterized GTP-binding protein
  162::338     1e-07  30%  435 aa  OBG_UREPA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::338     1e-07  30%  435 aa  OBG_UREP2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     1e-07  43%  333 aa  OBG_THEEB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::293     1e-07  37%  437 aa  OBG_STRSY RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::293     1e-07  37%  437 aa  OBG_STRS2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::293     1e-07  33%  436 aa  OBG_STRMU RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     1e-07  38%  336 aa  OBG_RHIME RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     1e-07  40%  363 aa  OBG_RHIEC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::218     1e-07  41%  329 aa  OBG_PROMT RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::218     1e-07  41%  329 aa  OBG_PROM1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::218     1e-07  48%  433 aa  OBG_MYCCT RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::283     1e-07  36%  360 aa  OBG_HELPG RecName: Full=GTPase obg;AltName: Full=GTP-binding
  165::316     1e-07  31%  421 aa  OBG_FINM2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  165::219     1e-07  36%  327 aa  OBG_BORRA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::219     1e-07  37%  327 aa  OBG_BORDL RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::219     1e-07  42%  342 aa  OBG_ANAVT RecName: Full=GTPase obg;AltName: Full=GTP-binding
  218::342     1e-07  31%  455 aa  MNME_PSEMY RecName: Full=tRNA modification GTPase mnmE;       
  218::342     1e-07  30%  455 aa  MNME_PSEAE RecName: Full=tRNA modification GTPase mnmE;       
  218::342     1e-07  30%  455 aa  MNME_PSEAB RecName: Full=tRNA modification GTPase mnmE;       
  152::378     1e-07  25%  457 aa  MNME_LISMF RecName: Full=tRNA modification GTPase mnmE;       
  222::374     1e-07  30%  455 aa  MNME_GEOUR RecName: Full=tRNA modification GTPase mnmE;       
  217::336     1e-07  37%  443 aa  MNME_CHLAB RecName: Full=tRNA modification GTPase mnmE;       
    5::162     1e-07  30%  488 aa  ENGA_SHEFN RecName: Full=GTP-binding protein engA;
   13::165     1e-07  27%  452 aa  ENGA_RICB8 RecName: Full=GTP-binding protein engA;
    5::159     1e-07  32%  488 aa  ENGA_PSEE4 RecName: Full=GTP-binding protein engA;
    5::164     1e-07  28%  435 aa  ENGA_CHLPB RecName: Full=GTP-binding protein engA;
   52::210     1e-07  30%  491 aa  ENGA_ARTAT RecName: Full=GTP-binding protein engA;
    5::90      1e-07  35%  506 aa  ENGA_ACTPJ RecName: Full=GTP-binding protein engA;
   65::167     2e-07  33%  366 aa  YFY7_SCHPO RecName: Full=Uncharacterized GTP-binding protein
   72::158     2e-07  36%  369 aa  RBG1_YEAST RecName: Full=GTP-binding protein RBG1;AltName:
  163::219     2e-07  43%  467 aa  OBG_THERP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::297     2e-07  37%  437 aa  OBG_STRS7 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::293     2e-07  31%  436 aa  OBG_STRR6 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::293     2e-07  31%  436 aa  OBG_STRPS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     2e-07  31%  434 aa  OBG_STRPN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     2e-07  31%  434 aa  OBG_STRPJ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     2e-07  31%  434 aa  OBG_STRPI RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     2e-07  31%  434 aa  OBG_STRP4 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::293     2e-07  31%  436 aa  OBG_STRP2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     2e-07  37%  435 aa  OBG_STREM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::292     2e-07  30%  329 aa  OBG_PAUCH RecName: Full=Putative GTPase obg;AltName:
  166::218     2e-07  48%  433 aa  OBG_MYCMS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::283     2e-07  34%  360 aa  OBG_HELPJ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::246     2e-07  36%  356 aa  OBG_CAMJJ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::246     2e-07  36%  350 aa  OBG_CAMJE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  191::342     2e-07  31%  452 aa  MNME_PASMU RecName: Full=tRNA modification GTPase mnmE;       
  220::347     2e-07  34%  459 aa  MNME_MARMS RecName: Full=tRNA modification GTPase mnmE;       
  228::383     2e-07  28%  462 aa  MNME_GEOTN RecName: Full=tRNA modification GTPase mnmE;       
  179::372     2e-07  27%  450 aa  MNME_FRATO RecName: Full=tRNA modification GTPase mnmE;       
  179::372     2e-07  27%  450 aa  MNME_FRATH RecName: Full=tRNA modification GTPase mnmE;       
  179::372     2e-07  27%  450 aa  MNME_FRATF RecName: Full=tRNA modification GTPase mnmE;       
   98::345     2e-07  31%  464 aa  MNME_BURXL RecName: Full=tRNA modification GTPase mnmE;       
  218::342     2e-07  31%  452 aa  MNME_BUCAI RecName: Full=tRNA modification GTPase mnmE;       
    9::132     2e-07  27%  300 aa  ERA_LACCB RecName: Full=GTP-binding protein era homolog;
    9::132     2e-07  27%  300 aa  ERA_LACC3 RecName: Full=GTP-binding protein era homolog;
   11::166     2e-07  26%  298 aa  ERA_GEOMG RecName: Full=GTP-binding protein era homolog;
    6::166     2e-07  29%  453 aa  ENGA_TRIEI RecName: Full=GTP-binding protein engA;
    6::171     2e-07  28%  452 aa  ENGA_SYNY3 RecName: Full=GTP-binding protein engA;
    5::159     2e-07  29%  487 aa  ENGA_PSEPW RecName: Full=GTP-binding protein engA;
    6::159     2e-07  27%  436 aa  ENGA_MYCAP RecName: Full=GTP-binding protein engA;
    6::164     2e-07  28%  504 aa  ENGA_HAEIN RecName: Full=GTP-binding protein engA;
   85::249     2e-07  30%  528 aa  ENGA_COREF RecName: Full=GTP-binding protein engA;
    4::161     2e-07  30%  435 aa  ENGA_CHLT3 RecName: Full=GTP-binding protein engA;
  159::329     2e-07  34%  337 aa  OBG_THEYD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::293     2e-07  37%  437 aa  OBG_STRE4 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::218     2e-07  42%  422 aa  OBG_PELTS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::222     2e-07  42%  337 aa  OBG_CYTH3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::246     2e-07  36%  350 aa  OBG_CAMJR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::246     2e-07  36%  345 aa  OBG_CAMJ8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  155::327     2e-07  27%  337 aa  OBG_AZOPC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  257::406     2e-07  28%  526 aa  MSS1_YEAST RecName: Full=tRNA modification GTPase MSS1,
  152::378     2e-07  25%  457 aa  MNME_LISMO RecName: Full=tRNA modification GTPase mnmE;       
  152::378     2e-07  25%  457 aa  MNME_LISIN RecName: Full=tRNA modification GTPase mnmE;       
  179::372     2e-07  27%  450 aa  MNME_FRATW RecName: Full=tRNA modification GTPase mnmE;       
  179::372     2e-07  27%  450 aa  MNME_FRATT RecName: Full=tRNA modification GTPase mnmE;       
  179::372     2e-07  27%  450 aa  MNME_FRATN RecName: Full=tRNA modification GTPase mnmE;       
  179::372     2e-07  27%  450 aa  MNME_FRAT1 RecName: Full=tRNA modification GTPase mnmE;       
  218::342     2e-07  32%  453 aa  MNME_AERS4 RecName: Full=tRNA modification GTPase mnmE;       
  153::235     2e-07  40%  366 aa  GTPBA_MOUSE RecName: Full=GTP-binding protein 10;
  151::309     2e-07  27%  439 aa  ENGA_THEMA RecName: Full=GTP-binding protein engA;AltName:
    5::90      2e-07  35%  506 aa  ENGA_ACTP7 RecName: Full=GTP-binding protein engA;
    5::90      2e-07  35%  506 aa  ENGA_ACTP2 RecName: Full=GTP-binding protein engA;
  151::293     3e-07  32%  436 aa  OBG_STRGC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::287     3e-07  33%  327 aa  OBG_PROA2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::292     3e-07  31%  367 aa  OBG_NITSB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::268     3e-07  34%  433 aa  OBG_LACAC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::219     3e-07  45%  338 aa  OBG_GEOSF RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::284     3e-07  32%  433 aa  OBG_DEIGD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  219::342     3e-07  31%  454 aa  MNME_KLEP3 RecName: Full=tRNA modification GTPase mnmE;       
  133::346     3e-07  29%  458 aa  MNME_HAMD5 RecName: Full=tRNA modification GTPase mnmE;       
  225::379     3e-07  32%  458 aa  MNME_CLOPH RecName: Full=tRNA modification GTPase mnmE;       
  217::361     3e-07  33%  442 aa  MNME_CHLPN RecName: Full=tRNA modification GTPase mnmE;       
  191::342     3e-07  28%  452 aa  MNME_ACTPJ RecName: Full=tRNA modification GTPase mnmE;       
  191::342     3e-07  29%  452 aa  MNME_ACTP2 RecName: Full=tRNA modification GTPase mnmE;       
  180::340     3e-07  27%  435 aa  ENGA_THELT RecName: Full=GTP-binding protein engA;
    5::162     3e-07  28%  491 aa  ENGA_SHEDO RecName: Full=GTP-binding protein engA;
    6::160     3e-07  28%  447 aa  ENGA_RICRS RecName: Full=GTP-binding protein engA;
    6::160     3e-07  28%  447 aa  ENGA_RICRO RecName: Full=GTP-binding protein engA;
    5::159     3e-07  33%  490 aa  ENGA_PSEU2 RecName: Full=GTP-binding protein engA;
  159::323     4e-07  31%  354 aa  OBG_SYNP2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  151::293     4e-07  32%  436 aa  OBG_STRSV RecName: Full=GTPase obg;AltName: Full=GTP-binding
  149::292     4e-07  33%  439 aa  OBG_LEUCK RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::325     4e-07  31%  430 aa  OBG_LACSS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::307     4e-07  30%  437 aa  OBG_LACLA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::253     4e-07  36%  434 aa  OBG_LACH4 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::219     4e-07  45%  338 aa  OBG_GEOBB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::293     4e-07  32%  438 aa  OBG_ENTFA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::323     4e-07  28%  424 aa  OBG_CLOK1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::246     4e-07  36%  345 aa  OBG_CAMJD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  193::342     4e-07  31%  454 aa  MNME_YERE8 RecName: Full=tRNA modification GTPase mnmE;       
  196::399     4e-07  32%  460 aa  MNME_THETN RecName: Full=tRNA modification GTPase mnmE;       
   65::164     4e-07  30%  364 aa  GTP1_SCHPO RecName: Full=GTP-binding protein 1;
   11::135     4e-07  32%  303 aa  ERA_LEUCK RecName: Full=GTP-binding protein era homolog;
    5::162     4e-07  29%  493 aa  ENGA_VIBSL RecName: Full=GTP-binding protein engA;
    6::160     4e-07  28%  447 aa  ENGA_RICPU RecName: Full=GTP-binding protein engA;
    6::160     4e-07  27%  447 aa  ENGA_RICFE RecName: Full=GTP-binding protein engA;
    6::160     4e-07  28%  447 aa  ENGA_RICCN RecName: Full=GTP-binding protein engA;
    6::160     4e-07  28%  447 aa  ENGA_RICAE RecName: Full=GTP-binding protein engA;
    5::162     4e-07  31%  490 aa  ENGA_PSEF5 RecName: Full=GTP-binding protein engA;
    4::121     4e-07  37%  439 aa  ENGA_PELCD RecName: Full=GTP-binding protein engA;
    5::159     4e-07  31%  491 aa  ENGA_AZOVD RecName: Full=GTP-binding protein engA;
    5::172     4e-07  29%  500 aa  ENGA_ALISL RecName: Full=GTP-binding protein engA;
  168::290     6e-07  35%  376 aa  OBG_TREPS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::290     6e-07  35%  376 aa  OBG_TREPA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::218     6e-07  40%  373 aa  OBG_SULNB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::218     6e-07  39%  327 aa  OBG_PROM2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::290     6e-07  32%  346 aa  OBG_OPITP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::286     6e-07  31%  433 aa  OBG_MYCPN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::320     6e-07  36%  431 aa  OBG_EXIS2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::289     6e-07  31%  438 aa  OBG_DEIRA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::258     6e-07  35%  347 aa  OBG_CAMHC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::218     6e-07  48%  338 aa  OBG_BUCBP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  226::346     6e-07  29%  462 aa  MNME_SYNP6 RecName: Full=tRNA modification GTPase mnmE;       
  140::361     6e-07  29%  453 aa  MNME_SHEAM RecName: Full=tRNA modification GTPase mnmE;       
  218::342     6e-07  31%  456 aa  MNME_PSEPG RecName: Full=tRNA modification GTPase mnmE;       
  219::342     6e-07  31%  454 aa  MNME_PECCP RecName: Full=tRNA modification GTPase mnmE;       
  180::343     6e-07  31%  452 aa  MNME_HAES1 RecName: Full=tRNA modification GTPase mnmE;       
  226::377     6e-07  29%  461 aa  MNME_DESAP RecName: Full=tRNA modification GTPase mnmE;       
  218::337     6e-07  35%  444 aa  MNME_CHLTR RecName: Full=tRNA modification GTPase mnmE;       
  218::337     6e-07  35%  444 aa  MNME_CHLTB RecName: Full=tRNA modification GTPase mnmE;       
  218::337     6e-07  35%  444 aa  MNME_CHLTA RecName: Full=tRNA modification GTPase mnmE;       
  218::337     6e-07  35%  444 aa  MNME_CHLT2 RecName: Full=tRNA modification GTPase mnmE;       
  197::379     6e-07  31%  464 aa  MNME_BORGA RecName: Full=tRNA modification GTPase mnmE;       
  225::379     6e-07  31%  458 aa  MNME_BACSK RecName: Full=tRNA modification GTPase mnmE;       
  202::349     6e-07  28%  461 aa  MNME_ALKMQ RecName: Full=tRNA modification GTPase mnmE;       
  218::371     6e-07  28%  453 aa  MNME_AERHH RecName: Full=tRNA modification GTPase mnmE;       
   11::142     6e-07  30%  297 aa  ERA_GEOSF RecName: Full=GTP-binding protein era homolog;
    4::170     6e-07  26%  296 aa  ERA_EHRCJ RecName: Full=GTP-binding protein era homolog;
    5::160     6e-07  28%  465 aa  ENGA_XYLFT RecName: Full=GTP-binding protein engA;
    5::160     6e-07  28%  465 aa  ENGA_XYLF2 RecName: Full=GTP-binding protein engA;
  161::309     6e-07  27%  439 aa  ENGA_THEP1 RecName: Full=GTP-binding protein engA;
  161::309     6e-07  28%  439 aa  ENGA_THENN RecName: Full=GTP-binding protein engA;
    5::160     6e-07  33%  437 aa  ENGA_PARD8 RecName: Full=GTP-binding protein engA;
    6::190     6e-07  31%  449 aa  ENGA_CHLAD RecName: Full=GTP-binding protein engA;
    4::156     6e-07  31%  463 aa  ENGA_CAMFF RecName: Full=GTP-binding protein engA;
    5::163     6e-07  33%  437 aa  ENGA_AZOPC RecName: Full=GTP-binding protein engA;
  159::323     7e-07  30%  329 aa  OBG_SYNS3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::291     7e-07  29%  327 aa  OBG_PROMP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::291     7e-07  30%  327 aa  OBG_PROM5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::288     7e-07  33%  438 aa  OBG_LACRJ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::288     7e-07  33%  438 aa  OBG_LACRD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  162::222     7e-07  37%  335 aa  OBG_GRAFK RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     7e-07  29%  424 aa  OBG_CLOAB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  193::342     7e-07  35%  454 aa  MNME_YERP3 RecName: Full=tRNA modification GTPase mnmE;       
  193::342     7e-07  30%  454 aa  MNME_SHIFL RecName: Full=tRNA modification GTPase mnmE;       
  193::342     7e-07  30%  454 aa  MNME_SHIF8 RecName: Full=tRNA modification GTPase mnmE;       
  221::371     7e-07  34%  456 aa  MNME_LEPIC RecName: Full=tRNA modification GTPase mnmE;       
  223::391     7e-07  28%  456 aa  MNME_GEOSL RecName: Full=tRNA modification GTPase mnmE;       
  217::336     7e-07  35%  443 aa  MNME_CHLFF RecName: Full=tRNA modification GTPase mnmE;       
  168::359     7e-07  26%  458 aa  MNME_BACCR RecName: Full=tRNA modification GTPase mnmE;       
   94::365     7e-07  28%  456 aa  MNME_ALCBS RecName: Full=tRNA modification GTPase mnmE;       
   11::171     7e-07  27%  303 aa  ERA_LACLS RecName: Full=GTP-binding protein era homolog;
   11::171     7e-07  27%  303 aa  ERA_LACLM RecName: Full=GTP-binding protein era homolog;
   11::171     7e-07  27%  303 aa  ERA_LACLA RecName: Full=GTP-binding protein era homolog;
   11::131     7e-07  32%  296 aa  ERA_GEOLS RecName: Full=GTP-binding protein era homolog;
    5::162     7e-07  32%  490 aa  ENGA_PSEPF RecName: Full=GTP-binding protein engA;
    4::156     7e-07  32%  462 aa  ENGA_NITSB RecName: Full=GTP-binding protein engA;
  168::370     7e-07  29%  487 aa  ENGA_HELHP RecName: Full=GTP-binding protein engA;
    6::173     7e-07  29%  441 aa  ENGA_CLOCE RecName: Full=GTP-binding protein engA;
   65::121     7e-07  35%  364 aa  DRG2_MOUSE RecName: Full=Developmentally-regulated GTP-binding
  158::291     9e-07  34%  430 aa  OBG_STAAW RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     9e-07  34%  430 aa  OBG_STAAT RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     9e-07  34%  430 aa  OBG_STAAS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     9e-07  34%  430 aa  OBG_STAAR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     9e-07  34%  430 aa  OBG_STAAN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     9e-07  34%  430 aa  OBG_STAAM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     9e-07  34%  430 aa  OBG_STAAE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     9e-07  34%  430 aa  OBG_STAAC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     9e-07  34%  430 aa  OBG_STAAB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     9e-07  34%  430 aa  OBG_STAA9 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     9e-07  34%  430 aa  OBG_STAA8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     9e-07  34%  430 aa  OBG_STAA3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     9e-07  34%  430 aa  OBG_STAA2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     9e-07  34%  430 aa  OBG_STAA1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::218     9e-07  36%  327 aa  OBG_PELUB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::330     9e-07  25%  370 aa  OBG_METPP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::219     9e-07  42%  338 aa  OBG_GEOUR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  146::300     9e-07  33%  450 aa  MNME_THEP1 RecName: Full=tRNA modification GTPase mnmE;       
  117::277     9e-07  35%  457 aa  MNME_SYNAS RecName: Full=tRNA modification GTPase mnmE;       
  196::383     9e-07  26%  458 aa  MNME_STRPM RecName: Full=tRNA modification GTPase mnmE;       
  193::342     9e-07  30%  454 aa  MNME_ECO7I RecName: Full=tRNA modification GTPase mnmE;       
  218::337     9e-07  35%  444 aa  MNME_CHLMU RecName: Full=tRNA modification GTPase mnmE;       
  184::346     9e-07  27%  458 aa  MNME_BACWK RecName: Full=tRNA modification GTPase mnmE;       
  168::359     9e-07  25%  458 aa  MNME_BACCN RecName: Full=tRNA modification GTPase mnmE;       
   12::136     9e-07  31%  300 aa  ERA_ELUMP RecName: Full=GTP-binding protein era homolog;
   13::170     9e-07  27%  296 aa  ERA_EHRCR RecName: Full=GTP-binding protein era homolog;
    8::178     9e-07  29%  300 aa  ERA_CALS8 RecName: Full=GTP-binding protein era homolog;
    5::172     9e-07  28%  500 aa  ENGA_VIBFM RecName: Full=GTP-binding protein engA;
    5::172     9e-07  28%  500 aa  ENGA_VIBF1 RecName: Full=GTP-binding protein engA;
    5::129     9e-07  36%  471 aa  ENGA_SYMTH RecName: Full=GTP-binding protein engA;
    5::159     9e-07  29%  487 aa  ENGA_PSEPK RecName: Full=GTP-binding protein engA;
    5::159     9e-07  29%  487 aa  ENGA_PSEPG RecName: Full=GTP-binding protein engA;
    5::159     9e-07  29%  487 aa  ENGA_PSEP1 RecName: Full=GTP-binding protein engA;
    5::162     9e-07  29%  493 aa  ENGA_PHOPR RecName: Full=GTP-binding protein engA;
    1::119     9e-07  31%  449 aa  ENGA_MYCPN RecName: Full=GTP-binding protein engA;
    6::176     9e-07  33%  455 aa  ENGA_HERA2 RecName: Full=GTP-binding protein engA;
    5::160     9e-07  32%  449 aa  ENGA_GEOLS RecName: Full=GTP-binding protein engA;
   71::168     9e-07  30%  367 aa  DRG1_MOUSE RecName: Full=Developmentally-regulated GTP-binding
   71::168     9e-07  30%  367 aa  DRG1_HUMAN RecName: Full=Developmentally-regulated GTP-binding
   71::168     9e-07  30%  367 aa  DRG1_BOVIN RecName: Full=Developmentally-regulated GTP-binding
  168::326     1e-06  30%  331 aa  OBG_SYNR3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::291     1e-06  34%  430 aa  OBG_STAHJ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  147::214     1e-06  35%  418 aa  OBG_MYCPU RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::301     1e-06  34%  431 aa  OBG_LACPL RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::253     1e-06  32%  352 aa  OBG_CAMC1 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  193::342     1e-06  35%  454 aa  MNME_YERPY RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  35%  454 aa  MNME_YERPS RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  35%  454 aa  MNME_YERPP RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  35%  454 aa  MNME_YERPN RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  35%  454 aa  MNME_YERPG RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  35%  454 aa  MNME_YERPE RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  35%  454 aa  MNME_YERPB RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  35%  454 aa  MNME_YERPA RecName: Full=tRNA modification GTPase mnmE;       
  216::370     1e-06  28%  450 aa  MNME_THELT RecName: Full=tRNA modification GTPase mnmE;       
  196::365     1e-06  26%  458 aa  MNME_STRPC RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  30%  454 aa  MNME_SHISS RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  30%  454 aa  MNME_SHIDS RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  30%  454 aa  MNME_SHIBS RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  30%  454 aa  MNME_SHIB3 RecName: Full=tRNA modification GTPase mnmE;       
  220::379     1e-06  33%  455 aa  MNME_PSYIN RecName: Full=tRNA modification GTPase mnmE;       
  218::342     1e-06  31%  456 aa  MNME_PSEPU RecName: Full=tRNA modification GTPase mnmE;       
  218::342     1e-06  31%  456 aa  MNME_PSEPK RecName: Full=tRNA modification GTPase mnmE;       
  218::342     1e-06  31%  456 aa  MNME_PSEP1 RecName: Full=tRNA modification GTPase mnmE;       
   86::354     1e-06  30%  451 aa  MNME_NITEC RecName: Full=tRNA modification GTPase mnmE;       
  159::347     1e-06  32%  466 aa  MNME_HERAR RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  30%  454 aa  MNME_ESCF3 RecName: Full=tRNA modification GTPase mnmE;       
  219::342     1e-06  31%  454 aa  MNME_ERWCT RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  30%  454 aa  MNME_ECOSM RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  30%  454 aa  MNME_ECOSE RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  30%  454 aa  MNME_ECOLU RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  30%  454 aa  MNME_ECOLI RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  30%  454 aa  MNME_ECOLC RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  30%  454 aa  MNME_ECOHS RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  30%  454 aa  MNME_ECODH RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  30%  454 aa  MNME_ECOBW RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  30%  454 aa  MNME_ECO8A RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  30%  454 aa  MNME_ECO81 RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  30%  454 aa  MNME_ECO5E RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  30%  454 aa  MNME_ECO57 RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  30%  454 aa  MNME_ECO55 RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  30%  454 aa  MNME_ECO27 RecName: Full=tRNA modification GTPase mnmE;       
  193::342     1e-06  30%  454 aa  MNME_ECO24 RecName: Full=tRNA modification GTPase mnmE;       
    6::166     1e-06  30%  299 aa  ERA_THEAB RecName: Full=GTP-binding protein era homolog;
   13::137     1e-06  28%  304 aa  ERA_PEDPA RecName: Full=GTP-binding protein era homolog;
   22::181     1e-06  29%  311 aa  ERA_BRUME RecName: Full=GTP-binding protein era homolog;
    8::178     1e-06  27%  300 aa  ERA_ANATD RecName: Full=GTP-binding protein era homolog;
    5::161     1e-06  30%  436 aa  ENGA_STRSY RecName: Full=GTP-binding protein engA;
    5::161     1e-06  30%  436 aa  ENGA_STRS2 RecName: Full=GTP-binding protein engA;
    6::160     1e-06  28%  447 aa  ENGA_RICCK RecName: Full=GTP-binding protein engA;
    2::163     1e-06  31%  452 aa  ENGA_MICAN RecName: Full=GTP-binding protein engA;
   71::168     1e-06  29%  367 aa  DRG1_XENLA RecName: Full=Developmentally-regulated GTP-binding
  163::286     2e-06  37%  430 aa  OBG_STAES RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::286     2e-06  37%  430 aa  OBG_STAEQ RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::293     2e-06  29%  437 aa  OBG_LACLS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::293     2e-06  29%  437 aa  OBG_LACLM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::333     2e-06  30%  424 aa  OBG_DEHSC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::333     2e-06  30%  424 aa  OBG_DEHSB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  148::309     2e-06  32%  459 aa  MNME_SYNWW RecName: Full=tRNA modification GTPase mnmE;       
  220::371     2e-06  27%  459 aa  MNME_STAHJ RecName: Full=tRNA modification GTPase mnmE;       
  207::305     2e-06  35%  453 aa  MNME_SHESH RecName: Full=tRNA modification GTPase mnmE;       
  207::305     2e-06  35%  453 aa  MNME_SHELP RecName: Full=tRNA modification GTPase mnmE;       
  188::275     2e-06  36%  453 aa  MNME_SHEB9 RecName: Full=tRNA modification GTPase mnmE;       
  188::275     2e-06  36%  453 aa  MNME_SHEB8 RecName: Full=tRNA modification GTPase mnmE;       
  188::275     2e-06  36%  453 aa  MNME_SHEB5 RecName: Full=tRNA modification GTPase mnmE;       
  220::339     2e-06  30%  456 aa  MNME_SACD2 RecName: Full=tRNA modification GTPase mnmE;       
  208::313     2e-06  38%  454 aa  MNME_PSEHT RecName: Full=tRNA modification GTPase mnmE;       
  227::343     2e-06  31%  458 aa  MNME_PARUW RecName: Full=tRNA modification GTPase mnmE;       
  193::334     2e-06  35%  448 aa  MNME_METCA RecName: Full=tRNA modification GTPase mnmE;       
  226::382     2e-06  31%  466 aa  MNME_HELMI RecName: Full=tRNA modification GTPase mnmE;       
  180::343     2e-06  31%  452 aa  MNME_HAES2 RecName: Full=tRNA modification GTPase mnmE;       
  217::337     2e-06  31%  443 aa  MNME_ANAMM RecName: Full=tRNA modification GTPase mnmE;       
    8::138     2e-06  25%  298 aa  ERA_THETN RecName: Full=GTP-binding protein era homolog;
    8::138     2e-06  25%  302 aa  ERA_THEPX RecName: Full=GTP-binding protein era homolog;
    8::138     2e-06  25%  302 aa  ERA_THEP3 RecName: Full=GTP-binding protein era homolog;
   22::181     2e-06  29%  311 aa  ERA_BRUSU RecName: Full=GTP-binding protein era homolog;
    5::159     2e-06  30%  499 aa  ENGA_PSEU5 RecName: Full=GTP-binding protein engA;
    5::136     2e-06  32%  493 aa  ENGA_PSEAE RecName: Full=GTP-binding protein engA;
    5::136     2e-06  32%  493 aa  ENGA_PSEAB RecName: Full=GTP-binding protein engA;
    5::136     2e-06  32%  493 aa  ENGA_PSEA8 RecName: Full=GTP-binding protein engA;
    5::136     2e-06  32%  493 aa  ENGA_PSEA7 RecName: Full=GTP-binding protein engA;
  169::343     2e-06  34%  448 aa  ENGA_PELPD RecName: Full=GTP-binding protein engA;
    3::122     2e-06  34%  483 aa  ENGA_OCHA4 RecName: Full=GTP-binding protein engA;
   29::209     2e-06  31%  463 aa  ENGA_BIFLO RecName: Full=GTP-binding protein engA;
    4::160     2e-06  37%  442 aa  ENGA_AZOSE RecName: Full=GTP-binding protein engA;
  150::217     2e-06  37%  337 aa  OBG_WOLPP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::293     2e-06  33%  435 aa  OBG_LACF3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  168::216     2e-06  45%  352 aa  OBG_ERYLH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::286     2e-06  29%  428 aa  OBG_CLOBB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::308     2e-06  36%  376 aa  OBG_CAMC5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  196::365     2e-06  26%  458 aa  MNME_STRP1 RecName: Full=tRNA modification GTPase mnmE;       
  220::371     2e-06  28%  459 aa  MNME_STAES RecName: Full=tRNA modification GTPase mnmE;       
  220::371     2e-06  28%  459 aa  MNME_STAEQ RecName: Full=tRNA modification GTPase mnmE;       
  188::275     2e-06  36%  453 aa  MNME_SHESR RecName: Full=tRNA modification GTPase mnmE;       
  188::275     2e-06  36%  453 aa  MNME_SHESM RecName: Full=tRNA modification GTPase mnmE;       
  189::342     2e-06  30%  456 aa  MNME_PSEE4 RecName: Full=tRNA modification GTPase mnmE;       
  219::342     2e-06  29%  454 aa  MNME_PROMH RecName: Full=tRNA modification GTPase mnmE;       
  213::372     2e-06  29%  450 aa  MNME_FRAP2 RecName: Full=tRNA modification GTPase mnmE;       
  226::312     2e-06  34%  461 aa  MNME_DESRM RecName: Full=tRNA modification GTPase mnmE;       
    7::175     2e-06  27%  296 aa  ERA_CLOPS RecName: Full=GTP-binding protein era homolog;
    7::175     2e-06  27%  296 aa  ERA_CLOPE RecName: Full=GTP-binding protein era homolog;
    5::90      2e-06  33%  496 aa  ENGA_PROMH RecName: Full=GTP-binding protein engA;
    6::91      2e-06  34%  510 aa  ENGA_PASMU RecName: Full=GTP-binding protein engA;
    5::90      2e-06  35%  462 aa  ENGA_LEGPL RecName: Full=GTP-binding protein engA;
    6::161     2e-06  35%  438 aa  ENGA_GEOSL RecName: Full=GTP-binding protein engA;
    5::90      2e-06  33%  499 aa  ENGA_ERWT9 RecName: Full=GTP-binding protein engA;
  181::355     2e-06  31%  492 aa  ENGA_DESAH RecName: Full=GTP-binding protein engA;
    4::183     2e-06  34%  443 aa  ENGA_DECAR RecName: Full=GTP-binding protein engA;
    5::161     2e-06  28%  443 aa  ENGA_COXB2 RecName: Full=GTP-binding protein engA;
   76::240     2e-06  31%  519 aa  ENGA_CORGL RecName: Full=GTP-binding protein engA;
  114::354     2e-06  28%  449 aa  ENGA_CHLSY RecName: Full=GTP-binding protein engA;
  114::354     2e-06  28%  449 aa  ENGA_CHLAA RecName: Full=GTP-binding protein engA;
    5::159     2e-06  31%  433 aa  ENGA_AMOA5 RecName: Full=GTP-binding protein engA;
  160::219     3e-06  31%  327 aa  OBG_SULMW RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::286     3e-06  29%  428 aa  OBG_CLOBA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  196::372     3e-06  31%  460 aa  MNME_THEPX RecName: Full=tRNA modification GTPase mnmE;       
  196::372     3e-06  31%  460 aa  MNME_THEP3 RecName: Full=tRNA modification GTPase mnmE;       
  196::365     3e-06  26%  458 aa  MNME_STRPG RecName: Full=tRNA modification GTPase mnmE;       
  196::365     3e-06  26%  458 aa  MNME_STRPD RecName: Full=tRNA modification GTPase mnmE;       
  196::365     3e-06  26%  458 aa  MNME_STRP8 RecName: Full=tRNA modification GTPase mnmE;       
  196::365     3e-06  26%  458 aa  MNME_STRP3 RecName: Full=tRNA modification GTPase mnmE;       
  187::292     3e-06  34%  459 aa  MNME_PELTS RecName: Full=tRNA modification GTPase mnmE;       
  224::374     3e-06  27%  458 aa  MNME_NATTJ RecName: Full=tRNA modification GTPase mnmE;       
  219::342     3e-06  31%  454 aa  MNME_ERWT9 RecName: Full=tRNA modification GTPase mnmE;       
  197::349     3e-06  30%  464 aa  MNME_BORAP RecName: Full=tRNA modification GTPase mnmE;       
  227::334     3e-06  32%  479 aa  MNME_BDEBA RecName: Full=tRNA modification GTPase mnmE;       
  217::276     3e-06  41%  444 aa  MNME_ALHEH RecName: Full=tRNA modification GTPase mnmE;       
   24::183     3e-06  28%  313 aa  ERA_RHIME RecName: Full=GTP-binding protein era homolog;
    6::129     3e-06  27%  296 aa  ERA_FUSNN RecName: Full=GTP-binding protein era homolog;
    8::170     3e-06  28%  295 aa  ERA_ALKOO RecName: Full=GTP-binding protein era homolog;
    5::90      3e-06  33%  495 aa  ENGA_YERPY RecName: Full=GTP-binding protein engA;
    5::90      3e-06  33%  495 aa  ENGA_YERPS RecName: Full=GTP-binding protein engA;
    5::90      3e-06  33%  495 aa  ENGA_YERPP RecName: Full=GTP-binding protein engA;
    5::90      3e-06  33%  495 aa  ENGA_YERPN RecName: Full=GTP-binding protein engA;
    5::90      3e-06  33%  495 aa  ENGA_YERPG RecName: Full=GTP-binding protein engA;
    5::90      3e-06  33%  495 aa  ENGA_YERPE RecName: Full=GTP-binding protein engA;
    5::90      3e-06  33%  495 aa  ENGA_YERPB RecName: Full=GTP-binding protein engA;
    5::90      3e-06  33%  495 aa  ENGA_YERPA RecName: Full=GTP-binding protein engA;
    5::90      3e-06  33%  495 aa  ENGA_YERP3 RecName: Full=GTP-binding protein engA;
    5::90      3e-06  31%  494 aa  ENGA_SERP5 RecName: Full=GTP-binding protein engA;
  182::355     3e-06  28%  447 aa  ENGA_RICTY RecName: Full=GTP-binding protein engA;
    5::159     3e-06  27%  492 aa  ENGA_ENTS8 RecName: Full=GTP-binding protein engA;
    5::161     3e-06  28%  443 aa  ENGA_COXBU RecName: Full=GTP-binding protein engA;
    5::161     3e-06  28%  443 aa  ENGA_COXBR RecName: Full=GTP-binding protein engA;
    5::161     3e-06  28%  443 aa  ENGA_COXBN RecName: Full=GTP-binding protein engA;
    5::161     3e-06  28%  443 aa  ENGA_COXB1 RecName: Full=GTP-binding protein engA;
    5::160     3e-06  29%  469 aa  ENGA_ACIB5 RecName: Full=GTP-binding protein engA;
  159::199     4e-06  44%  330 aa  OBG_SYNPX RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::199     4e-06  44%  329 aa  OBG_SYNPW RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::199     4e-06  44%  329 aa  OBG_PROMM RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::199     4e-06  44%  329 aa  OBG_PROM3 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  156::315     4e-06  29%  422 aa  OBG_MYCA5 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::221     4e-06  38%  341 aa  OBG_LEPBP RecName: Full=GTPase obg;AltName: Full=GTP-binding
  160::221     4e-06  38%  341 aa  OBG_LEPBA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  161::301     4e-06  33%  335 aa  OBG_CHLTR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  161::301     4e-06  33%  335 aa  OBG_CHLTB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  161::301     4e-06  33%  335 aa  OBG_CHLTA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  161::301     4e-06  33%  335 aa  OBG_CHLT2 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  207::275     4e-06  40%  453 aa  MNME_SHESW RecName: Full=tRNA modification GTPase mnmE;       
  207::275     4e-06  40%  453 aa  MNME_SHESA RecName: Full=tRNA modification GTPase mnmE;       
  207::275     4e-06  40%  453 aa  MNME_SHEPC RecName: Full=tRNA modification GTPase mnmE;       
  207::275     4e-06  40%  453 aa  MNME_SHEPA RecName: Full=tRNA modification GTPase mnmE;       
  207::275     4e-06  40%  453 aa  MNME_SHEON RecName: Full=tRNA modification GTPase mnmE;       
  207::275     4e-06  40%  453 aa  MNME_SHEHH RecName: Full=tRNA modification GTPase mnmE;       
  218::342     4e-06  30%  456 aa  MNME_PSEPW RecName: Full=tRNA modification GTPase mnmE;       
  218::283     4e-06  40%  456 aa  MNME_PSEF5 RecName: Full=tRNA modification GTPase mnmE;       
  219::342     4e-06  31%  454 aa  MNME_CITK8 RecName: Full=tRNA modification GTPase mnmE;       
  145::348     4e-06  32%  458 aa  MNME_CHRSD RecName: Full=tRNA modification GTPase mnmE;       
  168::359     4e-06  26%  458 aa  MNME_BACHK RecName: Full=tRNA modification GTPase mnmE;       
  168::359     4e-06  26%  458 aa  MNME_BACCZ RecName: Full=tRNA modification GTPase mnmE;       
  168::359     4e-06  26%  458 aa  MNME_BACAN RecName: Full=tRNA modification GTPase mnmE;       
  168::359     4e-06  26%  458 aa  MNME_BACAH RecName: Full=tRNA modification GTPase mnmE;       
    4::127     4e-06  26%  668 aa  FEOB_METJA RecName: Full=Ferrous iron transport protein B homolog;
   17::141     4e-06  33%  306 aa  ERA_PASMU RecName: Full=GTP-binding protein era homolog;
   11::135     4e-06  30%  303 aa  ERA_LEUMM RecName: Full=GTP-binding protein era homolog;
    7::175     4e-06  28%  293 aa  ERA_CLOK5 RecName: Full=GTP-binding protein era homolog;
    7::175     4e-06  28%  293 aa  ERA_CLOK1 RecName: Full=GTP-binding protein era homolog;
    5::170     4e-06  28%  436 aa  ENGA_STRPZ RecName: Full=GTP-binding protein engA;
    5::170     4e-06  28%  436 aa  ENGA_STRPM RecName: Full=GTP-binding protein engA;
    5::170     4e-06  28%  436 aa  ENGA_STRPF RecName: Full=GTP-binding protein engA;
    5::170     4e-06  28%  436 aa  ENGA_STRPD RecName: Full=GTP-binding protein engA;
    5::170     4e-06  28%  436 aa  ENGA_STRPC RecName: Full=GTP-binding protein engA;
    5::170     4e-06  28%  436 aa  ENGA_STRPB RecName: Full=GTP-binding protein engA;
    5::170     4e-06  28%  436 aa  ENGA_STRP8 RecName: Full=GTP-binding protein engA;
    5::170     4e-06  28%  436 aa  ENGA_STRP6 RecName: Full=GTP-binding protein engA;
    5::170     4e-06  28%  436 aa  ENGA_STRP3 RecName: Full=GTP-binding protein engA;
    5::170     4e-06  28%  436 aa  ENGA_STRP1 RecName: Full=GTP-binding protein engA;
    4::163     4e-06  30%  468 aa  ENGA_NITEC RecName: Full=GTP-binding protein engA;
    5::126     4e-06  31%  462 aa  ENGA_LEGPH RecName: Full=GTP-binding protein engA;
    5::90      4e-06  33%  492 aa  ENGA_KLEP7 RecName: Full=GTP-binding protein engA;
    5::169     4e-06  30%  472 aa  ENGA_HAHCH RecName: Full=GTP-binding protein engA;
    5::161     4e-06  38%  441 aa  ENGA_GEOUR RecName: Full=GTP-binding protein engA;
  142::352     4e-06  28%  440 aa  ENGA_FUSNN RecName: Full=GTP-binding protein engA;
    6::166     4e-06  32%  452 aa  ENGA_CYAP7 RecName: Full=GTP-binding protein engA;
    5::90      4e-06  39%  472 aa  ENGA_BAUCH RecName: Full=GTP-binding protein engA;
    5::90      4e-06  33%  481 aa  ENGA_ALTMD RecName: Full=GTP-binding protein engA;
   71::150     4e-06  30%  368 aa  128UP_DROME RecName: Full=GTP-binding protein 128up;
  168::220     5e-06  32%  337 aa  OBG_WIGBR RecName: Full=GTPase obg;AltName: Full=GTP-binding
  155::300     5e-06  31%  445 aa  OBG_TROWT RecName: Full=GTPase obg;AltName: Full=GTP-binding
  155::300     5e-06  31%  445 aa  OBG_TROW8 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  159::199     5e-06  44%  329 aa  OBG_SYNS9 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::283     5e-06  30%  357 aa  OBG_NAUPA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  164::286     5e-06  33%  356 aa  OBG_HYPNA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  161::301     5e-06  32%  335 aa  OBG_CHLMU RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::218     5e-06  40%  363 aa  OBG_ARCB4 RecName: Full=GTPase obg;AltName: Full=GTP-binding
  196::383     5e-06  26%  458 aa  MNME_STRPF RecName: Full=tRNA modification GTPase mnmE;       
  218::342     5e-06  28%  455 aa  MNME_PSEU5 RecName: Full=tRNA modification GTPase mnmE;       
  178::333     5e-06  33%  443 aa  MNME_PELUB RecName: Full=tRNA modification GTPase mnmE;       
   86::337     5e-06  28%  451 aa  MNME_NITEU RecName: Full=tRNA modification GTPase mnmE;       
  221::371     5e-06  32%  456 aa  MNME_LEPIN RecName: Full=tRNA modification GTPase mnmE;       
  229::386     5e-06  31%  461 aa  MNME_HELPJ RecName: Full=tRNA modification GTPase mnmE;       
  219::342     5e-06  31%  454 aa  MNME_ENT38 RecName: Full=tRNA modification GTPase mnmE;       
  219::342     5e-06  31%  454 aa  MNME_ECOUT RecName: Full=tRNA modification GTPase mnmE;       
  219::342     5e-06  31%  454 aa  MNME_ECOL6 RecName: Full=tRNA modification GTPase mnmE;       
  219::342     5e-06  31%  454 aa  MNME_ECOL5 RecName: Full=tRNA modification GTPase mnmE;       
  219::342     5e-06  31%  454 aa  MNME_ECOK1 RecName: Full=tRNA modification GTPase mnmE;       
  219::342     5e-06  31%  454 aa  MNME_ECO45 RecName: Full=tRNA modification GTPase mnmE;       
  199::349     5e-06  26%  459 aa  MNME_CLOAB RecName: Full=tRNA modification GTPase mnmE;       
    8::168     5e-06  29%  293 aa  ERA_RICAH RecName: Full=GTP-binding protein era homolog;
   10::126     5e-06  28%  300 aa  ERA_LACS1 RecName: Full=GTP-binding protein era homolog;
    9::131     5e-06  27%  299 aa  ERA_HELMI RecName: Full=GTP-binding protein era homolog;
   13::170     5e-06  29%  296 aa  ERA_EHRRW RecName: Full=GTP-binding protein era homolog;
    8::169     5e-06  27%  298 aa  ERA_CLOCE RecName: Full=GTP-binding protein era homolog;
    5::162     5e-06  32%  436 aa  ENGA_STRU0 RecName: Full=GTP-binding protein engA;
    5::170     5e-06  28%  436 aa  ENGA_STRPG RecName: Full=GTP-binding protein engA;
    5::161     5e-06  30%  436 aa  ENGA_PROVI RecName: Full=GTP-binding protein engA;
    4::163     5e-06  30%  467 aa  ENGA_NITEU RecName: Full=GTP-binding protein engA;
    6::162     5e-06  31%  435 aa  ENGA_MESFL RecName: Full=GTP-binding protein engA;
    5::90      5e-06  34%  462 aa  ENGA_LEGPC RecName: Full=GTP-binding protein engA;
    5::90      5e-06  34%  462 aa  ENGA_LEGPA RecName: Full=GTP-binding protein engA;
  174::343     5e-06  28%  442 aa  ENGA_HELMI RecName: Full=GTP-binding protein engA;
    5::183     5e-06  36%  441 aa  ENGA_GEOSF RecName: Full=GTP-binding protein engA;
    6::129     5e-06  33%  437 aa  ENGA_FLAJ1 RecName: Full=GTP-binding protein engA;
    5::162     5e-06  28%  466 aa  ENGA_CELJU RecName: Full=GTP-binding protein engA;
    3::91      5e-06  39%  456 aa  ENGA_BRASO RecName: Full=GTP-binding protein engA;
    5::122     5e-06  36%  449 aa  ENGA_ACIF5 RecName: Full=GTP-binding protein engA;
    5::122     5e-06  36%  449 aa  ENGA_ACIF2 RecName: Full=GTP-binding protein engA;
  161::297     6e-06  33%  335 aa  OBG_CHLCV RecName: Full=GTPase obg;AltName: Full=GTP-binding
  196::365     6e-06  25%  458 aa  MNME_STRP6 RecName: Full=tRNA modification GTPase mnmE;       
  207::305     6e-06  34%  453 aa  MNME_SHEWM RecName: Full=tRNA modification GTPase mnmE;       
  140::303     6e-06  30%  452 aa  MNME_NITMU RecName: Full=tRNA modification GTPase mnmE;       
  222::353     6e-06  30%  461 aa  MNME_LYSSC RecName: Full=tRNA modification GTPase mnmE;       
  181::343     6e-06  29%  454 aa  MNME_ENTS8 RecName: Full=tRNA modification GTPase mnmE;       
  154::341     6e-06  31%  450 aa  MNME_CHRVO RecName: Full=tRNA modification GTPase mnmE;       
  197::379     6e-06  30%  464 aa  MNME_BORBZ RecName: Full=tRNA modification GTPase mnmE;       
  197::379     6e-06  30%  464 aa  MNME_BORBU RecName: Full=tRNA modification GTPase mnmE;       
  184::346     6e-06  32%  451 aa  MNME_AZOSE RecName: Full=tRNA modification GTPase mnmE;       
    5::123     6e-06  28%  751 aa  FEOB_LEGPN RecName: Full=Ferrous iron transport protein B;
    5::123     6e-06  28%  751 aa  FEOB_LEGPL RecName: Full=Ferrous iron transport protein B;
    5::123     6e-06  28%  751 aa  FEOB_LEGPH RecName: Full=Ferrous iron transport protein B;
    5::123     6e-06  28%  751 aa  FEOB_LEGPA RecName: Full=Ferrous iron transport protein B;
    9::132     6e-06  30%  299 aa  ERA_STAAW RecName: Full=GTP-binding protein era homolog;
    9::132     6e-06  30%  299 aa  ERA_STAAT RecName: Full=GTP-binding protein era homolog;
    9::132     6e-06  30%  299 aa  ERA_STAAS RecName: Full=GTP-binding protein era homolog;
    9::132     6e-06  30%  299 aa  ERA_STAAR RecName: Full=GTP-binding protein era homolog;
    9::132     6e-06  30%  299 aa  ERA_STAAN RecName: Full=GTP-binding protein era homolog;
    9::132     6e-06  30%  299 aa  ERA_STAAM RecName: Full=GTP-binding protein era homolog;
    9::132     6e-06  30%  299 aa  ERA_STAAE RecName: Full=GTP-binding protein era homolog;
    9::132     6e-06  30%  299 aa  ERA_STAAC RecName: Full=GTP-binding protein era homolog;
    9::132     6e-06  30%  299 aa  ERA_STAAB RecName: Full=GTP-binding protein era homolog;
    9::132     6e-06  30%  299 aa  ERA_STAA9 RecName: Full=GTP-binding protein era homolog;
    9::132     6e-06  30%  299 aa  ERA_STAA3 RecName: Full=GTP-binding protein era homolog;
    9::132     6e-06  30%  299 aa  ERA_STAA2 RecName: Full=GTP-binding protein era homolog;
    9::132     6e-06  30%  299 aa  ERA_STAA1 RecName: Full=GTP-binding protein era homolog;
   18::141     6e-06  27%  308 aa  ERA_OLICO RecName: Full=GTP-binding protein era homolog;
   15::139     6e-06  33%  304 aa  ERA_HAES2 RecName: Full=GTP-binding protein era homolog;
   11::135     6e-06  33%  300 aa  ERA_HAES1 RecName: Full=GTP-binding protein era homolog;
    7::175     6e-06  26%  296 aa  ERA_CLOP1 RecName: Full=GTP-binding protein era homolog;
    6::174     6e-06  28%  301 aa  ERA_AQUAE RecName: Full=GTP-binding protein era homolog;
    5::163     6e-06  28%  496 aa  ENGA_VIBVY RecName: Full=GTP-binding protein engA;
    5::163     6e-06  28%  496 aa  ENGA_VIBVU RecName: Full=GTP-binding protein engA;
    5::170     6e-06  27%  488 aa  ENGA_SHESW RecName: Full=GTP-binding protein engA;
    5::170     6e-06  27%  488 aa  ENGA_SHEPC RecName: Full=GTP-binding protein engA;
    6::169     6e-06  25%  447 aa  ENGA_RICPR RecName: Full=GTP-binding protein engA;
    7::159     6e-06  26%  433 aa  ENGA_BORAP RecName: Full=GTP-binding protein engA;
    5::160     6e-06  29%  469 aa  ENGA_ACIBY RecName: Full=GTP-binding protein engA;
    5::160     6e-06  29%  469 aa  ENGA_ACIBT RecName: Full=GTP-binding protein engA;
    5::160     6e-06  29%  469 aa  ENGA_ACIBS RecName: Full=GTP-binding protein engA;
    5::160     6e-06  29%  469 aa  ENGA_ACIBC RecName: Full=GTP-binding protein engA;
    5::160     6e-06  29%  469 aa  ENGA_ACIB3 RecName: Full=GTP-binding protein engA;
  164::330     8e-06  27%  352 aa  OBG_NOVAD RecName: Full=GTPase obg;AltName: Full=GTP-binding
  163::218     8e-06  38%  344 aa  OBG_CAMFF RecName: Full=GTPase obg;AltName: Full=GTP-binding
  214::300     8e-06  35%  450 aa  MNME_THESQ RecName: Full=tRNA modification GTPase mnmE;       
  214::300     8e-06  35%  450 aa  MNME_THEMA RecName: Full=tRNA modification GTPase mnmE;       
  193::342     8e-06  33%  454 aa  MNME_SERP5 RecName: Full=tRNA modification GTPase mnmE;       
  158::346     8e-06  30%  465 aa  MNME_JANMA RecName: Full=tRNA modification GTPase mnmE;       
  223::346     8e-06  30%  458 aa  MNME_IDILO RecName: Full=tRNA modification GTPase mnmE;       
  226::334     8e-06  38%  437 aa  MNME_GLUOX RecName: Full=tRNA modification GTPase mnmE;       
  216::335     8e-06  33%  441 aa  MNME_EHRCJ RecName: Full=tRNA modification GTPase mnmE;       
   98::345     8e-06  28%  464 aa  MNME_BURVG RecName: Full=tRNA modification GTPase mnmE;       
  214::307     8e-06  38%  459 aa  MNME_BUCBP RecName: Full=tRNA modification GTPase mnmE;       
  213::345     8e-06  32%  456 aa  MNME_BUCAP RecName: Full=tRNA modification GTPase mnmE;       
  168::346     8e-06  26%  458 aa  MNME_BACC1 RecName: Full=tRNA modification GTPase mnmE;       
  220::373     8e-06  28%  454 aa  MNME_ACIBL RecName: Full=tRNA modification GTPase mnmE;       
   21::181     8e-06  28%  310 aa  ERA_SINMW RecName: Full=GTP-binding protein era homolog;
   13::148     8e-06  30%  314 aa  ERA_MARMM RecName: Full=GTP-binding protein era homolog;
    8::129     8e-06  30%  294 aa  ERA_HALOH RecName: Full=GTP-binding protein era homolog;
   13::129     8e-06  31%  302 aa  ERA_HAEIN RecName: Full=GTP-binding protein era homolog;
    7::146     8e-06  28%  296 aa  ERA_CLOBL RecName: Full=GTP-binding protein era homolog;
    7::138     8e-06  25%  295 aa  ERA_CLOBA RecName: Full=GTP-binding protein era homolog;
    4::122     8e-06  30%  469 aa  ENGA_THIDA RecName: Full=GTP-binding protein engA;
    6::169     8e-06  32%  460 aa  ENGA_THERP RecName: Full=GTP-binding protein engA;
    5::161     8e-06  29%  436 aa  ENGA_STRGC RecName: Full=GTP-binding protein engA;
    5::162     8e-06  28%  488 aa  ENGA_SHESR RecName: Full=GTP-binding protein engA;
    5::162     8e-06  28%  488 aa  ENGA_SHESM RecName: Full=GTP-binding protein engA;
    5::162     8e-06  30%  488 aa  ENGA_SHESH RecName: Full=GTP-binding protein engA;
    5::162     8e-06  28%  488 aa  ENGA_SHESA RecName: Full=GTP-binding protein engA;
    5::162     8e-06  28%  487 aa  ENGA_SHEON RecName: Full=GTP-binding protein engA;
    6::160     8e-06  27%  447 aa  ENGA_RICAH RecName: Full=GTP-binding protein engA;
    6::167     8e-06  28%  456 aa  ENGA_NOSP7 RecName: Full=GTP-binding protein engA;
    5::160     8e-06  32%  440 aa  ENGA_GEOSM RecName: Full=GTP-binding protein engA;
    7::164     8e-06  28%  471 aa  ENGA_ALCBS RecName: Full=GTP-binding protein engA;
   90::275     1e-05  32%  453 aa  MNME_VIBVY RecName: Full=tRNA modification GTPase mnmE;       
   90::275     1e-05  32%  453 aa  MNME_VIBVU RecName: Full=tRNA modification GTPase mnmE;       
  195::371     1e-05  25%  459 aa  MNME_STAAW RecName: Full=tRNA modification GTPase mnmE;       
  195::371     1e-05  25%  459 aa  MNME_STAAT RecName: Full=tRNA modification GTPase mnmE;       
  195::371     1e-05  25%  459 aa  MNME_STAAS RecName: Full=tRNA modification GTPase mnmE;       
  195::371     1e-05  25%  459 aa  MNME_STAAR RecName: Full=tRNA modification GTPase mnmE;       
  195::371     1e-05  25%  459 aa  MNME_STAAN RecName: Full=tRNA modification GTPase mnmE;       
  195::371     1e-05  25%  459 aa  MNME_STAAE RecName: Full=tRNA modification GTPase mnmE;       
  195::371     1e-05  25%  459 aa  MNME_STAAC RecName: Full=tRNA modification GTPase mnmE;       
  195::371     1e-05  25%  459 aa  MNME_STAAB RecName: Full=tRNA modification GTPase mnmE;       
  195::371     1e-05  25%  459 aa  MNME_STAA9 RecName: Full=tRNA modification GTPase mnmE;       
  195::371     1e-05  25%  459 aa  MNME_STAA8 RecName: Full=tRNA modification GTPase mnmE;       
  195::371     1e-05  25%  459 aa  MNME_STAA3 RecName: Full=tRNA modification GTPase mnmE;       
  195::371     1e-05  25%  459 aa  MNME_STAA2 RecName: Full=tRNA modification GTPase mnmE;       
  197::378     1e-05  24%  460 aa  MNME_PSEA6 RecName: Full=tRNA modification GTPase mnmE;       
  118::283     1e-05  31%  471 aa  MNME_COLP3 RecName: Full=tRNA modification GTPase mnmE;       
  226::295     1e-05  37%  459 aa  MNME_CLOTE RecName: Full=tRNA modification GTPase mnmE;       
  127::274     1e-05  29%  454 aa  MNME_BUCCC RecName: Full=tRNA modification GTPase mnmE;       
    8::131     1e-05  27%  299 aa  ERA_STRSY RecName: Full=GTP-binding protein era homolog;
    8::131     1e-05  27%  299 aa  ERA_STRS2 RecName: Full=GTP-binding protein era homolog;
   11::168     1e-05  31%  304 aa  ERA_ERYLH RecName: Full=GTP-binding protein era homolog;
    3::126     1e-05  36%  470 aa  ENGA_WOLSU RecName: Full=GTP-binding protein engA;
    6::167     1e-05  29%  449 aa  ENGA_THEEB RecName: Full=GTP-binding protein engA;
    6::162     1e-05  32%  455 aa  ENGA_SYNS9 RecName: Full=GTP-binding protein engA;
    5::160     1e-05  30%  436 aa  ENGA_STRMU RecName: Full=GTP-binding protein engA;
    5::90      1e-05  29%  495 aa  ENGA_PECCP RecName: Full=GTP-binding protein engA;
    3::120     1e-05  35%  460 aa  ENGA_NITHX RecName: Full=GTP-binding protein engA;
    6::161     1e-05  29%  440 aa  ENGA_NATTJ RecName: Full=GTP-binding protein engA;
  169::300     1e-05  26%  444 aa  ENGA_MYCPE RecName: Full=GTP-binding protein engA;
    5::161     1e-05  33%  436 aa  ENGA_LACLA RecName: Full=GTP-binding protein engA;
    5::160     1e-05  31%  440 aa  ENGA_GEOBB RecName: Full=GTP-binding protein engA;
  165::284     1e-05  34%  429 aa  OBG_MYCPE RecName: Full=GTPase obg;AltName: Full=GTP-binding
  218::305     1e-05  37%  453 aa  MNME_VIBPA RecName: Full=tRNA modification GTPase mnmE;       
  218::305     1e-05  37%  453 aa  MNME_VIBHB RecName: Full=tRNA modification GTPase mnmE;       
  218::305     1e-05  33%  453 aa  MNME_VIBCH RecName: Full=tRNA modification GTPase mnmE;       
  218::305     1e-05  33%  453 aa  MNME_VIBC3 RecName: Full=tRNA modification GTPase mnmE;       
  227::355     1e-05  31%  453 aa  MNME_SYNR3 RecName: Full=tRNA modification GTPase mnmE;       
  225::362     1e-05  34%  457 aa  MNME_SYMTH RecName: Full=tRNA modification GTPase mnmE;       
  193::274     1e-05  36%  454 aa  MNME_SODGM RecName: Full=tRNA modification GTPase mnmE;       
  219::342     1e-05  30%  454 aa  MNME_SALTY RecName: Full=tRNA modification GTPase mnmE;       
  219::342     1e-05  35%  454 aa  MNME_SALTI RecName: Full=tRNA modification GTPase mnmE;       
  219::342     1e-05  30%  454 aa  MNME_SALSV RecName: Full=tRNA modification GTPase mnmE;       
  219::342     1e-05  35%  454 aa  MNME_SALPK RecName: Full=tRNA modification GTPase mnmE;       
  219::342     1e-05  30%  454 aa  MNME_SALPC RecName: Full=tRNA modification GTPase mnmE;       
  219::342     1e-05  30%  454 aa  MNME_SALPB RecName: Full=tRNA modification GTPase mnmE;       
  219::342     1e-05  35%  454 aa  MNME_SALPA RecName: Full=tRNA modification GTPase mnmE;       
  219::342     1e-05  30%  454 aa  MNME_SALNS RecName: Full=tRNA modification GTPase mnmE;       
  219::342     1e-05  30%  454 aa  MNME_SALG2 RecName: Full=tRNA modification GTPase mnmE;       
  219::342     1e-05  30%  454 aa  MNME_SALEP RecName: Full=tRNA modification GTPase mnmE;       
  219::342     1e-05  30%  454 aa  MNME_SALCH RecName: Full=tRNA modification GTPase mnmE;       
  219::342     1e-05  31%  454 aa  MNME_SALAR RecName: Full=tRNA modification GTPase mnmE;       
  182::359     1e-05  27%  474 aa  MNME_RALSO RecName: Full=tRNA modification GTPase mnmE;       
  212::343     1e-05  31%  455 aa  MNME_PHOPR RecName: Full=tRNA modification GTPase mnmE;       
   21::77      1e-05  30%  614 aa  FEOB_SYNY3 RecName: Full=Ferrous iron transport protein B homolog;
    8::131     1e-05  28%  299 aa  ERA_STRSV RecName: Full=GTP-binding protein era homolog;
    8::131     1e-05  28%  299 aa  ERA_STRGC RecName: Full=GTP-binding protein era homolog;
   12::128     1e-05  33%  300 aa  ERA_PSEPF RecName: Full=GTP-binding protein era homolog;
   11::168     1e-05  28%  300 aa  ERA_HAEPS RecName: Full=GTP-binding protein era homolog;
   13::170     1e-05  29%  296 aa  ERA_EHRRG RecName: Full=GTP-binding protein era homolog;
    7::175     1e-05  27%  298 aa  ERA_CLOB8 RecName: Full=GTP-binding protein era homolog;
   15::184     1e-05  30%  207 aa  ENGB_PELLD RecName: Full=Probable GTP-binding protein engB;
    5::160     1e-05  31%  436 aa  ENGA_STRZT RecName: Full=GTP-binding protein engA;
    5::160     1e-05  31%  436 aa  ENGA_STRZP RecName: Full=GTP-binding protein engA;
    5::160     1e-05  31%  436 aa  ENGA_STRZJ RecName: Full=GTP-binding protein engA;
    5::160     1e-05  31%  436 aa  ENGA_STRR6 RecName: Full=GTP-binding protein engA;
    5::160     1e-05  31%  436 aa  ENGA_STRPS RecName: Full=GTP-binding protein engA;
    5::160     1e-05  31%  436 aa  ENGA_STRPN RecName: Full=GTP-binding protein engA;
    5::160     1e-05  31%  436 aa  ENGA_STRPJ RecName: Full=GTP-binding protein engA;
    5::160     1e-05  31%  436 aa  ENGA_STRPI RecName: Full=GTP-binding protein engA;
    5::160     1e-05  31%  436 aa  ENGA_STRP7 RecName: Full=GTP-binding protein engA;
    5::160     1e-05  31%  436 aa  ENGA_STRP4 RecName: Full=GTP-binding protein engA;
    5::160     1e-05  31%  436 aa  ENGA_STRP2 RecName: Full=GTP-binding protein engA;
    5::162     1e-05  28%  488 aa  ENGA_SHEB9 RecName: Full=GTP-binding protein engA;
    5::162     1e-05  28%  488 aa  ENGA_SHEB8 RecName: Full=GTP-binding protein engA;
    5::162     1e-05  28%  488 aa  ENGA_SHEB5 RecName: Full=GTP-binding protein engA;
    5::162     1e-05  28%  488 aa  ENGA_SHEB2 RecName: Full=GTP-binding protein engA;
    5::159     1e-05  29%  482 aa  ENGA_PSEA6 RecName: Full=GTP-binding protein engA;
    5::161     1e-05  32%  436 aa  ENGA_LACLS RecName: Full=GTP-binding protein engA;
    5::161     1e-05  32%  436 aa  ENGA_LACLM RecName: Full=GTP-binding protein engA;
    5::163     1e-05  27%  436 aa  ENGA_FLAPJ RecName: Full=GTP-binding protein engA;
    6::128     1e-05  33%  439 aa  ENGA_CLOBL RecName: Full=GTP-binding protein engA;
    6::128     1e-05  33%  439 aa  ENGA_CLOBJ RecName: Full=GTP-binding protein engA;
    5::90      1e-05  34%  467 aa  ENGA_CHRSD RecName: Full=GTP-binding protein engA;
    3::161     1e-05  30%  483 aa  ENGA_BRUO2 RecName: Full=GTP-binding protein engA;
    3::91      1e-05  39%  456 aa  ENGA_BRASB RecName: Full=GTP-binding protein engA;
    7::159     1e-05  27%  433 aa  ENGA_BORBU RecName: Full=GTP-binding protein engA;
   16::173     2e-05  34%  207 aa  RHEB1_CAEEL RecName: Full=GTP-binding protein Rheb homolog 1;Flags:
  346::468     2e-05  31%  518 aa  MTG2_YEAST RecName: Full=GTPase MTG2, mitochondrial;AltName:
  216::273     2e-05  42%  438 aa  MNME_MARMM RecName: Full=tRNA modification GTPase mnmE;       
  173::384     2e-05  22%  464 aa  MNME_LACBA RecName: Full=tRNA modification GTPase mnmE;       
  229::372     2e-05  32%  461 aa  MNME_HELPH RecName: Full=tRNA modification GTPase mnmE;       
    8::131     2e-05  29%  299 aa  ERA_STRU0 RecName: Full=GTP-binding protein era homolog;
   11::132     2e-05  26%  301 aa  ERA_ENT38 RecName: Full=GTP-binding protein era homolog;
    8::142     2e-05  26%  295 aa  ERA_ALKMQ RecName: Full=GTP-binding protein era homolog;
    5::159     2e-05  28%  436 aa  ENGA_STRA5 RecName: Full=GTP-binding protein engA;
    5::159     2e-05  28%  436 aa  ENGA_STRA1 RecName: Full=GTP-binding protein engA;
    5::162     2e-05  28%  488 aa  ENGA_SHEWM RecName: Full=GTP-binding protein engA;
    4::91      2e-05  37%  466 aa  ENGA_NITMU RecName: Full=GTP-binding protein engA;
    6::122     2e-05  33%  439 aa  ENGA_DESRM RecName: Full=GTP-binding protein engA;
    6::167     2e-05  32%  452 aa  ENGA_CYAA5 RecName: Full=GTP-binding protein engA;
    6::128     2e-05  33%  439 aa  ENGA_CLOBM RecName: Full=GTP-binding protein engA;
    6::128     2e-05  33%  439 aa  ENGA_CLOBK RecName: Full=GTP-binding protein engA;
    4::163     2e-05  29%  469 aa  ENGA_CHRVO RecName: Full=GTP-binding protein engA;
    3::161     2e-05  30%  483 aa  ENGA_BRUSU RecName: Full=GTP-binding protein engA;
    3::161     2e-05  30%  483 aa  ENGA_BRUME RecName: Full=GTP-binding protein engA;
    3::161     2e-05  30%  483 aa  ENGA_BRUMB RecName: Full=GTP-binding protein engA;
    3::161     2e-05  30%  483 aa  ENGA_BRUC2 RecName: Full=GTP-binding protein engA;
    3::161     2e-05  30%  483 aa  ENGA_BRUAB RecName: Full=GTP-binding protein engA;
    3::161     2e-05  30%  483 aa  ENGA_BRUA2 RecName: Full=GTP-binding protein engA;
    3::161     2e-05  30%  483 aa  ENGA_BRUA1 RecName: Full=GTP-binding protein engA;
    7::159     2e-05  27%  433 aa  ENGA_BORGA RecName: Full=GTP-binding protein engA;
  197::275     2e-05  38%  455 aa  MNME_VIBF1 RecName: Full=tRNA modification GTPase mnmE;       
  192::379     2e-05  36%  449 aa  MNME_RHOPB RecName: Full=tRNA modification GTPase mnmE;       
   93::341     2e-05  28%  457 aa  MNME_POLSQ RecName: Full=tRNA modification GTPase mnmE;       
  228::377     2e-05  33%  455 aa  MNME_FUSNN RecName: Full=tRNA modification GTPase mnmE;       
  141::345     2e-05  29%  464 aa  MNME_BURCM RecName: Full=tRNA modification GTPase mnmE;       
  215::320     2e-05  37%  435 aa  MNME_BARHE RecName: Full=tRNA modification GTPase mnmE;       
  220::277     2e-05  39%  435 aa  MNME_AZOC5 RecName: Full=tRNA modification GTPase mnmE;       
  222::347     2e-05  30%  455 aa  MNME_AMOA5 RecName: Full=tRNA modification GTPase mnmE;       
    7::130     2e-05  29%  298 aa  ERA_STRPZ RecName: Full=GTP-binding protein era homolog;
    7::130     2e-05  29%  298 aa  ERA_STRPM RecName: Full=GTP-binding protein era homolog;
    7::130     2e-05  29%  298 aa  ERA_STRPG RecName: Full=GTP-binding protein era homolog;
    7::130     2e-05  29%  298 aa  ERA_STRPF RecName: Full=GTP-binding protein era homolog;
    7::130     2e-05  29%  298 aa  ERA_STRPD RecName: Full=GTP-binding protein era homolog;
    7::130     2e-05  29%  298 aa  ERA_STRPC RecName: Full=GTP-binding protein era homolog;
    7::130     2e-05  29%  298 aa  ERA_STRPB RecName: Full=GTP-binding protein era homolog;
    7::130     2e-05  29%  203 aa  ERA_STRP9 RecName: Full=GTP-binding protein era homolog;Flags:
    7::130     2e-05  29%  298 aa  ERA_STRP8 RecName: Full=GTP-binding protein era homolog;
    7::130     2e-05  29%  298 aa  ERA_STRP6 RecName: Full=GTP-binding protein era homolog;
    7::130     2e-05  29%  298 aa  ERA_STRP3 RecName: Full=GTP-binding protein era homolog;
    7::130     2e-05  29%  298 aa  ERA_STRP1 RecName: Full=GTP-binding protein era homolog;
    7::130     2e-05  30%  298 aa  ERA_STRE4 RecName: Full=GTP-binding protein era homolog;
    8::131     2e-05  29%  299 aa  ERA_STRA5 RecName: Full=GTP-binding protein era homolog;
    8::131     2e-05  29%  299 aa  ERA_STRA3 RecName: Full=GTP-binding protein era homolog;
    8::131     2e-05  29%  299 aa  ERA_STRA1 RecName: Full=GTP-binding protein era homolog;
   21::180     2e-05  26%  310 aa  ERA_RHILO RecName: Full=GTP-binding protein era homolog;
   11::127     2e-05  27%  301 aa  ERA_ENTS8 RecName: Full=GTP-binding protein era homolog;
    7::146     2e-05  27%  296 aa  ERA_CLOBH RecName: Full=GTP-binding protein era homolog;
    7::138     2e-05  25%  295 aa  ERA_CLOBB RecName: Full=GTP-binding protein era homolog;
    7::146     2e-05  27%  296 aa  ERA_CLOB1 RecName: Full=GTP-binding protein era homolog;
    5::169     2e-05  28%  436 aa  ENGA_STRTD RecName: Full=GTP-binding protein engA;
    3::120     2e-05  29%  492 aa  ENGA_SILST RecName: Full=GTP-binding protein engA;
    6::162     2e-05  31%  456 aa  ENGA_PROM4 RecName: Full=GTP-binding protein engA;
    5::126     2e-05  32%  447 aa  ENGA_POLSJ RecName: Full=GTP-binding protein engA;
    5::90      2e-05  33%  445 aa  ENGA_MARMS RecName: Full=GTP-binding protein engA;
    5::122     2e-05  31%  434 aa  ENGA_GRAFK RecName: Full=GTP-binding protein engA;
    6::122     2e-05  38%  437 aa  ENGA_BACHD RecName: Full=GTP-binding protein engA;
  161::302     3e-05  31%  335 aa  OBG_CHLPN RecName: Full=GTPase obg;AltName: Full=GTP-binding
  195::382     3e-05  24%  457 aa  MNME_STRGC RecName: Full=tRNA modification GTPase mnmE;       
  231::359     3e-05  33%  469 aa  MNME_RHOFD RecName: Full=tRNA modification GTPase mnmE;       
  221::309     3e-05  39%  459 aa  MNME_LAWIP RecName: Full=tRNA modification GTPase mnmE;       
  229::386     3e-05  29%  461 aa  MNME_HELPY RecName: Full=tRNA modification GTPase mnmE;       
  214::344     3e-05  30%  439 aa  MNME_EHRRG RecName: Full=tRNA modification GTPase mnmE;       
  199::295     3e-05  29%  461 aa  MNME_CLOBM RecName: Full=tRNA modification GTPase mnmE;       
  199::295     3e-05  29%  461 aa  MNME_CLOBK RecName: Full=tRNA modification GTPase mnmE;       
  199::295     3e-05  29%  461 aa  MNME_CLOBH RecName: Full=tRNA modification GTPase mnmE;       
  199::295     3e-05  29%  461 aa  MNME_CLOB1 RecName: Full=tRNA modification GTPase mnmE;       
  177::345     3e-05  30%  467 aa  MNME_BURPS RecName: Full=tRNA modification GTPase mnmE;       
  177::345     3e-05  30%  467 aa  MNME_BURP6 RecName: Full=tRNA modification GTPase mnmE;       
  177::345     3e-05  30%  467 aa  MNME_BURP1 RecName: Full=tRNA modification GTPase mnmE;       
  177::345     3e-05  30%  467 aa  MNME_BURP0 RecName: Full=tRNA modification GTPase mnmE;       
  177::345     3e-05  30%  467 aa  MNME_BURMS RecName: Full=tRNA modification GTPase mnmE;       
  177::345     3e-05  30%  467 aa  MNME_BURMA RecName: Full=tRNA modification GTPase mnmE;       
  177::345     3e-05  30%  467 aa  MNME_BURM9 RecName: Full=tRNA modification GTPase mnmE;       
  177::345     3e-05  30%  467 aa  MNME_BURM7 RecName: Full=tRNA modification GTPase mnmE;       
  223::380     3e-05  25%  460 aa  MNME_AYWBP RecName: Full=tRNA modification GTPase mnmE;       
  183::279     3e-05  33%  448 aa  MNME_ACHLI RecName: Full=tRNA modification GTPase mnmE;       
  117::238     3e-05  31%  284 aa  GTPB8_HUMAN RecName: Full=GTP-binding protein 8;
   12::171     3e-05  27%  298 aa  ERA_XYLFT RecName: Full=GTP-binding protein era homolog;
   12::171     3e-05  27%  298 aa  ERA_XYLF2 RecName: Full=GTP-binding protein era homolog;
    7::130     3e-05  29%  298 aa  ERA_STREM RecName: Full=GTP-binding protein era homolog;
   10::170     3e-05  25%  295 aa  ERA_RICBR RecName: Full=GTP-binding protein era homolog;
   10::170     3e-05  25%  295 aa  ERA_RICB8 RecName: Full=GTP-binding protein era homolog;
   10::125     3e-05  25%  298 aa  ERA_RALSO RecName: Full=GTP-binding protein era homolog;
   17::138     3e-05  30%  305 aa  ERA_PSEAE RecName: Full=GTP-binding protein era homolog;
   17::138     3e-05  30%  305 aa  ERA_PSEAB RecName: Full=GTP-binding protein era homolog;
   17::138     3e-05  30%  305 aa  ERA_PSEA8 RecName: Full=GTP-binding protein era homolog;
    7::168     3e-05  27%  297 aa  ERA_CLOD6 RecName: Full=GTP-binding protein era homolog;
    7::146     3e-05  27%  296 aa  ERA_CLOBM RecName: Full=GTP-binding protein era homolog;
    7::146     3e-05  27%  296 aa  ERA_CLOBK RecName: Full=GTP-binding protein era homolog;
    7::146     3e-05  27%  296 aa  ERA_CLOBJ RecName: Full=GTP-binding protein era homolog;
    7::146     3e-05  27%  296 aa  ERA_CLOB6 RecName: Full=GTP-binding protein era homolog;
    4::159     3e-05  28%  464 aa  ENGA_TERTT RecName: Full=GTP-binding protein engA;
    6::122     3e-05  34%  436 aa  ENGA_STAS1 RecName: Full=GTP-binding protein engA;
    5::162     3e-05  27%  489 aa  ENGA_SHELP RecName: Full=GTP-binding protein engA;
    4::91      3e-05  38%  485 aa  ENGA_NEIMF RecName: Full=GTP-binding protein engA;
    4::91      3e-05  38%  485 aa  ENGA_NEIMB RecName: Full=GTP-binding protein engA;
    4::91      3e-05  38%  485 aa  ENGA_NEIMA RecName: Full=GTP-binding protein engA;
    5::164     3e-05  30%  459 aa  ENGA_MYXXD RecName: Full=GTP-binding protein engA;
    5::90      3e-05  31%  473 aa  ENGA_MARAV RecName: Full=GTP-binding protein engA;
    5::154     3e-05  30%  489 aa  ENGA_LEPIN RecName: Full=GTP-binding protein engA;
    5::122     3e-05  37%  435 aa  ENGA_LACC3 RecName: Full=GTP-binding protein engA;
    6::164     3e-05  30%  438 aa  ENGA_CLOTE RecName: Full=GTP-binding protein engA;
  173::269     3e-05  30%  438 aa  ENGA_CLOB8 RecName: Full=GTP-binding protein engA;
  216::279     4e-05  38%  443 aa  MNME_RHILO RecName: Full=tRNA modification GTPase mnmE;       
  233::349     4e-05  37%  468 aa  MNME_MAGSM RecName: Full=tRNA modification GTPase mnmE;       
  229::383     4e-05  25%  463 aa  MNME_LACPL RecName: Full=tRNA modification GTPase mnmE;       
  218::375     4e-05  29%  450 aa  MNME_HELPS RecName: Full=tRNA modification GTPase mnmE;       
   98::354     4e-05  29%  467 aa  MNME_BURTA RecName: Full=tRNA modification GTPase mnmE;       
   14::135     4e-05  32%  302 aa  ERA_PSEPK RecName: Full=GTP-binding protein era homolog;
   12::133     4e-05  32%  300 aa  ERA_PSEPG RecName: Full=GTP-binding protein era homolog;
   12::133     4e-05  32%  300 aa  ERA_PSEP1 RecName: Full=GTP-binding protein era homolog;
   12::134     4e-05  26%  301 aa  ERA_LACDB RecName: Full=GTP-binding protein era homolog;
   12::134     4e-05  26%  301 aa  ERA_LACDA RecName: Full=GTP-binding protein era homolog;
    3::119     4e-05  26%  437 aa  ENGA_THEM4 RecName: Full=GTP-binding protein engA;
    5::159     4e-05  30%  436 aa  ENGA_STRSV RecName: Full=GTP-binding protein engA;
    6::122     4e-05  34%  436 aa  ENGA_STAAT RecName: Full=GTP-binding protein engA;
    6::122     4e-05  34%  436 aa  ENGA_STAA3 RecName: Full=GTP-binding protein engA;
    5::92      4e-05  37%  458 aa  ENGA_PROM5 RecName: Full=GTP-binding protein engA;
  179::346     4e-05  33%  463 aa  ENGA_METCA RecName: Full=GTP-binding protein engA;
    3::123     4e-05  31%  470 aa  ENGA_MESSB RecName: Full=GTP-binding protein engA;
    3::62      4e-05  41%  464 aa  ENGA_MAGSA RecName: Full=GTP-binding protein engA;
    5::122     4e-05  37%  435 aa  ENGA_LACCB RecName: Full=GTP-binding protein engA;
    6::128     4e-05  32%  439 aa  ENGA_CLOBH RecName: Full=GTP-binding protein engA;
    6::164     4e-05  30%  439 aa  ENGA_CLOB6 RecName: Full=GTP-binding protein engA;
    6::128     4e-05  32%  439 aa  ENGA_CLOB1 RecName: Full=GTP-binding protein engA;
    3::173     4e-05  24%  460 aa  ENGA_CAMJD RecName: Full=GTP-binding protein engA;
    3::161     4e-05  29%  483 aa  ENGA_BRUSI RecName: Full=GTP-binding protein engA;
    5::128     4e-05  32%  433 aa  ENGA_AQUAE RecName: Full=GTP-binding protein engA;
  195::371     5e-05  25%  459 aa  MNME_STAAM RecName: Full=tRNA modification GTPase mnmE;       
  195::371     5e-05  25%  459 aa  MNME_STAA1 RecName: Full=tRNA modification GTPase mnmE;       
  167::305     5e-05  31%  448 aa  MNME_NEIMF RecName: Full=tRNA modification GTPase mnmE;       
  167::305     5e-05  31%  448 aa  MNME_NEIMB RecName: Full=tRNA modification GTPase mnmE;       
  167::305     5e-05  31%  448 aa  MNME_NEIMA RecName: Full=tRNA modification GTPase mnmE;       
  167::305     5e-05  31%  448 aa  MNME_NEIM0 RecName: Full=tRNA modification GTPase mnmE;       
  167::305     5e-05  31%  448 aa  MNME_NEIG2 RecName: Full=tRNA modification GTPase mnmE;       
  167::305     5e-05  31%  448 aa  MNME_NEIG1 RecName: Full=tRNA modification GTPase mnmE;       
  105::305     5e-05  30%  452 aa  MNME_MYCMS RecName: Full=tRNA modification GTPase mnmE;       
  105::305     5e-05  30%  452 aa  MNME_MYCCT RecName: Full=tRNA modification GTPase mnmE;       
  224::339     5e-05  31%  461 aa  MNME_LEPBP RecName: Full=tRNA modification GTPase mnmE;       
  224::339     5e-05  31%  461 aa  MNME_LEPBA RecName: Full=tRNA modification GTPase mnmE;       
  181::375     5e-05  27%  450 aa  MNME_HELAH RecName: Full=tRNA modification GTPase mnmE;       
  214::326     5e-05  31%  439 aa  MNME_EHRRW RecName: Full=tRNA modification GTPase mnmE;       
  229::352     5e-05  32%  468 aa  MNME_DESDG RecName: Full=tRNA modification GTPase mnmE;       
  219::350     5e-05  30%  444 aa  MNME_CAMC5 RecName: Full=tRNA modification GTPase mnmE;       
  141::345     5e-05  28%  464 aa  MNME_BURA4 RecName: Full=tRNA modification GTPase mnmE;       
    8::131     5e-05  29%  299 aa  ERA_STRZT RecName: Full=GTP-binding protein era homolog;
    8::131     5e-05  29%  299 aa  ERA_STRZP RecName: Full=GTP-binding protein era homolog;
    8::131     5e-05  29%  299 aa  ERA_STRZJ RecName: Full=GTP-binding protein era homolog;
    8::131     5e-05  29%  299 aa  ERA_STRR6 RecName: Full=GTP-binding protein era homolog;
    8::131     5e-05  29%  299 aa  ERA_STRPS RecName: Full=GTP-binding protein era homolog;
    8::131     5e-05  29%  299 aa  ERA_STRPN RecName: Full=GTP-binding protein era homolog;
    8::131     5e-05  29%  299 aa  ERA_STRPJ RecName: Full=GTP-binding protein era homolog;
    8::131     5e-05  29%  299 aa  ERA_STRPI RecName: Full=GTP-binding protein era homolog;
    8::131     5e-05  29%  299 aa  ERA_STRP7 RecName: Full=GTP-binding protein era homolog;
    8::131     5e-05  29%  299 aa  ERA_STRP2 RecName: Full=GTP-binding protein era homolog;
    9::132     5e-05  29%  299 aa  ERA_STAS1 RecName: Full=GTP-binding protein era homolog;
   11::132     5e-05  26%  301 aa  ERA_SHIFL RecName: Full=GTP-binding protein era homolog;
   11::132     5e-05  26%  301 aa  ERA_SHIF8 RecName: Full=GTP-binding protein era homolog;
   11::132     5e-05  26%  301 aa  ERA_SHIDS RecName: Full=GTP-binding protein era homolog;
   12::128     5e-05  30%  300 aa  ERA_PSEU2 RecName: Full=GTP-binding protein era homolog;
   12::133     5e-05  32%  300 aa  ERA_PSEPW RecName: Full=GTP-binding protein era homolog;
   12::128     5e-05  30%  300 aa  ERA_PSEF5 RecName: Full=GTP-binding protein era homolog;
   12::133     5e-05  32%  300 aa  ERA_PSEE4 RecName: Full=GTP-binding protein era homolog;
   12::128     5e-05  30%  300 aa  ERA_PSE14 RecName: Full=GTP-binding protein era homolog;
   11::132     5e-05  26%  301 aa  ERA_ECOLI RecName: Full=GTP-binding protein era;
   11::132     5e-05  26%  301 aa  ERA_ECOLC RecName: Full=GTP-binding protein era homolog;
   11::132     5e-05  26%  301 aa  ERA_ECOHS RecName: Full=GTP-binding protein era homolog;
   11::132     5e-05  26%  301 aa  ERA_ECODH RecName: Full=GTP-binding protein era homolog;
   11::132     5e-05  26%  301 aa  ERA_ECOBW RecName: Full=GTP-binding protein era homolog;
   11::132     5e-05  26%  301 aa  ERA_ECO5E RecName: Full=GTP-binding protein era homolog;
   11::132     5e-05  26%  301 aa  ERA_ECO57 RecName: Full=GTP-binding protein era;
   15::198     5e-05  31%  314 aa  ERA_CYAA5 RecName: Full=GTP-binding protein era homolog;
   11::144     5e-05  34%  295 aa  ERA_COXBU RecName: Full=GTP-binding protein era homolog;
   11::144     5e-05  34%  295 aa  ERA_COXBR RecName: Full=GTP-binding protein era homolog;
   18::141     5e-05  25%  308 aa  ERA_BRAJA RecName: Full=GTP-binding protein era homolog;
   13::136     5e-05  28%  304 aa  ERA_BACHD RecName: Full=GTP-binding protein era homolog;
    4::52      5e-05  39%  366 aa  ENGD_BACSU RecName: Full=GTP-dependent nucleic acid-binding protein
   34::197     5e-05  27%  200 aa  ENGB_BDEBA RecName: Full=Probable GTP-binding protein engB;
    4::119     5e-05  30%  494 aa  ENGA_SULDN RecName: Full=GTP-binding protein engA;
    5::160     5e-05  29%  436 aa  ENGA_STRT2 RecName: Full=GTP-binding protein engA;
    5::160     5e-05  29%  436 aa  ENGA_STRT1 RecName: Full=GTP-binding protein engA;
    3::62      5e-05  42%  492 aa  ENGA_ROSDO RecName: Full=GTP-binding protein engA;
    3::91      5e-05  38%  487 aa  ENGA_RHOSK RecName: Full=GTP-binding protein engA;
    3::91      5e-05  38%  487 aa  ENGA_RHOS5 RecName: Full=GTP-binding protein engA;
    3::91      5e-05  38%  487 aa  ENGA_RHOS4 RecName: Full=GTP-binding protein engA;
    3::91      5e-05  38%  487 aa  ENGA_RHOS1 RecName: Full=GTP-binding protein engA;
  157::348     5e-05  32%  454 aa  ENGA_RHOBA RecName: Full=GTP-binding protein engA;
    3::122     5e-05  32%  479 aa  ENGA_RHILO RecName: Full=GTP-binding protein engA;
    5::161     5e-05  27%  436 aa  ENGA_PELLD RecName: Full=GTP-binding protein engA;
    4::91      5e-05  38%  485 aa  ENGA_NEIG2 RecName: Full=GTP-binding protein engA;
    4::91      5e-05  38%  485 aa  ENGA_NEIG1 RecName: Full=GTP-binding protein engA;
    5::154     5e-05  30%  489 aa  ENGA_LEPIC RecName: Full=GTP-binding protein engA;
    3::62      5e-05  42%  479 aa  ENGA_JANSC RecName: Full=GTP-binding protein engA;
    3::120     5e-05  32%  475 aa  ENGA_AGRRK RecName: Full=GTP-binding protein engA;
  168::199     7e-05  53%  347 aa  OBG_THISH RecName: Full=GTPase obg;AltName: Full=GTP-binding
  166::217     7e-05  37%  338 aa  OBG_BUCCC RecName: Full=GTPase obg;AltName: Full=GTP-binding
  193::381     7e-05  24%  456 aa  MNME_STRTD RecName: Full=tRNA modification GTPase mnmE;       
  193::381     7e-05  24%  456 aa  MNME_STRT2 RecName: Full=tRNA modification GTPase mnmE;       
  193::381     7e-05  24%  456 aa  MNME_STRT1 RecName: Full=tRNA modification GTPase mnmE;       
  223::340     7e-05  29%  456 aa  MNME_PELCD RecName: Full=tRNA modification GTPase mnmE;       
  221::370     7e-05  30%  442 aa  MNME_MYCH7 RecName: Full=tRNA modification GTPase mnmE;       
  223::338     7e-05  34%  456 aa  MNME_LEPBL RecName: Full=tRNA modification GTPase mnmE;       
  223::338     7e-05  34%  456 aa  MNME_LEPBJ RecName: Full=tRNA modification GTPase mnmE;       
  186::343     7e-05  27%  452 aa  MNME_FINM2 RecName: Full=tRNA modification GTPase mnmE;       
  221::348     7e-05  31%  460 aa  MNME_EXIS2 RecName: Full=tRNA modification GTPase mnmE;       
  223::341     7e-05  28%  459 aa  MNME_DESHY RecName: Full=tRNA modification GTPase mnmE;       
  225::293     7e-05  37%  459 aa  MNME_CLOTH RecName: Full=tRNA modification GTPase mnmE;       
  199::295     7e-05  29%  461 aa  MNME_CLOBL RecName: Full=tRNA modification GTPase mnmE;       
  230::299     7e-05  38%  462 aa  MNME_CLOB8 RecName: Full=tRNA modification GTPase mnmE;       
  170::340     7e-05  30%  450 aa  MNME_BORA1 RecName: Full=tRNA modification GTPase mnmE;       
   12::128     7e-05  28%  298 aa  ERA_XYLFM RecName: Full=GTP-binding protein era homolog;
   12::128     7e-05  28%  298 aa  ERA_XYLFA RecName: Full=GTP-binding protein era homolog;
   11::131     7e-05  29%  296 aa  ERA_NITEU RecName: Full=GTP-binding protein era homolog;
   11::144     7e-05  34%  295 aa  ERA_COXBN RecName: Full=GTP-binding protein era homolog;
   11::144     7e-05  30%  295 aa  ERA_COXB2 RecName: Full=GTP-binding protein era homolog;
   11::144     7e-05  34%  295 aa  ERA_COXB1 RecName: Full=GTP-binding protein era homolog;
    7::170     7e-05  28%  295 aa  ERA_CLOTE RecName: Full=GTP-binding protein era homolog;
  110::187     7e-05  30%  437 aa  ERAL_MOUSE RecName: Full=GTP-binding protein era homolog;AltName:
   22::157     7e-05  27%  197 aa  ENGB_EXISA RecName: Full=Probable GTP-binding protein engB;
    3::88      7e-05  35%  442 aa  ENGA_UREPA RecName: Full=GTP-binding protein engA;
    3::88      7e-05  35%  442 aa  ENGA_UREP2 RecName: Full=GTP-binding protein engA;
    3::90      7e-05  26%  439 aa  ENGA_THEAB RecName: Full=GTP-binding protein engA;
    6::162     7e-05  31%  452 aa  ENGA_SYNR3 RecName: Full=GTP-binding protein engA;
    5::90      7e-05  32%  487 aa  ENGA_PSEHT RecName: Full=GTP-binding protein engA;
    5::184     7e-05  27%  436 aa  ENGA_PROA2 RecName: Full=GTP-binding protein engA;
    5::122     7e-05  31%  461 aa  ENGA_NOVAD RecName: Full=GTP-binding protein engA;
    5::163     7e-05  30%  435 aa  ENGA_CYTH3 RecName: Full=GTP-binding protein engA;
  173::304     7e-05  28%  438 aa  ENGA_CLONN RecName: Full=GTP-binding protein engA;
  127::238     7e-05  35%  437 aa  ENGA_CHLTE RecName: Full=GTP-binding protein engA;
    4::127     7e-05  30%  462 aa  ENGA_CAMC1 RecName: Full=GTP-binding protein engA;
  161::297     9e-05  31%  335 aa  OBG_CHLAB RecName: Full=GTPase obg;AltName: Full=GTP-binding
  195::382     9e-05  24%  457 aa  MNME_STRSV RecName: Full=tRNA modification GTPase mnmE;       
  220::331     9e-05  32%  440 aa  MNME_SINMW RecName: Full=tRNA modification GTPase mnmE;       
  219::286     9e-05  43%  439 aa  MNME_RHIE6 RecName: Full=tRNA modification GTPase mnmE;       
  221::370     9e-05  30%  442 aa  MNME_MYCHJ RecName: Full=tRNA modification GTPase mnmE;       
  221::370     9e-05  30%  442 aa  MNME_MYCH2 RecName: Full=tRNA modification GTPase mnmE;       
  198::364     9e-05  26%  464 aa  MNME_LACS1 RecName: Full=tRNA modification GTPase mnmE;       
  223::309     9e-05  34%  457 aa  MNME_GEOMG RecName: Full=tRNA modification GTPase mnmE;       
  224::380     9e-05  25%  462 aa  MNME_FLAPJ RecName: Full=tRNA modification GTPase mnmE;       
  214::333     9e-05  29%  439 aa  MNME_EHRCR RecName: Full=tRNA modification GTPase mnmE;       
  225::380     9e-05  28%  459 aa  MNME_CLOD6 RecName: Full=tRNA modification GTPase mnmE;       
  141::345     9e-05  28%  464 aa  MNME_BURCH RecName: Full=tRNA modification GTPase mnmE;       
  141::345     9e-05  28%  464 aa  MNME_BURCA RecName: Full=tRNA modification GTPase mnmE;       
  200::292     9e-05  35%  451 aa  MNME_BEII9 RecName: Full=tRNA modification GTPase mnmE;       
   35::158     9e-05  31%  725 aa  FEOB2_PORGI RecName: Full=Ferrous iron transport protein B homolog;
    7::130     9e-05  28%  298 aa  ERA_STRS7 RecName: Full=GTP-binding protein era homolog;
    8::124     9e-05  28%  299 aa  ERA_STRMU RecName: Full=GTP-binding protein era homolog;
    9::132     9e-05  28%  299 aa  ERA_STAES RecName: Full=GTP-binding protein era homolog;
    9::132     9e-05  28%  299 aa  ERA_STAEQ RecName: Full=GTP-binding protein era homolog;
   11::132     9e-05  26%  301 aa  ERA_SALTY RecName: Full=GTP-binding protein era;
   11::132     9e-05  26%  301 aa  ERA_SALTI RecName: Full=GTP-binding protein era homolog;
   11::132     9e-05  26%  301 aa  ERA_SALSV RecName: Full=GTP-binding protein era homolog;
   11::132     9e-05  26%  301 aa  ERA_SALPK RecName: Full=GTP-binding protein era homolog;
   11::132     9e-05  26%  301 aa  ERA_SALPC RecName: Full=GTP-binding protein era homolog;
   11::132     9e-05  26%  301 aa  ERA_SALPB RecName: Full=GTP-binding protein era homolog;
   11::132     9e-05  26%  301 aa  ERA_SALPA RecName: Full=GTP-binding protein era homolog;
   11::132     9e-05  26%  301 aa  ERA_SALNS RecName: Full=GTP-binding protein era homolog;
   11::132     9e-05  26%  301 aa  ERA_SALHS RecName: Full=GTP-binding protein era homolog;
   11::132     9e-05  26%  301 aa  ERA_SALG2 RecName: Full=GTP-binding protein era homolog;
   11::132     9e-05  26%  301 aa  ERA_SALEP RecName: Full=GTP-binding protein era homolog;
   11::132     9e-05  26%  301 aa  ERA_SALDC RecName: Full=GTP-binding protein era homolog;
   11::132     9e-05  26%  301 aa  ERA_SALCH RecName: Full=GTP-binding protein era homolog;
   11::132     9e-05  26%  301 aa  ERA_SALAR RecName: Full=GTP-binding protein era homolog;
   11::132     9e-05  26%  301 aa  ERA_SALA4 RecName: Full=GTP-binding protein era homolog;
   54::214     9e-05  27%  339 aa  ERA_RICCN RecName: Full=GTP-binding protein era homolog;
   12::128     9e-05  30%  300 aa  ERA_PSESM RecName: Full=GTP-binding protein era homolog;
   10::135     9e-05  27%  301 aa  ERA_LISIN RecName: Full=GTP-binding protein era homolog;
   11::126     9e-05  30%  301 aa  ERA_LACAC RecName: Full=GTP-binding protein era homolog;
   13::172     9e-05  28%  303 aa  ERA_BACSK RecName: Full=GTP-binding protein era homolog;
   15::137     9e-05  28%  304 aa  ERA_ACTP7 RecName: Full=GTP-binding protein era homolog;
   15::137     9e-05  28%  304 aa  ERA_ACTP2 RecName: Full=GTP-binding protein era homolog;
    3::120     9e-05  28%  458 aa  ENGA_XANP2 RecName: Full=GTP-binding protein engA;
    5::120     9e-05  32%  498 aa  ENGA_VIBHB RecName: Full=GTP-binding protein engA;
    6::162     9e-05  30%  455 aa  ENGA_SYNPX RecName: Full=GTP-binding protein engA;
    3::127     9e-05  32%  476 aa  ENGA_RHIME RecName: Full=GTP-binding protein engA;
    3::120     9e-05  35%  473 aa  ENGA_RHIL3 RecName: Full=GTP-binding protein engA;
  209::376     9e-05  28%  493 aa  ENGA_PHOLL RecName: Full=GTP-binding protein engA;
    5::90      9e-05  31%  510 aa  ENGA_HAEDU RecName: Full=GTP-binding protein engA;
    6::131     9e-05  32%  441 aa  ENGA_DESHD RecName: Full=GTP-binding protein engA;
  178::343     9e-05  31%  438 aa  ENGA_DESAP RecName: Full=GTP-binding protein engA;
    6::166     9e-05  28%  453 aa  ENGA_CYAP4 RecName: Full=GTP-binding protein engA;
  173::304     9e-05  28%  438 aa  ENGA_CLOPS RecName: Full=GTP-binding protein engA;
  173::304     9e-05  28%  438 aa  ENGA_CLOPE RecName: Full=GTP-binding protein engA;
  173::304     9e-05  28%  438 aa  ENGA_CLOP1 RecName: Full=GTP-binding protein engA;
    3::91      9e-05  39%  460 aa  ENGA_BRAJA RecName: Full=GTP-binding protein engA;
    6::129     9e-05  30%  440 aa  ENGA_ALKOO RecName: Full=GTP-binding protein engA;
   65::164     1e-04  26%  366 aa  YKK3_CAEEL RecName: Full=Uncharacterized GTP-binding protein
  133::382     1e-04  28%  457 aa  MNME_STRSY RecName: Full=tRNA modification GTPase mnmE;       
  133::382     1e-04  28%  457 aa  MNME_STRS2 RecName: Full=tRNA modification GTPase mnmE;       
  196::365     1e-04  22%  458 aa  MNME_STRA5 RecName: Full=tRNA modification GTPase mnmE;       
  196::365     1e-04  22%  458 aa  MNME_STRA3 RecName: Full=tRNA modification GTPase mnmE;       
  196::365     1e-04  22%  458 aa  MNME_STRA1 RecName: Full=tRNA modification GTPase mnmE;       
  192::314     1e-04  33%  428 aa  MNME_RHOS4 RecName: Full=tRNA modification GTPase mnmE;       
  222::336     1e-04  33%  442 aa  MNME_MESSB RecName: Full=tRNA modification GTPase mnmE;       
  222::281     1e-04  32%  459 aa  MNME_CLOK5 RecName: Full=tRNA modification GTPase mnmE;       
  141::345     1e-04  28%  464 aa  MNME_BURS3 RecName: Full=tRNA modification GTPase mnmE;       
  221::308     1e-04  33%  470 aa  MNME_BLOPB RecName: Full=tRNA modification GTPase mnmE;       
  222::310     1e-04  32%  474 aa  MNME_BLOFL RecName: Full=tRNA modification GTPase mnmE;       
    9::132     1e-04  27%  299 aa  ERA_STACT RecName: Full=GTP-binding protein era homolog;
   11::132     1e-04  26%  301 aa  ERA_SHISS RecName: Full=GTP-binding protein era homolog;
   11::132     1e-04  26%  301 aa  ERA_SHIBS RecName: Full=GTP-binding protein era homolog;
   11::132     1e-04  26%  301 aa  ERA_SHIB3 RecName: Full=GTP-binding protein era homolog;
   11::132     1e-04  26%  301 aa  ERA_ESCF3 RecName: Full=GTP-binding protein era homolog;
   11::132     1e-04  26%  301 aa  ERA_ECOUT RecName: Full=GTP-binding protein era homolog;
   11::132     1e-04  26%  301 aa  ERA_ECOSM RecName: Full=GTP-binding protein era homolog;
   11::132     1e-04  26%  301 aa  ERA_ECOSE RecName: Full=GTP-binding protein era homolog;
   11::132     1e-04  26%  301 aa  ERA_ECOLU RecName: Full=GTP-binding protein era homolog;
   11::132     1e-04  26%  301 aa  ERA_ECOL6 RecName: Full=GTP-binding protein era homolog;
   11::132     1e-04  26%  301 aa  ERA_ECOL5 RecName: Full=GTP-binding protein era homolog;
   11::132     1e-04  26%  301 aa  ERA_ECOK1 RecName: Full=GTP-binding protein era homolog;
   11::132     1e-04  26%  301 aa  ERA_ECO8A RecName: Full=GTP-binding protein era homolog;
   11::132     1e-04  26%  301 aa  ERA_ECO81 RecName: Full=GTP-binding protein era homolog;
   11::132     1e-04  26%  301 aa  ERA_ECO7I RecName: Full=GTP-binding protein era homolog;
   11::132     1e-04  26%  301 aa  ERA_ECO55 RecName: Full=GTP-binding protein era homolog;
   11::132     1e-04  26%  301 aa  ERA_ECO45 RecName: Full=GTP-binding protein era homolog;
   11::132     1e-04  26%  301 aa  ERA_ECO27 RecName: Full=GTP-binding protein era homolog;
   11::132     1e-04  26%  301 aa  ERA_ECO24 RecName: Full=GTP-binding protein era homolog;
   11::132     1e-04  26%  301 aa  ERA_CITK8 RecName: Full=GTP-binding protein era homolog;
   15::137     1e-04  28%  304 aa  ERA_ACTPJ RecName: Full=GTP-binding protein era homolog;
    3::88      1e-04  35%  442 aa  ENGA_UREU1 RecName: Full=GTP-binding protein engA;
    5::90      1e-04  34%  436 aa  ENGA_STRA3 RecName: Full=GTP-binding protein engA;
    5::90      1e-04  31%  488 aa  ENGA_SODGM RecName: Full=GTP-binding protein engA;
    3::120     1e-04  37%  473 aa  ENGA_RHILW RecName: Full=GTP-binding protein engA;
    3::120     1e-04  37%  473 aa  ENGA_RHIEC RecName: Full=GTP-binding protein engA;
    3::120     1e-04  37%  473 aa  ENGA_RHIE6 RecName: Full=GTP-binding protein engA;
    3::89      1e-04  33%  458 aa  ENGA_MYCGA RecName: Full=GTP-binding protein engA;
  172::304     1e-04  27%  441 aa  ENGA_DESHY RecName: Full=GTP-binding protein engA;
    5::176     1e-04  33%  445 aa  ENGA_BURPS RecName: Full=GTP-binding protein engA;
    5::176     1e-04  33%  445 aa  ENGA_BURP6 RecName: Full=GTP-binding protein engA;
    5::176     1e-04  33%  445 aa  ENGA_BURP0 RecName: Full=GTP-binding protein engA;
    5::176     1e-04  33%  445 aa  ENGA_BURM9 RecName: Full=GTP-binding protein engA;
    5::176     1e-04  33%  445 aa  ENGA_BURM7 RecName: Full=GTP-binding protein engA;
  215::286     2e-04  35%  447 aa  MNME_RUTMC RecName: Full=tRNA modification GTPase mnmE;       
  221::358     2e-04  31%  441 aa  MNME_RHOPA RecName: Full=tRNA modification GTPase mnmE;       
  221::332     2e-04  35%  453 aa  MNME_RHOP5 RecName: Full=tRNA modification GTPase mnmE;       
  230::384     2e-04  24%  464 aa  MNME_PEDPA RecName: Full=tRNA modification GTPase mnmE;       
  141::345     2e-04  28%  464 aa  MNME_BURCC RecName: Full=tRNA modification GTPase mnmE;       
  312::393     2e-04  37%  606 aa  LSG1_DROME RecName: Full=Large subunit GTPase 1 homolog;       
  101::239     2e-04  36%  285 aa  GTPB8_RAT RecName: Full=GTP-binding protein 8;
  101::239     2e-04  36%  285 aa  GTPB8_MOUSE RecName: Full=GTP-binding protein 8;
   10::170     2e-04  25%  295 aa  ERA_RICCK RecName: Full=GTP-binding protein era homolog;
   12::165     2e-04  27%  300 aa  ERA_OCEIH RecName: Full=GTP-binding protein era homolog;
   10::135     2e-04  27%  301 aa  ERA_LISW6 RecName: Full=GTP-binding protein era homolog;
   17::140     2e-04  23%  307 aa  ERA_BRASO RecName: Full=GTP-binding protein era homolog;
   12::128     2e-04  32%  300 aa  ERA_AZOVD RecName: Full=GTP-binding protein era homolog;
    5::91      2e-04  36%  447 aa  ENGA_VARPS RecName: Full=GTP-binding protein engA;
    6::92      2e-04  33%  459 aa  ENGA_SYNJA RecName: Full=GTP-binding protein engA;
    5::162     2e-04  29%  465 aa  ENGA_STRMK RecName: Full=GTP-binding protein engA;
    5::162     2e-04  27%  490 aa  ENGA_SHEPW RecName: Full=GTP-binding protein engA;
    5::162     2e-04  27%  490 aa  ENGA_SHEPA RecName: Full=GTP-binding protein engA;
    5::162     2e-04  27%  490 aa  ENGA_SHEHH RecName: Full=GTP-binding protein engA;
    5::99      2e-04  38%  447 aa  ENGA_HERAR RecName: Full=GTP-binding protein engA;
    3::60      2e-04  42%  490 aa  ENGA_DINSH RecName: Full=GTP-binding protein engA;
    5::90      2e-04  31%  498 aa  ENGA_COLP3 RecName: Full=GTP-binding protein engA;
    5::160     2e-04  29%  447 aa  ENGA_ACIAC RecName: Full=GTP-binding protein engA;
  192::347     2e-04  25%  456 aa  MNME_WOLSU RecName: Full=tRNA modification GTPase mnmE;       
  161::337     2e-04  31%  457 aa  MNME_NITHX RecName: Full=tRNA modification GTPase mnmE;       
  224::384     2e-04  26%  466 aa  MNME_FLAJ1 RecName: Full=tRNA modification GTPase mnmE;       
  227::283     2e-04  34%  459 aa  MNME_CLONN RecName: Full=tRNA modification GTPase mnmE;       
  196::379     2e-04  30%  464 aa  MNME_BORDL RecName: Full=tRNA modification GTPase mnmE;       
  176::331     2e-04  34%  436 aa  MNME_BARQU RecName: Full=tRNA modification GTPase mnmE;       
  142::285     2e-04  28%  462 aa  MNME_ACIAD RecName: Full=tRNA modification GTPase mnmE;       
    5::130     2e-04  26%  772 aa  FEOB_SALTY RecName: Full=Ferrous iron transport protein B;
    5::130     2e-04  26%  772 aa  FEOB_SALTI RecName: Full=Ferrous iron transport protein B;
    5::130     2e-04  26%  772 aa  FEOB_SALPA RecName: Full=Ferrous iron transport protein B;
    5::130     2e-04  26%  772 aa  FEOB_SALCH RecName: Full=Ferrous iron transport protein B;
   11::168     2e-04  25%  293 aa  ERA_RICFE RecName: Full=GTP-binding protein era homolog;
   10::135     2e-04  27%  301 aa  ERA_LISMO RecName: Full=GTP-binding protein era homolog;
   10::135     2e-04  27%  301 aa  ERA_LISMH RecName: Full=GTP-binding protein era homolog;
   10::135     2e-04  27%  301 aa  ERA_LISMF RecName: Full=GTP-binding protein era homolog;
   10::135     2e-04  27%  301 aa  ERA_LISMC RecName: Full=GTP-binding protein era homolog;
   11::126     2e-04  28%  301 aa  ERA_LACH4 RecName: Full=GTP-binding protein era homolog;
    7::157     2e-04  25%  294 aa  ERA_CLONN RecName: Full=GTP-binding protein era homolog;
    7::130     2e-04  29%  296 aa  ERA_CLOAB RecName: Full=GTP-binding protein era homolog;
   21::185     2e-04  28%  196 aa  ENGB_PETMO RecName: Full=Probable GTP-binding protein engB;
    5::120     2e-04  32%  498 aa  ENGA_VIBPA RecName: Full=GTP-binding protein engA;
    6::164     2e-04  28%  439 aa  ENGA_THETN RecName: Full=GTP-binding protein engA;
    5::160     2e-04  27%  447 aa  ENGA_RHOFD RecName: Full=GTP-binding protein engA;
   32::203     2e-04  27%  469 aa  ENGA_MYCMM RecName: Full=GTP-binding protein engA;
    1::126     2e-04  35%  474 aa  ENGA_CHLAB RecName: Full=GTP-binding protein engA;
    3::125     2e-04  26%  460 aa  ENGA_CAMJR RecName: Full=GTP-binding protein engA;
    3::125     2e-04  26%  460 aa  ENGA_CAMJE RecName: Full=GTP-binding protein engA;
    5::92      2e-04  40%  446 aa  ENGA_BURP8 RecName: Full=GTP-binding protein engA;
    3::120     2e-04  33%  476 aa  ENGA_AGRT5 RecName: Full=GTP-binding protein engA;
    6::50      3e-04  33%  367 aa  Y024_MYCGE RecName: Full=Probable GTP-binding protein MG024;
  458::515     3e-04  39% 1089 aa  TC120_ARATH RecName: Full=Translocase of chloroplast 120,
  221::341     3e-04  33%  451 aa  MNME_XYLFA RecName: Full=tRNA modification GTPase mnmE;       
  189::271     3e-04  30%  428 aa  MNME_SILST RecName: Full=tRNA modification GTPase mnmE;       
  127::344     3e-04  28%  456 aa  MNME_PELPD RecName: Full=tRNA modification GTPase mnmE;       
  222::352     3e-04  26%  467 aa  MNME_HELHP RecName: Full=tRNA modification GTPase mnmE;       
  196::341     3e-04  32%  464 aa  MNME_BORRA RecName: Full=tRNA modification GTPase mnmE;       
  113::225     3e-04  32%  286 aa  GTPB8_DANRE RecName: Full=GTP-binding protein 8;
    5::130     3e-04  26%  773 aa  FEOB_SHIFL RecName: Full=Ferrous iron transport protein B;
    5::130     3e-04  26%  773 aa  FEOB_ECO57 RecName: Full=Ferrous iron transport protein B;
  129::243     3e-04  29%  844 aa  FEOB1_PORGI RecName: Full=Ferrous iron transport protein B;
   12::133     3e-04  29%  303 aa  ERA_YERPY RecName: Full=GTP-binding protein era homolog;
   12::133     3e-04  29%  303 aa  ERA_YERPS RecName: Full=GTP-binding protein era homolog;
   12::133     3e-04  29%  303 aa  ERA_YERPP RecName: Full=GTP-binding protein era homolog;
   12::133     3e-04  29%  303 aa  ERA_YERPN RecName: Full=GTP-binding protein era homolog;
   12::133     3e-04  29%  303 aa  ERA_YERPG RecName: Full=GTP-binding protein era homolog;
   12::133     3e-04  29%  303 aa  ERA_YERPE RecName: Full=GTP-binding protein era homolog;
   12::133     3e-04  29%  303 aa  ERA_YERPB RecName: Full=GTP-binding protein era homolog;
   12::133     3e-04  29%  303 aa  ERA_YERPA RecName: Full=GTP-binding protein era homolog;
   12::133     3e-04  29%  303 aa  ERA_YERP3 RecName: Full=GTP-binding protein era homolog;
    8::131     3e-04  28%  299 aa  ERA_STRP4 RecName: Full=GTP-binding protein era homolog;
   11::132     3e-04  24%  301 aa  ERA_KLEP7 RecName: Full=GTP-binding protein era homolog;
    4::91      3e-04  36%  487 aa  ENGA_SILPO RecName: Full=GTP-binding protein engA;
    3::120     3e-04  35%  476 aa  ENGA_RHISN RecName: Full=GTP-binding protein engA;
    7::131     3e-04  33%  487 aa  ENGA_PARUW RecName: Full=GTP-binding protein engA;
    3::120     3e-04  30%  455 aa  ENGA_NITWN RecName: Full=GTP-binding protein engA;
    5::99      3e-04  38%  447 aa  ENGA_JANMA RecName: Full=GTP-binding protein engA;
    6::129     3e-04  32%  438 aa  ENGA_CLOBB RecName: Full=GTP-binding protein engA;
    6::129     3e-04  32%  438 aa  ENGA_CLOBA RecName: Full=GTP-binding protein engA;
    6::164     3e-04  28%  438 aa  ENGA_CLOAB RecName: Full=GTP-binding protein engA;
    3::125     3e-04  26%  460 aa  ENGA_CAMJJ RecName: Full=GTP-binding protein engA;
    3::125     3e-04  26%  460 aa  ENGA_CAMJ8 RecName: Full=GTP-binding protein engA;
    5::164     3e-04  33%  445 aa  ENGA_BURPP RecName: Full=GTP-binding protein engA;
    3::120     3e-04  30%  474 aa  ENGA_AGRVS RecName: Full=GTP-binding protein engA;
    6::165     3e-04  26%  453 aa  ENGA_ACAM1 RecName: Full=GTP-binding protein engA;
  215::304     3e-04  29%  447 aa  MNME_VESOH RecName: Full=tRNA modification GTPase mnmE;       
  188::274     3e-04  31%  444 aa  MNME_SOLUE RecName: Full=tRNA modification GTPase mnmE;       
  187::333     3e-04  25%  452 aa  MNME_PETMO RecName: Full=tRNA modification GTPase mnmE;       
  161::276     3e-04  33%  456 aa  MNME_NITWN RecName: Full=tRNA modification GTPase mnmE;       
  198::336     3e-04  28%  448 aa  MNME_MYCGA RecName: Full=tRNA modification GTPase mnmE;       
  183::337     3e-04  29%  471 aa  MNME_METPP RecName: Full=tRNA modification GTPase mnmE;       
  233::288     3e-04  42%  479 aa  MNME_LEPCP RecName: Full=tRNA modification GTPase mnmE;       
  229::354     3e-04  30%  462 aa  MNME_LACSS RecName: Full=tRNA modification GTPase mnmE;       
  226::348     3e-04  30%  465 aa  MNME_ENTFA RecName: Full=tRNA modification GTPase mnmE;       
  226::342     3e-04  29%  458 aa  MNME_CLOPE RecName: Full=tRNA modification GTPase mnmE;       
  226::342     3e-04  29%  458 aa  MNME_CLOP1 RecName: Full=tRNA modification GTPase mnmE;       
   11::67      3e-04  38%  298 aa  ERA_XANCP RecName: Full=GTP-binding protein era homolog;
   11::67      3e-04  38%  298 aa  ERA_XANCB RecName: Full=GTP-binding protein era homolog;
   11::67      3e-04  38%  298 aa  ERA_XANC8 RecName: Full=GTP-binding protein era homolog;
   20::151     3e-04  29%  309 aa  ERA_DEIGD RecName: Full=GTP-binding protein era homolog;
    8::163     3e-04  26%  298 aa  ERA_CARHZ RecName: Full=GTP-binding protein era homolog;
   38::120     3e-04  35%  214 aa  ENGB_RICTY RecName: Full=Probable GTP-binding protein engB;
  164::322     3e-04  29%  448 aa  ENGA_THEYD RecName: Full=GTP-binding protein engA;
    5::90      3e-04  29%  488 aa  ENGA_SHEAM RecName: Full=GTP-binding protein engA;
  174::254     3e-04  34%  440 aa  ENGA_PELTS RecName: Full=GTP-binding protein engA;
   32::203     3e-04  27%  469 aa  ENGA_MYCUA RecName: Full=GTP-binding protein engA;
    5::123     3e-04  33%  496 aa  ENGA_HAMD5 RecName: Full=GTP-binding protein engA;
  165::349     3e-04  32%  447 aa  ENGA_DIAST RecName: Full=GTP-binding protein engA;
    4::125     3e-04  28%  460 aa  ENGA_CAMHC RecName: Full=GTP-binding protein engA;
    4::156     3e-04  29%  461 aa  ENGA_CAMC5 RecName: Full=GTP-binding protein engA;
    5::91      3e-04  38%  445 aa  ENGA_BURM1 RecName: Full=GTP-binding protein engA;
    3::120     3e-04  28%  453 aa  ENGA_AZOC5 RecName: Full=GTP-binding protein engA;
  165::349     3e-04  32%  447 aa  ENGA_ACISJ RecName: Full=GTP-binding protein engA;
   75::166     3e-04  43%  695 aa  EFG_THENN RecName: Full=Elongation factor G;         Short=EF-G;
    6::50      4e-04  33%  362 aa  Y026_MYCPN RecName: Full=Probable GTP-binding protein MG024
  175::271     4e-04  36%  471 aa  SRCA_CHICK RecName: Full=Sarcalumenin;Flags: Precursor;
  221::341     4e-04  33%  451 aa  MNME_XYLFT RecName: Full=tRNA modification GTPase mnmE;       
  101::341     4e-04  28%  451 aa  MNME_SYNS9 RecName: Full=tRNA modification GTPase mnmE;       
  192::314     4e-04  32%  428 aa  MNME_RHOS1 RecName: Full=tRNA modification GTPase mnmE;       
  197::343     4e-04  27%  460 aa  MNME_CYTH3 RecName: Full=tRNA modification GTPase mnmE;       
    6::128     4e-04  32%  296 aa  ERA_THELT RecName: Full=GTP-binding protein era homolog;
    6::131     4e-04  32%  290 aa  ERA_MYCAP RecName: Full=GTP-binding protein era homolog;
   11::127     4e-04  24%  301 aa  ERA_KLEP3 RecName: Full=GTP-binding protein era homolog;
   15::137     4e-04  26%  304 aa  ERA_HAEDU RecName: Full=GTP-binding protein era homolog;
   11::173     4e-04  28%  308 aa  ERA_DESVV RecName: Full=GTP-binding protein era homolog;
   11::173     4e-04  28%  308 aa  ERA_DESVH RecName: Full=GTP-binding protein era homolog;
   15::82      4e-04  30%  316 aa  ERA_CAUCR RecName: Full=GTP-binding protein era homolog;
   15::82      4e-04  30%  316 aa  ERA_CAUCN RecName: Full=GTP-binding protein era homolog;
   31::120     4e-04  34%  214 aa  ENGB_RICPR RecName: Full=Probable GTP-binding protein engB;
   26::190     4e-04  31%  193 aa  ENGB_CHLT3 RecName: Full=Probable GTP-binding protein engB;
    5::159     4e-04  30%  465 aa  ENGA_XANC5 RecName: Full=GTP-binding protein engA;
    5::159     4e-04  30%  465 aa  ENGA_XANAC RecName: Full=GTP-binding protein engA;
    5::90      4e-04  31%  464 aa  ENGA_THISH RecName: Full=GTP-binding protein engA;
  181::269     4e-04  34%  446 aa  ENGA_SYNFM RecName: Full=GTP-binding protein engA;
    5::90      4e-04  32%  489 aa  ENGA_PSYIN RecName: Full=GTP-binding protein engA;
    5::91      4e-04  35%  445 aa  ENGA_POLNA RecName: Full=GTP-binding protein engA;
    5::90      4e-04  32%  464 aa  ENGA_NITOC RecName: Full=GTP-binding protein engA;
  173::303     4e-04  25%  438 aa  ENGA_CLOK5 RecName: Full=GTP-binding protein engA;
  173::303     4e-04  25%  438 aa  ENGA_CLOK1 RecName: Full=GTP-binding protein engA;
  180::238     4e-04  38%  437 aa  ENGA_CHLL2 RecName: Full=GTP-binding protein engA;
    4::91      4e-04  38%  474 aa  ENGA_BART1 RecName: Full=GTP-binding protein engA;
   72::163     4e-04  42%  692 aa  EFG_THEMA RecName: Full=Elongation factor G;         Short=EF-G;
   68::156     6e-04  32%  360 aa  RF1_NITOC RecName: Full=Peptide chain release factor 1;       
  161::248     6e-04  32%  335 aa  OBG_CHLFF RecName: Full=GTPase obg;AltName: Full=GTP-binding
  220::275     6e-04  43%  442 aa  MNME_WOLWR RecName: Full=tRNA modification GTPase mnmE;       
  220::275     6e-04  43%  442 aa  MNME_WOLPP RecName: Full=tRNA modification GTPase mnmE;       
  220::275     6e-04  43%  508 aa  MNME_WOLPM RecName: Full=tRNA modification GTPase mnmE;       
  221::358     6e-04  30%  441 aa  MNME_RHOPT RecName: Full=tRNA modification GTPase mnmE;       
  219::276     6e-04  35%  439 aa  MNME_RHIL3 RecName: Full=tRNA modification GTPase mnmE;       
  189::274     6e-04  33%  452 aa  MNME_OPITP RecName: Full=tRNA modification GTPase mnmE;       
  223::282     6e-04  39%  444 aa  MNME_METPB RecName: Full=tRNA modification GTPase mnmE;       
  229::363     6e-04  28%  462 aa  MNME_LACC3 RecName: Full=tRNA modification GTPase mnmE;       
  212::371     6e-04  26%  438 aa  MNME_CAMFF RecName: Full=tRNA modification GTPase mnmE;       
  215::346     6e-04  28%  441 aa  MNME_CAMC1 RecName: Full=tRNA modification GTPase mnmE;       
  219::274     6e-04  40%  433 aa  MNME_ACICJ RecName: Full=tRNA modification GTPase mnmE;       
  155::326     6e-04  27%  426 aa  HFLX_ECOLI RecName: Full=GTP-binding protein hflX;
  117::238     6e-04  28%  288 aa  GTPB8_BOVIN RecName: Full=GTP-binding protein 8;
  252::307     6e-04  48%  492 aa  GTPB3_RAT RecName: Full=tRNA modification GTPase GTPBP3,
    5::59      6e-04  37%  642 aa  FEOB_HELPY RecName: Full=Ferrous iron transport protein B;
    5::130     6e-04  26%  773 aa  FEOB_ECOLI RecName: Full=Ferrous iron transport protein B;
    5::130     6e-04  26%  773 aa  FEOB_ECOL6 RecName: Full=Ferrous iron transport protein B;
   12::133     6e-04  27%  303 aa  ERA_YERE8 RecName: Full=GTP-binding protein era homolog;
   12::68      6e-04  38%  299 aa  ERA_XANOR RecName: Full=GTP-binding protein era homolog;
   12::68      6e-04  38%  299 aa  ERA_XANOM RecName: Full=GTP-binding protein era homolog;
   12::68      6e-04  38%  300 aa  ERA_XANC5 RecName: Full=GTP-binding protein era homolog;
   12::68      6e-04  38%  299 aa  ERA_XANAC RecName: Full=GTP-binding protein era homolog;
   29::145     6e-04  30%  320 aa  ERA_VIBPA RecName: Full=GTP-binding protein era homolog;
   14::104     6e-04  32%  319 aa  ERA_TREPS RecName: Full=GTP-binding protein era homolog;
   14::104     6e-04  32%  319 aa  ERA_TREPA RecName: Full=GTP-binding protein era homolog;
   12::128     6e-04  26%  302 aa  ERA_LACPL RecName: Full=GTP-binding protein era homolog;
    9::141     6e-04  22%  308 aa  ERA_BRASB RecName: Full=GTP-binding protein era homolog;
   22::138     6e-04  30%  186 aa  ENGB_MYCPE RecName: Full=Probable GTP-binding protein engB;
    5::160     6e-04  25%  465 aa  ENGA_XYLFM RecName: Full=GTP-binding protein engA;
    5::160     6e-04  29%  447 aa  ENGA_RALME RecName: Full=GTP-binding protein engA;
    6::162     6e-04  28%  455 aa  ENGA_PROMM RecName: Full=GTP-binding protein engA;
  156::343     6e-04  29%  439 aa  ENGA_GEOMG RecName: Full=GTP-binding protein engA;
    1::126     6e-04  34%  474 aa  ENGA_CHLCV RecName: Full=GTP-binding protein engA;
    5::91      6e-04  38%  445 aa  ENGA_BURVG RecName: Full=GTP-binding protein engA;
    5::91      6e-04  38%  445 aa  ENGA_BURS3 RecName: Full=GTP-binding protein engA;
    5::91      6e-04  36%  445 aa  ENGA_BURCM RecName: Full=GTP-binding protein engA;
    5::91      6e-04  38%  445 aa  ENGA_BURCJ RecName: Full=GTP-binding protein engA;
    5::91      6e-04  38%  445 aa  ENGA_BURCH RecName: Full=GTP-binding protein engA;
    5::91      6e-04  38%  445 aa  ENGA_BURCC RecName: Full=GTP-binding protein engA;
    5::91      6e-04  38%  445 aa  ENGA_BURCA RecName: Full=GTP-binding protein engA;
    5::91      6e-04  36%  445 aa  ENGA_BURA4 RecName: Full=GTP-binding protein engA;
    7::93      6e-04  38%  451 aa  ENGA_BORPE RecName: Full=GTP-binding protein engA;
    7::93      6e-04  38%  451 aa  ENGA_BORPA RecName: Full=GTP-binding protein engA;
    7::93      6e-04  38%  451 aa  ENGA_BORBR RecName: Full=GTP-binding protein engA;
    4::91      6e-04  38%  475 aa  ENGA_BARHE RecName: Full=GTP-binding protein engA;
    6::173     6e-04  25%  453 aa  ENGA_ANAVT RecName: Full=GTP-binding protein engA;
  173::344     6e-04  28%  440 aa  ENGA_ALKMQ RecName: Full=GTP-binding protein engA;
    4::45      8e-04  38%  393 aa  Y1332_METJA RecName: Full=Uncharacterized GTP-binding protein
  188::298     8e-04  30%  514 aa  OBG_LEIXX RecName: Full=GTPase obg;AltName: Full=GTP-binding
   38::206     8e-04  26%  326 aa  MTG1_MOUSE RecName: Full=Mitochondrial GTPase 1;AltName:
  219::278     8e-04  41%  446 aa  MNME_THIDA RecName: Full=tRNA modification GTPase mnmE;       
  217::284     8e-04  34%  437 aa  MNME_RHIEC RecName: Full=tRNA modification GTPase mnmE;       
  195::342     8e-04  27%  478 aa  MNME_PSYCK RecName: Full=tRNA modification GTPase mnmE;       
  195::355     8e-04  28%  478 aa  MNME_PSYA2 RecName: Full=tRNA modification GTPase mnmE;       
  234::323     8e-04  33%  478 aa  MNME_POLNA RecName: Full=tRNA modification GTPase mnmE;       
  224::327     8e-04  34%  442 aa  MNME_OCHA4 RecName: Full=tRNA modification GTPase mnmE;       
  218::285     8e-04  36%  444 aa  MNME_MYCPE RecName: Full=tRNA modification GTPase mnmE;       
  218::315     8e-04  26%  442 aa  MNME_MYCGE RecName: Full=tRNA modification GTPase mnmE;       
  233::354     8e-04  26%  469 aa  MNME_HALHL RecName: Full=tRNA modification GTPase mnmE;       
  222::330     8e-04  32%  435 aa  MNME_GLUDA RecName: Full=tRNA modification GTPase mnmE;       
  226::342     8e-04  28%  458 aa  MNME_CLOPS RecName: Full=tRNA modification GTPase mnmE;       
  216::308     8e-04  29%  455 aa  MNME_CALS8 RecName: Full=tRNA modification GTPase mnmE;       
   29::145     8e-04  28%  320 aa  ERA_VIBVY RecName: Full=GTP-binding protein era homolog;
   29::145     8e-04  28%  320 aa  ERA_VIBVU RecName: Full=GTP-binding protein era homolog;
   11::67      8e-04  38%  298 aa  ERA_STRMK RecName: Full=GTP-binding protein era homolog;
   11::67      8e-04  38%  298 aa  ERA_STRM5 RecName: Full=GTP-binding protein era homolog;
   26::193     8e-04  27%  198 aa  ENGB_CLOB8 RecName: Full=Probable GTP-binding protein engB;
  190::343     8e-04  24%  460 aa  ENGA_TREPS RecName: Full=GTP-binding protein engA;
  190::343     8e-04  24%  460 aa  ENGA_TREPA RecName: Full=GTP-binding protein engA;
    5::121     8e-04  28%  490 aa  ENGA_SHIB3 RecName: Full=GTP-binding protein engA;
  172::233     8e-04  33%  435 aa  ENGA_MYCPU RecName: Full=GTP-binding protein engA;
    6::160     8e-04  29%  435 aa  ENGA_MYCCT RecName: Full=GTP-binding protein engA;
    6::183     8e-04  31%  438 aa  ENGA_MOOTA RecName: Full=GTP-binding protein engA;
    6::122     8e-04  30%  435 aa  ENGA_LACBA RecName: Full=GTP-binding protein engA;
    5::159     8e-04  26%  490 aa  ENGA_ECO81 RecName: Full=GTP-binding protein engA;
    5::159     8e-04  26%  490 aa  ENGA_ECO45 RecName: Full=GTP-binding protein engA;
  163::310     8e-04  30%  458 aa  ENGA_DESOH RecName: Full=GTP-binding protein engA;
    6::165     8e-04  27%  440 aa  ENGA_CLOTH RecName: Full=GTP-binding protein engA;
  202::349     8e-04  26%  490 aa  ENGA_CHLMU RecName: Full=GTP-binding protein engA;
    3::125     8e-04  25%  461 aa  ENGA_CAMLR RecName: Full=GTP-binding protein engA;
    6::163     8e-04  25%  453 aa  ENGA_ANASP RecName: Full=GTP-binding protein engA;
  184::315     8e-04  29%  467 aa  ENGA_ALHEH RecName: Full=GTP-binding protein engA;
    6::124     8e-04  30%  464 aa  ENGA_AKKM8 RecName: Full=GTP-binding protein engA;
   75::142     8e-04  43%  694 aa  EFG_THELT RecName: Full=Elongation factor G;         Short=EF-G;
   73::182     8e-04  41%  691 aa  EFG_CALS8 RecName: Full=Elongation factor G;         Short=EF-G;
  174::355     0.001  29%  490 aa  MNME_VEREI RecName: Full=tRNA modification GTPase mnmE;       
  226::300     0.001  33%  495 aa  MNME_TREPS RecName: Full=tRNA modification GTPase mnmE;       
  226::300     0.001  33%  495 aa  MNME_TREPA RecName: Full=tRNA modification GTPase mnmE;       
  122::384     0.001  24%  463 aa  MNME_SYNS3 RecName: Full=tRNA modification GTPase mnmE;       
  220::289     0.001  37%  439 aa  MNME_RHIME RecName: Full=tRNA modification GTPase mnmE;       
  214::273     0.001  36%  445 aa  MNME_PHEZH RecName: Full=tRNA modification GTPase mnmE;       
  227::378     0.001  32%  458 aa  MNME_NITOC RecName: Full=tRNA modification GTPase mnmE;       
  220::315     0.001  31%  444 aa  MNME_BRASO RecName: Full=tRNA modification GTPase mnmE;       
  188::368     0.001  28%  449 aa  MNME_AKKM8 RecName: Full=tRNA modification GTPase mnmE;       
  252::324     0.001  38%  492 aa  GTPB3_MOUSE RecName: Full=tRNA modification GTPase GTPBP3,
  141::313     0.001  28%  423 aa  ERG_ANTMA RecName: Full=GTP-binding protein ERG;
  175::271     0.001  32%  465 aa  ENGA_XANOM RecName: Full=GTP-binding protein engA;
  175::271     0.001  32%  465 aa  ENGA_XANCP RecName: Full=GTP-binding protein engA;
  175::271     0.001  32%  465 aa  ENGA_XANCB RecName: Full=GTP-binding protein engA;
  175::271     0.001  32%  465 aa  ENGA_XANC8 RecName: Full=GTP-binding protein engA;
    5::91      0.001  38%  447 aa  ENGA_RALEJ RecName: Full=GTP-binding protein engA;
    6::165     0.001  27%  441 aa  ENGA_EUBE2 RecName: Full=GTP-binding protein engA;
  182::308     0.001  32%  444 aa  ENGA_DESMR RecName: Full=GTP-binding protein engA;
    6::184     0.001  25%  452 aa  ENGA_CYAP8 RecName: Full=GTP-binding protein engA;
    5::91      0.001  35%  447 aa  ENGA_CUPTR RecName: Full=GTP-binding protein engA;
   97::238     0.001  28%  437 aa  ENGA_CHLPD RecName: Full=GTP-binding protein engA;
  119::239     0.001  31%  438 aa  ENGA_CHLP8 RecName: Full=GTP-binding protein engA;
  180::238     0.001  36%  443 aa  ENGA_CHLCH RecName: Full=GTP-binding protein engA;
    7::93      0.001  33%  451 aa  ENGA_BORPD RecName: Full=GTP-binding protein engA;
   75::142     0.001  43%  695 aa  EFG_THESQ RecName: Full=Elongation factor G;         Short=EF-G;
   75::142     0.001  43%  695 aa  EFG_THEP1 RecName: Full=Elongation factor G;         Short=EF-G;
    1::346

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEVVDKSKLPYVYAADELISLFLTTYSREEARGSTAEPAFVKQKRLEIKRIVSSGKAIASILREMALRMP
NOG1_YEAST      --------IPTVAPANDLLDIVLNRTQRKTP--TVIRPGFTRIRAFYMRKVKYTGEGFVEKFEDILKGFP
NOG1_KLULA      --------IPTVAPANDLLDIVLNRTQRKTP--TVIRPGFTRIRAFYMRKVKFTGEGFVEKFDDILKGFP
NOG1_ASHGO      --------IPTVPTSNDMLDIVLNRTQRKTPTVIRAGFKITRIRAFYMRKVKFTCEGFIEKFDDILKGFP
NOG1_CANGA      --------IPTVAPANDMLDIVLNRTQRKTP--TVIRPGFTRIRAFYMRKVKFTAEGFEEKFDDILKGFP
NOG1_ENCCU      ----------------ELIDISLSKTQKRTPTVIHPQYNIVKIRMFYMRKVKHAGNEFASRLGTILTDFP
NOG1_DROME      -------------------------------------------------------------LSQIIQDFP
NOG1_CAEEL      -------------------------------------------------------------LTQIITEFP
NOG1_DICDI      MVLYNFKKIQVVPTSKDFIDIVLSKTQRKTPTEIHKQYAIGRIRTFYMRKVKYTAQSYHEKLTQIIGDFP
NOG1_MOUSE      -------KITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQILSDFP
NOG1_HUMAN      -------KITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQILTDFP
NOG1_RAT        -------KITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQILSDFP
NOG1_ARATH      ---------------------------------------------------------------------P
Y1408_METJA     -------KMPTILMPDELMAKALRRGEKVANEMRQKEPWLLKARFVEEHKVRTIASVVADNLQKVIDKTP
NOG1_TRYBB      -------------------------------------------RQFYMRKVKFTQKTINEKLTHILTEFP
NOG1_SCHPO      -----------------------------------------------------------SILQEF----P
OBG_BIFLO       ----------------------------------------------------------------------
OBG_BIFLI       ----------------------------------------------------------------------
OBG_BIFLD       ----------------------------------------------------------------------
OBG_SYNJA       ----------------------------------------------------------------------
OBG_VIBF1       ----------------------------------------------------------------------
OBG_BURP8       ----------------------------------------------------------------------
OBG_PELCD       ----------------------------------------------------------------------
OBG_CELJU       ----------------------------------------------------------------------
OBG_RICBR       ----------------------------------------------------------------------
OBG_RICB8       ----------------------------------------------------------------------
OBG_VIBFM       ----------------------------------------------------------------------
OBG_FRATM       ----------------------------------------------------------------------
OBG_CALS8       ----------------------------------------------------------------------
OBG_RICCN       ----------------------------------------------------------------------
OBG_ERWT9       ----------------------------------------------------------------------
OBG_DECAR       ----------------------------------------------------------------------
OBG_ANATD       ----------------------------------------------------------------------
OBG_SYNJB       ----------------------------------------------------------------------
OBG_PSYCK       ----------------------------------------------------------------------
OBG_SHEDO       ----------------------------------------------------------------------
OBG_SHEB9       ----------------------------------------------------------------------
OBG_SHEB8       ----------------------------------------------------------------------
OBG_SHEB5       ----------------------------------------------------------------------
OBG_SHEB2       ----------------------------------------------------------------------
OBG_FRATW       ----------------------------------------------------------------------
OBG_FRATT       ----------------------------------------------------------------------
OBG_FRATN       ----------------------------------------------------------------------
OBG_FRAT1       ----------------------------------------------------------------------
OBG_BIFA0       ----------------------------------------------------------------------
OBG_PSYA2       ----------------------------------------------------------------------
OBG_AZOSE       ----------------------------------------------------------------------
OBG_RICFE       ----------------------------------------------------------------------
OBG_SHEWM       ----------------------------------------------------------------------
OBG_SHEPW       ----------------------------------------------------------------------
OBG_PSEMY       ----------------------------------------------------------------------
OBG_MYCSS       ----------------------------------------------------------------------
OBG_MYCSK       ----------------------------------------------------------------------
OBG_MYCSJ       ----------------------------------------------------------------------
OBG_HERAR       ----------------------------------------------------------------------
OBG_VESOH       ----------------------------------------------------------------------
OBG_SHEHH       ----------------------------------------------------------------------
OBG_RICAH       ----------------------------------------------------------------------
OBG_PROMH       ----------------------------------------------------------------------
OBG_PHOLL       ----------------------------------------------------------------------
OBG_MYCS2       ----------------------------------------------------------------------
OBG_DICT6       ----------------------------------------------------------------------
GTPB5_HUMAN     ----------------------------------------------------------------------
OBG_POLSQ       ----------------------------------------------------------------------
OBG_MARMS       ----------------------------------------------------------------------
OBG_JANMA       ----------------------------------------------------------------------
OBG_SACD2       ----------------------------------------------------------------------
OBG_RICM5       ----------------------------------------------------------------------
OBG_COPPD       ----------------------------------------------------------------------
OBG_VIBPA       ----------------------------------------------------------------------
OBG_RICRS       ----------------------------------------------------------------------
OBG_RICRO       ----------------------------------------------------------------------
OBG_PSYIN       ----------------------------------------------------------------------
OBG_COLP3       ----------------------------------------------------------------------
OBG_ACTSZ       ----------------------------------------------------------------------
OBG_ACIBY       ----------------------------------------------------------------------
OBG_ACIBT       ----------------------------------------------------------------------
OBG_ACIBS       ----------------------------------------------------------------------
OBG_ACIBC       ----------------------------------------------------------------------
OBG_ACIB5       ----------------------------------------------------------------------
OBG_ACIB3       ----------------------------------------------------------------------
OBG_THICR       ----------------------------------------------------------------------
OBG_THESQ       ----------------------------------------------------------------------
OBG_THEP1       ----------------------------------------------------------------------
OBG_THEMA       ----------------------------------------------------------------------
OBG_SHEPA       ----------------------------------------------------------------------
OBG_MYCVP       ----------------------------------------------------------------------
OBG_BLOPB       ----------------------------------------------------------------------
OBG_ACIAD       ----------------------------------------------------------------------
OBG_VIBSL       ----------------------------------------------------------------------
OBG_THEM4       ----------------------------------------------------------------------
OBG_PSEU2       ----------------------------------------------------------------------
OBG_PSE14       ----------------------------------------------------------------------
OBG_BURXL       ----------------------------------------------------------------------
OBG_BURCM       ----------------------------------------------------------------------
OBG_BURCJ       ----------------------------------------------------------------------
OBG_BURCH       ----------------------------------------------------------------------
OBG_BURCC       ----------------------------------------------------------------------
OBG_BURCA       ----------------------------------------------------------------------
OBG_BURA4       ----------------------------------------------------------------------
GTPB5_PONAB     ----------------------------------------------------------------------
OBG_SOLUE       ----------------------------------------------------------------------
OBG_SACEN       ----------------------------------------------------------------------
OBG_FRATO       ----------------------------------------------------------------------
OBG_FRATH       ----------------------------------------------------------------------
OBG_FRATF       ----------------------------------------------------------------------
OBG_DESDA       ----------------------------------------------------------------------
MNME_SYNP2      ----------------------------------------------------------------------
OBG_VIBVY       ----------------------------------------------------------------------
OBG_RHOP5       ----------------------------------------------------------------------
OBG_OLICO       ----------------------------------------------------------------------
OBG_CLAMS       ----------------------------------------------------------------------
OBG_CLAM3       ----------------------------------------------------------------------
OBG_BURPP       ----------------------------------------------------------------------
OBG_ALKOO       ----------------------------------------------------------------------
OBG_SYNAS       ----------------------------------------------------------------------
OBG_RHOPB       ----------------------------------------------------------------------
OBG_PSEPK       ----------------------------------------------------------------------
OBG_PSEP1       ----------------------------------------------------------------------
OBG_PSEA6       ----------------------------------------------------------------------
OBG_MYCGI       ----------------------------------------------------------------------
OBG_MANSM       ----------------------------------------------------------------------
OBG_HAES2       ----------------------------------------------------------------------
OBG_DICTD       ----------------------------------------------------------------------
OBG_CHRVO       ----------------------------------------------------------------------
OBG_BORPE       ----------------------------------------------------------------------
OBG_BORPA       ----------------------------------------------------------------------
OBG_BORBR       ----------------------------------------------------------------------
OBG2_ANAMM      ----------------------------------------------------------------------
OBG2_ANAMF      ----------------------------------------------------------------------
OBG1_ANAMM      ----------------------------------------------------------------------
OBG1_ANAMF      ----------------------------------------------------------------------
OBG_SYNWW       ----------------------------------------------------------------------
OBG_RHOCS       ----------------------------------------------------------------------
OBG_PSEPG       ----------------------------------------------------------------------
OBG_PHOPR       ----------------------------------------------------------------------
OBG_JANSC       ----------------------------------------------------------------------
OBG_DESVV       ----------------------------------------------------------------------
OBG_DESVH       ----------------------------------------------------------------------
OBG_BURP6       ----------------------------------------------------------------------
OBG_ALKMQ       ----------------------------------------------------------------------
OBG_YERPY       ----------------------------------------------------------------------
OBG_YERPS       ----------------------------------------------------------------------
OBG_YERPP       ----------------------------------------------------------------------
OBG_YERPN       ----------------------------------------------------------------------
OBG_YERPG       ----------------------------------------------------------------------
OBG_YERPE       ----------------------------------------------------------------------
OBG_YERPB       ----------------------------------------------------------------------
OBG_YERPA       ----------------------------------------------------------------------
OBG_YERP3       ----------------------------------------------------------------------
OBG_VIBHB       ----------------------------------------------------------------------
OBG_VIBHA       ----------------------------------------------------------------------
OBG_RICCK       ----------------------------------------------------------------------
OBG_PSYWF       ----------------------------------------------------------------------
OBG_BORPD       ----------------------------------------------------------------------
OBG_AERS4       ----------------------------------------------------------------------
OBG_YERE8       ----------------------------------------------------------------------
OBG_THIDA       ----------------------------------------------------------------------
OBG_THENN       ----------------------------------------------------------------------
OBG_SILPO       ----------------------------------------------------------------------
OBG_SHEAM       ----------------------------------------------------------------------
OBG_NITWN       ----------------------------------------------------------------------
OBG_NITOC       ----------------------------------------------------------------------
OBG_MARAV       ----------------------------------------------------------------------
OBG_GEOLS       ----------------------------------------------------------------------
OBG_FRAP2       ----------------------------------------------------------------------
OBG_CLOTH       ----------------------------------------------------------------------
OBG_BURVG       ----------------------------------------------------------------------
OBG_BURPS       ----------------------------------------------------------------------
OBG_BURP1       ----------------------------------------------------------------------
OBG_BURP0       ----------------------------------------------------------------------
OBG_BURMS       ----------------------------------------------------------------------
OBG_BURMA       ----------------------------------------------------------------------
OBG_BURM9       ----------------------------------------------------------------------
OBG_BURM7       ----------------------------------------------------------------------
OBG_RHOBA       ----------------------------------------------------------------------
OBG_PSEE4       ----------------------------------------------------------------------
OBG_MYCMM       ----------------------------------------------------------------------
OBG_METSB       ----------------------------------------------------------------------
OBG_EHRCR       ----------------------------------------------------------------------
OBG_EHRCJ       ----------------------------------------------------------------------
OBG_DESDG       ----------------------------------------------------------------------
OBG_CORJK       ----------------------------------------------------------------------
OBG_CHLL2       ----------------------------------------------------------------------
OBG_BURS3       ----------------------------------------------------------------------
OBG_VIBVU       ----------------------------------------------------------------------
OBG_PARUW       ----------------------------------------------------------------------
OBG_HAES1       ----------------------------------------------------------------------
OBG_ANADF       ----------------------------------------------------------------------
OBG_AERHH       ----------------------------------------------------------------------
OBG_STRCO       ----------------------------------------------------------------------
OBG_SODGM       ----------------------------------------------------------------------
OBG_SHESH       ----------------------------------------------------------------------
OBG_PSEPF       ----------------------------------------------------------------------
OBG_NITHX       ----------------------------------------------------------------------
OBG_BURM1       ----------------------------------------------------------------------
OBG_ALTMD       ----------------------------------------------------------------------
OBG_AKKM8       ----------------------------------------------------------------------
OBG_THELT       ----------------------------------------------------------------------
OBG_RICTY       ----------------------------------------------------------------------
OBG_RALME       ----------------------------------------------------------------------
OBG_MYCUA       ----------------------------------------------------------------------
OBG_DESVM       ----------------------------------------------------------------------
OBG_CHLCH       ----------------------------------------------------------------------
OBG_BRASO       ----------------------------------------------------------------------
OBG_BART1       ----------------------------------------------------------------------
OBG_AZOSB       ----------------------------------------------------------------------
OBG_ALISL       ----------------------------------------------------------------------
OBG_ACTPJ       ----------------------------------------------------------------------
OBG_ACTP7       ----------------------------------------------------------------------
OBG_ACTP2       ----------------------------------------------------------------------
MNME_AQUAE      -------KAPHSYTGEDMVELNLHGNPRVNAGARLAEPGFTKRAFLNGKLDLTQAEAVAELIRKVALKQ-
OBG_STRGR       ----------------------------------------------------------------------
OBG_STRGG       ----------------------------------------------------------------------
OBG_SHELP       ----------------------------------------------------------------------
OBG_RALEJ       ----------------------------------------------------------------------
OBG_PSEPW       ----------------------------------------------------------------------
OBG_PHYMT       ----------------------------------------------------------------------
OBG_PARDP       ----------------------------------------------------------------------
OBG_METEP       ----------------------------------------------------------------------
OBG_METC4       ----------------------------------------------------------------------
OBG_HAEIN       ----------------------------------------------------------------------
OBG_HAEI8       ----------------------------------------------------------------------
OBG_GLUDA       ----------------------------------------------------------------------
OBG_RUTMC       ----------------------------------------------------------------------
OBG_RHOP2       ----------------------------------------------------------------------
OBG_RALPJ       ----------------------------------------------------------------------
OBG_RALEH       ----------------------------------------------------------------------
OBG_ORITI       ----------------------------------------------------------------------
OBG_ORITB       ----------------------------------------------------------------------
OBG_IDILO       ----------------------------------------------------------------------
OBG_HAEIG       ----------------------------------------------------------------------
OBG_HAEIE       ----------------------------------------------------------------------
OBG_BRASB       ----------------------------------------------------------------------
GTPBA_XENLA     ----------------------------------------------------------------------
OBG_RHOPT       ----------------------------------------------------------------------
OBG_RHOPA       ----------------------------------------------------------------------
OBG_PSEU5       ----------------------------------------------------------------------
OBG_NEIMF       ----------------------------------------------------------------------
OBG_NEIMB       ----------------------------------------------------------------------
OBG_KINRD       ----------------------------------------------------------------------
OBG_FERNB       ----------------------------------------------------------------------
OBG_BDEBA       ----------------------------------------------------------------------
OBG_ACISJ       ----------------------------------------------------------------------
MNME_PROM1      ---------------------------------------------IPVQKILERILAFPSVRREFSQRAV
OBG_UNCTG       ----------------------------------------------------------------------
OBG_STRAW       ----------------------------------------------------------------------
OBG_ROSDO       ----------------------------------------------------------------------
OBG_RHOSK       ----------------------------------------------------------------------
OBG_RHOPS       ----------------------------------------------------------------------
OBG_PSEHT       ----------------------------------------------------------------------
OBG_CYAP4       ----------------------------------------------------------------------
OBG_CUPTR       ----------------------------------------------------------------------
OBG_BURTA       ----------------------------------------------------------------------
OBG_BRAJA       ----------------------------------------------------------------------
OBG_AGRRK       ----------------------------------------------------------------------
OBG_RHOS4       ----------------------------------------------------------------------
OBG_RHOS1       ----------------------------------------------------------------------
OBG_NEIMA       ----------------------------------------------------------------------
OBG_NEIM0       ----------------------------------------------------------------------
OBG_NEIG2       ----------------------------------------------------------------------
OBG_NEIG1       ----------------------------------------------------------------------
OBG_MOOTA       ----------------------------------------------------------------------
OBG_LEGPH       ----------------------------------------------------------------------
OBG_LEGPC       ----------------------------------------------------------------------
OBG_LEGPA       ----------------------------------------------------------------------
OBG_GLOVI       ----------------------------------------------------------------------
OBG_GEOMG       ----------------------------------------------------------------------
OBG_COXBU       ----------------------------------------------------------------------
OBG_COXBR       ----------------------------------------------------------------------
OBG_COXBN       ----------------------------------------------------------------------
OBG_COXB2       ----------------------------------------------------------------------
OBG_COXB1       ----------------------------------------------------------------------
OBG_CLONN       ----------------------------------------------------------------------
OBG_CHRSD       ----------------------------------------------------------------------
OBG_CHLP8       ----------------------------------------------------------------------
OBG_BRAHW       ----------------------------------------------------------------------
OBG_ACIBL       ----------------------------------------------------------------------
OBG_THETN       ----------------------------------------------------------------------
OBG_SHEFN       ----------------------------------------------------------------------
OBG_RHOS5       ----------------------------------------------------------------------
OBG_PSEF5       ----------------------------------------------------------------------
OBG_PERMH       ----------------------------------------------------------------------
OBG_LEGPL       ----------------------------------------------------------------------
OBG_DIAST       ----------------------------------------------------------------------
OBG_CORDI       ----------------------------------------------------------------------
OBG_CHLTE       ----------------------------------------------------------------------
OBG_CHLPD       ----------------------------------------------------------------------
OBG_BORA1       ----------------------------------------------------------------------
OBG_AYWBP       ----------------------------------------------------------------------
OBG_ANAPZ       ----------------------------------------------------------------------
OBG_ACIC1       ----------------------------------------------------------------------
MNME_PROMT      ---------------------------------------------IPVQKILERILAFPSVRREFSQRAV
OBG_VIBCH       ----------------------------------------------------------------------
OBG_THET8       ----------------------------------------------------------------------
OBG_THET2       ----------------------------------------------------------------------
OBG_RICPR       ----------------------------------------------------------------------
OBG_POLSJ       ----------------------------------------------------------------------
OBG_MYCPA       ----------------------------------------------------------------------
OBG_MYCA9       ----------------------------------------------------------------------
OBG_MYCA1       ----------------------------------------------------------------------
OBG_HAHCH       ----------------------------------------------------------------------
OBG_DESAH       ----------------------------------------------------------------------
OBG_CLOTE       ----------------------------------------------------------------------
OBG_CARHZ       ----------------------------------------------------------------------
OBG_ACAM1       ----------------------------------------------------------------------
MNME_BAUCH      ----------------------------------------------------------------------
OBG_SALRD       ----------------------------------------------------------------------
OBG_PELPD       ----------------------------------------------------------------------
OBG_PASMU       ----------------------------------------------------------------------
OBG_ONYPE       ----------------------------------------------------------------------
OBG_NATTJ       ----------------------------------------------------------------------
OBG_HALOH       ----------------------------------------------------------------------
OBG_DELAS       ----------------------------------------------------------------------
OBG_CYAP8       ----------------------------------------------------------------------
OBG_CORGB       ----------------------------------------------------------------------
MNME_RALEJ      ----------------------------------------------------------------------
OBG_VEREI       ----------------------------------------------------------------------
OBG_SYNP6       ----------------------------------------------------------------------
OBG_SYNE7       ----------------------------------------------------------------------
OBG_SALAI       ----------------------------------------------------------------------
OBG_ROSS1       ----------------------------------------------------------------------
OBG_RHORT       ----------------------------------------------------------------------
OBG_MYCAP       ----------------------------------------------------------------------
OBG_METRJ       ----------------------------------------------------------------------
OBG_METFK       ----------------------------------------------------------------------
OBG_MAGSA       ----------------------------------------------------------------------
OBG_LEPBL       ----------------------------------------------------------------------
OBG_LEPBJ       ----------------------------------------------------------------------
OBG_KOCRD       ----------------------------------------------------------------------
OBG_HAEDU       ----------------------------------------------------------------------
OBG_CLOPS       ----------------------------------------------------------------------
OBG_CLOPE       ----------------------------------------------------------------------
OBG_CLOP1       ----------------------------------------------------------------------
OBG_BORGA       ----------------------------------------------------------------------
OBG_BORBZ       ----------------------------------------------------------------------
OBG_BORBU       ----------------------------------------------------------------------
OBG_BIFAA       ----------------------------------------------------------------------
OBG_BARBK       ----------------------------------------------------------------------
OBG_ALCBS       ----------------------------------------------------------------------
OBG_XYLFT       ----------------------------------------------------------------------
OBG_XYLFM       ----------------------------------------------------------------------
OBG_XYLFA       ----------------------------------------------------------------------
OBG_XYLF2       ----------------------------------------------------------------------
OBG_XANP2       ----------------------------------------------------------------------
OBG_WOLSU       ----------------------------------------------------------------------
OBG_NITMU       ----------------------------------------------------------------------
OBG_LEPIN       ----------------------------------------------------------------------
OBG_LEPIC       ----------------------------------------------------------------------
OBG_LEPCP       ----------------------------------------------------------------------
OBG_ELUMP       ----------------------------------------------------------------------
OBG_CORGL       ----------------------------------------------------------------------
OBG_BRUSU       ----------------------------------------------------------------------
OBG_BRUSI       ----------------------------------------------------------------------
OBG_BRUO2       ----------------------------------------------------------------------
OBG_BRUME       ----------------------------------------------------------------------
OBG_BRUC2       ----------------------------------------------------------------------
OBG_BRUAB       ----------------------------------------------------------------------
OBG_BRUA2       ----------------------------------------------------------------------
OBG_BRUA1       ----------------------------------------------------------------------
OBG_BAUCH       ----------------------------------------------------------------------
OBG_BARHE       ----------------------------------------------------------------------
OBG_AMOA5       ----------------------------------------------------------------------
ENGA_HELP2      ----------------------------------------------------------------------
OBG_THEPX       ----------------------------------------------------------------------
OBG_THEP3       ----------------------------------------------------------------------
OBG_RHOE4       ----------------------------------------------------------------------
OBG_PORGI       ----------------------------------------------------------------------
OBG_PORG3       ----------------------------------------------------------------------
OBG_OCHA4       ----------------------------------------------------------------------
OBG_NOSP7       ----------------------------------------------------------------------
OBG_NOCSJ       ----------------------------------------------------------------------
OBG_MYCLE       ----------------------------------------------------------------------
OBG_MYCLB       ----------------------------------------------------------------------
OBG_MAGSM       ----------------------------------------------------------------------
OBG_GEOSL       ----------------------------------------------------------------------
OBG_FRASC       ----------------------------------------------------------------------
OBG_ERWCT       ----------------------------------------------------------------------
OBG_DINSH       ----------------------------------------------------------------------
OBG_BREBN       ----------------------------------------------------------------------
OBG_BEII9       ----------------------------------------------------------------------
OBG_ACIAC       ----------------------------------------------------------------------
MNME_HAHCH      -----------------------------------------------VKRIVSLGARLARP-GEFSERAF
GTPBA_XENTR     ----------------------------------------------------------------------
GTPBA_DROME     ----------------------------------------------------------------------
ERA_GEOSM       ----------------------------------------------------------------------
ENGA_HELPY      ----------------------------------------------------------------------
YG3Y_YEAST      ----------------------------------------------------------------------
Y1111_HALSA     ----------------------------------------------------------------------
OBG_THEAB       ----------------------------------------------------------------------
OBG_SYNY3       ----------------------------------------------------------------------
OBG_OENOB       ----------------------------------------------------------------------
OBG_BUCAP       ----------------------------------------------------------------------
OBG_BARQU       ----------------------------------------------------------------------
GTPBA_HUMAN     ----------------------------------------------------------------------
ENGA_KOSOT      ----------------------------------------------------------------------
ENGA_HELPH      ----------------------------------------------------------------------
ENGA_HELPG      ----------------------------------------------------------------------
OBG_STRM5       ----------------------------------------------------------------------
OBG_SALTO       ----------------------------------------------------------------------
OBG_ROSCS       ----------------------------------------------------------------------
OBG_PSEAE       ----------------------------------------------------------------------
OBG_PSEAB       ----------------------------------------------------------------------
OBG_PSEA8       ----------------------------------------------------------------------
OBG_PETMO       ----------------------------------------------------------------------
OBG_CHLPB       ----------------------------------------------------------------------
OBG_CAUSK       ----------------------------------------------------------------------
OBG_BACFR       ----------------------------------------------------------------------
OBG_BACFN       ----------------------------------------------------------------------
OBG_AQUAE       ----------------------------------------------------------------------
OBG_ACICJ       ----------------------------------------------------------------------
OBG_ACIC5       ----------------------------------------------------------------------
ENGA_DEIDV      ----------------------------------------------------------------------
OBG_ZYMMO       ----------------------------------------------------------------------
OBG_XANOR       ----------------------------------------------------------------------
OBG_XANOP       ----------------------------------------------------------------------
OBG_XANOM       ----------------------------------------------------------------------
OBG_STRMK       ----------------------------------------------------------------------
OBG_SILST       ----------------------------------------------------------------------
OBG_SERP5       ----------------------------------------------------------------------
OBG_OCEIH       ----------------------------------------------------------------------
OBG_MICAN       ----------------------------------------------------------------------
OBG_METS4       ----------------------------------------------------------------------
OBG_METPB       ----------------------------------------------------------------------
OBG_METI4       ----------------------------------------------------------------------
OBG_GEOKA       ----------------------------------------------------------------------
OBG_FUSNN       ----------------------------------------------------------------------
OBG_DESAP       ----------------------------------------------------------------------
OBG_CORU7       ----------------------------------------------------------------------
OBG_CHLT3       ----------------------------------------------------------------------
OBG_BORHD       ----------------------------------------------------------------------
OBG_ANOFW       ----------------------------------------------------------------------
ENGA_HELPS      ----------------------------------------------------------------------
ENGA_HELPJ      ----------------------------------------------------------------------
ENGA_DEIRA      ----------------------------------------------------------------------
ENGA_BACTN      ----------------------------------------------------------------------
OBG_RHOFD       ----------------------------------------------------------------------
OBG_PSEA7       ----------------------------------------------------------------------
OBG_POLNS       ----------------------------------------------------------------------
OBG_POLNA       ----------------------------------------------------------------------
OBG_PARL1       ----------------------------------------------------------------------
OBG_NEOSM       ----------------------------------------------------------------------
OBG_MYCTU       ----------------------------------------------------------------------
OBG_MYCTA       ----------------------------------------------------------------------
OBG_MYCBP       ----------------------------------------------------------------------
OBG_MYCBO       ----------------------------------------------------------------------
OBG_MESSB       ----------------------------------------------------------------------
OBG_FRASN       ----------------------------------------------------------------------
OBG_DESHD       ----------------------------------------------------------------------
OBG_BORAP       ----------------------------------------------------------------------
OBG_BACLD       ----------------------------------------------------------------------
OBG_AZOC5       ----------------------------------------------------------------------
OBG_ALHEH       ----------------------------------------------------------------------
OBG_ACIF5       ----------------------------------------------------------------------
OBG_ACIF2       ----------------------------------------------------------------------
MNME_SYNY3      ----------------------------------------------------------------------
MNME_SYNJA      ----------------------------------------------------------------------
MNME_FERNB      ----------------------------------------------------------------------
MNME_BACSU      ----------------------------------------------------------------------
ENGA_SULSY      ----------------------------------------------------------------------
ENGA_PORGI      ----------------------------------------------------------------------
OBG_STRP1       ----------------------------------------------------------------------
OBG_RHOSR       ----------------------------------------------------------------------
OBG_PELLD       ----------------------------------------------------------------------
OBG_PARD8       ----------------------------------------------------------------------
OBG_NITEU       ----------------------------------------------------------------------
OBG_MYCS5       ----------------------------------------------------------------------
OBG_MARMM       ----------------------------------------------------------------------
OBG_ECO7I       ----------------------------------------------------------------------
OBG_BORT9       ----------------------------------------------------------------------
OBG_BACTN       ----------------------------------------------------------------------
MNME_MANSM      ----------------------------------------------------------------------
OBG_XANC5       ----------------------------------------------------------------------
OBG_STRA5       ----------------------------------------------------------------------
OBG_STRA3       ----------------------------------------------------------------------
OBG_STRA1       ----------------------------------------------------------------------
OBG_SHISS       ----------------------------------------------------------------------
OBG_SHIFL       ----------------------------------------------------------------------
OBG_SHIF8       ----------------------------------------------------------------------
OBG_SHIDS       ----------------------------------------------------------------------
OBG_SHIBS       ----------------------------------------------------------------------
OBG_SHIB3       ----------------------------------------------------------------------
OBG_PHYAS       ----------------------------------------------------------------------
OBG_METNO       ----------------------------------------------------------------------
OBG_ESCF3       ----------------------------------------------------------------------
OBG_ENTS8       ----------------------------------------------------------------------
OBG_EHRRG       ----------------------------------------------------------------------
OBG_ECOUT       ----------------------------------------------------------------------
OBG_ECOSM       ----------------------------------------------------------------------
OBG_ECOSE       ----------------------------------------------------------------------
OBG_ECOLU       ----------------------------------------------------------------------
OBG_ECOLI       ----------------------------------------------------------------------
OBG_ECOLC       ----------------------------------------------------------------------
OBG_ECOL6       ----------------------------------------------------------------------
OBG_ECOL5       ----------------------------------------------------------------------
OBG_ECOK1       ----------------------------------------------------------------------
OBG_ECOHS       ----------------------------------------------------------------------
OBG_ECODH       ----------------------------------------------------------------------
OBG_ECO8A       ----------------------------------------------------------------------
OBG_ECO81       ----------------------------------------------------------------------
OBG_ECO5E       ----------------------------------------------------------------------
OBG_ECO57       ----------------------------------------------------------------------
OBG_ECO55       ----------------------------------------------------------------------
OBG_ECO45       ----------------------------------------------------------------------
OBG_ECO27       ----------------------------------------------------------------------
OBG_ECO24       ----------------------------------------------------------------------
OBG_CYAP7       ----------------------------------------------------------------------
OBG_CLOD6       ----------------------------------------------------------------------
OBG_BACV8       ----------------------------------------------------------------------
OBG_BACSU       ----------------------------------------------------------------------
OBG_BACHD       ----------------------------------------------------------------------
OBG_ANASK       ----------------------------------------------------------------------
OBG_ANADE       ----------------------------------------------------------------------
OBG_ANAD2       ----------------------------------------------------------------------
OBG_AGRT5       ----------------------------------------------------------------------
DRG2_HUMAN      ----------------------------------------------------------------------
OBG_SHESW       ----------------------------------------------------------------------
OBG_SHEPC       ----------------------------------------------------------------------
OBG_RHILO       ----------------------------------------------------------------------
OBG_PROM4       ----------------------------------------------------------------------
OBG_LISW6       ----------------------------------------------------------------------
OBG_LISIN       ----------------------------------------------------------------------
OBG_KLEP7       ----------------------------------------------------------------------
OBG_KLEP3       ----------------------------------------------------------------------
OBG_HELPY       ----------------------------------------------------------------------
OBG_HAEPS       ----------------------------------------------------------------------
OBG_EHRRW       ----------------------------------------------------------------------
OBG_CYAA5       ----------------------------------------------------------------------
OBG_CLOBK       ----------------------------------------------------------------------
OBG_CLOBH       ----------------------------------------------------------------------
OBG_CLOB1       ----------------------------------------------------------------------
OBG_CITK8       ----------------------------------------------------------------------
OBG_BUCAT       ----------------------------------------------------------------------
OBG_BUCAI       ----------------------------------------------------------------------
OBG_BUCA5       ----------------------------------------------------------------------
OBG_BACSK       ----------------------------------------------------------------------
OBG_BACC4       ----------------------------------------------------------------------
OBG_ARTS2       ----------------------------------------------------------------------
OBG_ARTCA       ----------------------------------------------------------------------
OBG_ARTAT       ----------------------------------------------------------------------
MNME_RALME      ----------------------------------------------------------------------
ENGA_BACV8      ----------------------------------------------------------------------
DRG2_BOVIN      ----------------------------------------------------------------------
OBG_XANCP       ----------------------------------------------------------------------
OBG_XANCB       ----------------------------------------------------------------------
OBG_XANC8       ----------------------------------------------------------------------
OBG_XANAC       ----------------------------------------------------------------------
OBG_SULDN       ----------------------------------------------------------------------
OBG_STRPZ       ----------------------------------------------------------------------
OBG_STRPM       ----------------------------------------------------------------------
OBG_STRPD       ----------------------------------------------------------------------
OBG_STRPC       ----------------------------------------------------------------------
OBG_STRPB       ----------------------------------------------------------------------
OBG_STRP8       ----------------------------------------------------------------------
OBG_STRP6       ----------------------------------------------------------------------
OBG_SALTY       ----------------------------------------------------------------------
OBG_SALTI       ----------------------------------------------------------------------
OBG_SALSV       ----------------------------------------------------------------------
OBG_SALPK       ----------------------------------------------------------------------
OBG_SALPC       ----------------------------------------------------------------------
OBG_SALPB       ----------------------------------------------------------------------
OBG_SALPA       ----------------------------------------------------------------------
OBG_SALNS       ----------------------------------------------------------------------
OBG_SALHS       ----------------------------------------------------------------------
OBG_SALG2       ----------------------------------------------------------------------
OBG_SALEP       ----------------------------------------------------------------------
OBG_SALDC       ----------------------------------------------------------------------
OBG_SALCH       ----------------------------------------------------------------------
OBG_SALAR       ----------------------------------------------------------------------
OBG_SALA4       ----------------------------------------------------------------------
OBG_RENSM       ----------------------------------------------------------------------
OBG_RALSO       ----------------------------------------------------------------------
OBG_NITEC       ----------------------------------------------------------------------
OBG_LISMO       ----------------------------------------------------------------------
OBG_LISMH       ----------------------------------------------------------------------
OBG_LISMF       ----------------------------------------------------------------------
OBG_GRABC       ----------------------------------------------------------------------
OBG_GEOTN       ----------------------------------------------------------------------
OBG_ENT38       ----------------------------------------------------------------------
OBG_DESHY       ----------------------------------------------------------------------
OBG_CHLAD       ----------------------------------------------------------------------
OBG_BACWK       ----------------------------------------------------------------------
OBG_BACP2       ----------------------------------------------------------------------
MNME_THEM4      ----------------------------------------------------------------------
MNME_COXBU      ---------------DRLLNTVLKAGARQARPGEFSERAFLNNK-IDLAQAASSEQAARSAMR--SLQGE
MNME_COXBR      ---------------DRLLNTVLKAGARQARPGEFSERAFLNNK-IDLAQAASSEQAARSAMR--SLQGE
MNME_COXBN      ---------------DRLLNTVLKAGARQARPGEFSERAFLNNK-IDLAQAASSEQAARSAMR--SLQGE
MNME_BUCMP      ----------------------------------------------------------------------
MNME_BACP2      ----------------------------------------------------------------------
GTPBA_DROPS     ----------------------------------------------------------------------
ERA_THEP1       ----------------------------------------------------------------------
ENGA_BACFR      ----------------------------------------------------------------------
ENGA_BACFN      ----------------------------------------------------------------------
OBG_STRPG       ----------------------------------------------------------------------
OBG_STRPF       ----------------------------------------------------------------------
OBG_STACT       ----------------------------------------------------------------------
OBG_PROAC       ----------------------------------------------------------------------
OBG_NOCFA       ----------------------------------------------------------------------
OBG_MYCGE       ----------------------------------------------------------------------
OBG_LYSSC       ----------------------------------------------------------------------
OBG_LEUMM       ----------------------------------------------------------------------
OBG_LACDB       ----------------------------------------------------------------------
OBG_LACDA       ----------------------------------------------------------------------
OBG_LACC3       ----------------------------------------------------------------------
OBG_DESPS       ----------------------------------------------------------------------
OBG_CLOBM       ----------------------------------------------------------------------
OBG_CHLSY       ----------------------------------------------------------------------
OBG_CHLAA       ----------------------------------------------------------------------
MNME_TRIEI      ----------------------------------------------------------------------
MNME_PHOLL      ----------------------------------------------------------------------
MNME_HAEI8      ---------------------------------------FSEQAFLNDKLDLAQAEAIADLISEQAARSA
ERA_GEOUR       ----------------------------------------------------------------------
OBG_SYMTH       ----------------------------------------------------------------------
OBG_SPHWW       ----------------------------------------------------------------------
OBG_RHISN       ----------------------------------------------------------------------
OBG_MYCGA       ----------------------------------------------------------------------
OBG_LACGA       ----------------------------------------------------------------------
OBG_LACCB       ----------------------------------------------------------------------
OBG_HERA2       ----------------------------------------------------------------------
OBG_HELPH       ----------------------------------------------------------------------
OBG_HELMI       ----------------------------------------------------------------------
OBG_DESOH       ----------------------------------------------------------------------
OBG_COREF       ----------------------------------------------------------------------
OBG_CLOCE       ----------------------------------------------------------------------
OBG_CLOBL       ----------------------------------------------------------------------
OBG_BACHK       ----------------------------------------------------------------------
OBG_BACCZ       ----------------------------------------------------------------------
OBG_BACCR       ----------------------------------------------------------------------
OBG_BACCQ       ----------------------------------------------------------------------
OBG_BACC7       ----------------------------------------------------------------------
OBG_BACC3       ----------------------------------------------------------------------
OBG_BACC2       ----------------------------------------------------------------------
OBG_BACC1       ----------------------------------------------------------------------
OBG_BACC0       ----------------------------------------------------------------------
OBG_BACAN       ----------------------------------------------------------------------
OBG_BACAH       ----------------------------------------------------------------------
OBG_AZOVD       ----------------------------------------------------------------------
OBG_ACHLI       ----------------------------------------------------------------------
MNME_THEEB      ----------------------------------------------------------------------
MNME_SYNEL      ----------------------------------------------------------------------
MNME_SHEFN      ----------------------------------------------------------------------
MNME_OCEIH      ----------------------------------------------------------------------
MNME_MICAN      ----------------------------------------------------------------------
MNME_HAEDU      ----------------------------------------------------------------------
MNME_CARHZ      ----------------------------------------------------------------------
ERA_THEMA       ----------------------------------------------------------------------
OBG_UREU1       ----------------------------------------------------------------------
OBG_TREDE       ----------------------------------------------------------------------
OBG_SYNSC       ----------------------------------------------------------------------
OBG_SULSY       ----------------------------------------------------------------------
OBG_STRP3       ----------------------------------------------------------------------
OBG_SPHAL       ----------------------------------------------------------------------
OBG_PELPB       ----------------------------------------------------------------------
OBG_MYCHJ       ----------------------------------------------------------------------
OBG_LACS1       ----------------------------------------------------------------------
OBG_LACJO       ----------------------------------------------------------------------
OBG_DICNV       ----------------------------------------------------------------------
OBG_DESAA       ----------------------------------------------------------------------
OBG_CLOB8       ----------------------------------------------------------------------
MNME_PSE14      ----------------------------------------------------------------------
MNME_GEOKA      ----------------------------------------------------------------------
MNME_DESPS      ----------------------------------------------------------------------
MNME_CHLCV      ----------------------------------------------------------------------
MNME_BACHD      ----------------------------------------------------------------------
MNME_BACA2      ----------------------------------------------------------------------
MNME_ANASP      ----------------------------------------------------------------------
MNME_ALKOO      ----------------------------------------------------------------------
MNME_ACAM1      ----------------------------------------------------------------------
GTPBA_DANRE     ----------------------------------------------------------------------
GTPBA_BOVIN     ----------------------------------------------------------------------
ENGA_VIBCM      ----------------------------------------------------------------------
ENGA_VIBCH      ----------------------------------------------------------------------
ENGA_VIBC3      ----------------------------------------------------------------------
ENGA_DEIGD      ----------------------------------------------------------------------
OBG_WOLTR       ----------------------------------------------------------------------
OBG_TRIEI       ----------------------------------------------------------------------
OBG_THEFY       ----------------------------------------------------------------------
OBG_STRU0       ----------------------------------------------------------------------
OBG_SORC5       ----------------------------------------------------------------------
OBG_PROMS       ----------------------------------------------------------------------
OBG_MYCH7       ----------------------------------------------------------------------
OBG_MYCH2       ----------------------------------------------------------------------
OBG_HYDS0       ----------------------------------------------------------------------
OBG_HELP2       ----------------------------------------------------------------------
OBG_HELAH       ----------------------------------------------------------------------
OBG_HALHL       ----------------------------------------------------------------------
OBG_CLOPH       ----------------------------------------------------------------------
OBG_CAMLR       ----------------------------------------------------------------------
MNME_SYNFM      ----------------------------------------------------------------------
MNME_HAEIN      ---------------------------------------FSEQAFLNDKLDLAQAEAIADLISEQAVRSA
MNME_BACLD      ----------------------------------------------------------------------
MNME_ANAVT      ----------------------------------------------------------------------
ENGA_RICBR      ----------------------------------------------------------------------
ENGA_PERMH      ----------------------------------------------------------------------
ENGA_GEMAT      ----------------------------------------------------------------------
DRG2_DICDI      ----------------------------------------------------------------------
YLWB_SCHPO      ----------------------------------------------------------------------
OBG_SYNFM       ----------------------------------------------------------------------
OBG_STRTD       ----------------------------------------------------------------------
OBG_STRT2       ----------------------------------------------------------------------
OBG_STRT1       ----------------------------------------------------------------------
OBG_MYXXD       ----------------------------------------------------------------------
OBG_LAWIP       ----------------------------------------------------------------------
OBG_LACBA       ----------------------------------------------------------------------
OBG_GLUOX       ----------------------------------------------------------------------
OBG_FRAAA       ----------------------------------------------------------------------
OBG_DESRM       ----------------------------------------------------------------------
OBG_BACA2       ----------------------------------------------------------------------
MNME_SYNJB      ----------------------------------------------------------------------
MNME_SHEDO      ----------------------------------------------------------------------
MNME_PSESM      ----------------------------------------------------------------------
MNME_PSEA7      ----------------------------------------------------------------------
MNME_PROMA      ---------------------------------------------------------------EFSQRAV
MNME_MARAV      ----------------------------------------------------------------------
MNME_HAEIG      ---------------------------------------FSEQAFLNDKFDLAQAEAIADLISEQAARSA
ERA_THEM4       ----------------------------------------------------------------------
ERA_NITEC       ----------------------------------------------------------------------
ERA_LYSSC       ----------------------------------------------------------------------
ENGA_HELAH      ----------------------------------------------------------------------
ENGA_HAEPS      ----------------------------------------------------------------------
OBG_SINMW       ----------------------------------------------------------------------
OBG_RUBXD       ----------------------------------------------------------------------
OBG_PROVI       ----------------------------------------------------------------------
OBG_PROM0       ----------------------------------------------------------------------
OBG_MESFL       ----------------------------------------------------------------------
OBG_HELPS       ----------------------------------------------------------------------
OBG_FLAPJ       ----------------------------------------------------------------------
OBG_FLAJ1       ----------------------------------------------------------------------
OBG_DEHE1       ----------------------------------------------------------------------
MNME_STAS1      ----------------------------------------------------------------------
MNME_RALEH      ----------------------------------------------------------------------
MNME_PSEU2      ----------------------------------------------------------------------
MNME_HAEIE      ---------------------------------------FSEQAFLNDKLDLAQAEAIADLISEQAARSA
MNME_GLOVI      ----------------------------------------------------------------------
ENGA_PSESM      ----------------------------------------------------------------------
ENGA_PSE14      ----------------------------------------------------------------------
OBG_WOLWR       ----------------------------------------------------------------------
OBG_WOLPM       ----------------------------------------------------------------------
OBG_STAS1       ----------------------------------------------------------------------
OBG_SHESR       ----------------------------------------------------------------------
OBG_SHESM       ----------------------------------------------------------------------
OBG_SHESA       ----------------------------------------------------------------------
OBG_SHEON       ----------------------------------------------------------------------
OBG_RHILW       ----------------------------------------------------------------------
OBG_RHIL3       ----------------------------------------------------------------------
OBG_RHIE6       ----------------------------------------------------------------------
OBG_PROMA       ----------------------------------------------------------------------
OBG_PROM9       ----------------------------------------------------------------------
OBG_PEDPA       ----------------------------------------------------------------------
OBG_MYCMO       ----------------------------------------------------------------------
OBG_METCA       ----------------------------------------------------------------------
OBG_HELHP       ----------------------------------------------------------------------
OBG_ANASP       ----------------------------------------------------------------------
OBG_AGRVS       ----------------------------------------------------------------------
MNME_SYNE7      ----------------------------------------------------------------------
MNME_PSEPF      ----------------------------------------------------------------------
MNME_LISW6      ----------------------------------------------------------------------
MNME_KLEP7      ----------------------------------------------------------------------
MNME_CYAP4      ----------------------------------------------------------------------
MNME_ACTSZ      ----------------------------------------------------------------------
ENGA_THESQ      ----------------------------------------------------------------------
ENGA_CALS8      ----------------------------------------------------------------------
ENGA_BUCAP      ----------------------------------------------------------------------
ENGA_AZOSB      ----------------------------------------------------------------------
Y1326_METJA     ----------------------------------------------------------------------
OBG_UREPA       ----------------------------------------------------------------------
OBG_UREP2       ----------------------------------------------------------------------
OBG_THEEB       ----------------------------------------------------------------------
OBG_STRSY       ----------------------------------------------------------------------
OBG_STRS2       ----------------------------------------------------------------------
OBG_STRMU       ----------------------------------------------------------------------
OBG_RHIME       ----------------------------------------------------------------------
OBG_RHIEC       ----------------------------------------------------------------------
OBG_PROMT       ----------------------------------------------------------------------
OBG_PROM1       ----------------------------------------------------------------------
OBG_MYCCT       ----------------------------------------------------------------------
OBG_HELPG       ----------------------------------------------------------------------
OBG_FINM2       ----------------------------------------------------------------------
OBG_BORRA       ----------------------------------------------------------------------
OBG_BORDL       ----------------------------------------------------------------------
OBG_ANAVT       ----------------------------------------------------------------------
MNME_PSEMY      ----------------------------------------------------------------------
MNME_PSEAE      ----------------------------------------------------------------------
MNME_PSEAB      ----------------------------------------------------------------------
MNME_LISMF      ----------------------------------------------------------------------
MNME_GEOUR      ----------------------------------------------------------------------
MNME_CHLAB      ----------------------------------------------------------------------
ENGA_SHEFN      ----------------------------------------------------------------------
ENGA_RICB8      ----------------------------------------------------------------------
ENGA_PSEE4      ----------------------------------------------------------------------
ENGA_CHLPB      ----------------------------------------------------------------------
ENGA_ARTAT      ----------------------------------------------------------------------
ENGA_ACTPJ      ----------------------------------------------------------------------
YFY7_SCHPO      ----------------------------------------------------------------------
RBG1_YEAST      ----------------------------------------------------------------------
OBG_THERP       ----------------------------------------------------------------------
OBG_STRS7       ----------------------------------------------------------------------
OBG_STRR6       ----------------------------------------------------------------------
OBG_STRPS       ----------------------------------------------------------------------
OBG_STRPN       ----------------------------------------------------------------------
OBG_STRPJ       ----------------------------------------------------------------------
OBG_STRPI       ----------------------------------------------------------------------
OBG_STRP4       ----------------------------------------------------------------------
OBG_STRP2       ----------------------------------------------------------------------
OBG_STREM       ----------------------------------------------------------------------
OBG_PAUCH       ----------------------------------------------------------------------
OBG_MYCMS       ----------------------------------------------------------------------
OBG_HELPJ       ----------------------------------------------------------------------
OBG_CAMJJ       ----------------------------------------------------------------------
OBG_CAMJE       ----------------------------------------------------------------------
MNME_PASMU      ----------------------------------------------------------------------
MNME_MARMS      ----------------------------------------------------------------------
MNME_GEOTN      ----------------------------------------------------------------------
MNME_FRATO      ----------------------------------------------------------------------
MNME_FRATH      ----------------------------------------------------------------------
MNME_FRATF      ----------------------------------------------------------------------
MNME_BURXL      --------------------------------------------QLVLQRCIDAGRAFGLRLAEPGTRRA
MNME_BUCAI      ----------------------------------------------------------------------
ERA_LACCB       ----------------------------------------------------------------------
ERA_LACC3       ----------------------------------------------------------------------
ERA_GEOMG       ----------------------------------------------------------------------
ENGA_TRIEI      ----------------------------------------------------------------------
ENGA_SYNY3      ----------------------------------------------------------------------
ENGA_PSEPW      ----------------------------------------------------------------------
ENGA_MYCAP      ----------------------------------------------------------------------
ENGA_HAEIN      ----------------------------------------------------------------------
ENGA_COREF      ----------------------------------------------------------------------
ENGA_CHLT3      ----------------------------------------------------------------------
OBG_THEYD       ----------------------------------------------------------------------
OBG_STRE4       ----------------------------------------------------------------------
OBG_PELTS       ----------------------------------------------------------------------
OBG_CYTH3       ----------------------------------------------------------------------
OBG_CAMJR       ----------------------------------------------------------------------
OBG_CAMJ8       ----------------------------------------------------------------------
OBG_AZOPC       ----------------------------------------------------------------------
MSS1_YEAST      ----------------------------------------------------------------------
MNME_LISMO      ----------------------------------------------------------------------
MNME_LISIN      ----------------------------------------------------------------------
MNME_FRATW      ----------------------------------------------------------------------
MNME_FRATT      ----------------------------------------------------------------------
MNME_FRATN      ----------------------------------------------------------------------
MNME_FRAT1      ----------------------------------------------------------------------
MNME_AERS4      ----------------------------------------------------------------------
GTPBA_MOUSE     ----------------------------------------------------------------------
ENGA_THEMA      ----------------------------------------------------------------------
ENGA_ACTP7      ----------------------------------------------------------------------
ENGA_ACTP2      ----------------------------------------------------------------------
OBG_STRGC       ----------------------------------------------------------------------
OBG_PROA2       ----------------------------------------------------------------------
OBG_NITSB       ----------------------------------------------------------------------
OBG_LACAC       ----------------------------------------------------------------------
OBG_GEOSF       ----------------------------------------------------------------------
OBG_DEIGD       ----------------------------------------------------------------------
MNME_KLEP3      ----------------------------------------------------------------------
MNME_HAMD5      ----------------------------------------------------------------------
MNME_CLOPH      ----------------------------------------------------------------------
MNME_CHLPN      ----------------------------------------------------------------------
MNME_ACTPJ      ----------------------------------------------------------------------
MNME_ACTP2      ----------------------------------------------------------------------
ENGA_THELT      ----------------------------------------------------------------------
ENGA_SHEDO      ----------------------------------------------------------------------
ENGA_RICRS      ----------------------------------------------------------------------
ENGA_RICRO      ----------------------------------------------------------------------
ENGA_PSEU2      ----------------------------------------------------------------------
OBG_SYNP2       ----------------------------------------------------------------------
OBG_STRSV       ----------------------------------------------------------------------
OBG_LEUCK       ----------------------------------------------------------------------
OBG_LACSS       ----------------------------------------------------------------------
OBG_LACLA       ----------------------------------------------------------------------
OBG_LACH4       ----------------------------------------------------------------------
OBG_GEOBB       ----------------------------------------------------------------------
OBG_ENTFA       ----------------------------------------------------------------------
OBG_CLOK1       ----------------------------------------------------------------------
OBG_CAMJD       ----------------------------------------------------------------------
MNME_YERE8      ----------------------------------------------------------------------
MNME_THETN      ----------------------------------------------------------------------
GTP1_SCHPO      ----------------------------------------------------------------------
ERA_LEUCK       ----------------------------------------------------------------------
ENGA_VIBSL      ----------------------------------------------------------------------
ENGA_RICPU      ----------------------------------------------------------------------
ENGA_RICFE      ----------------------------------------------------------------------
ENGA_RICCN      ----------------------------------------------------------------------
ENGA_RICAE      ----------------------------------------------------------------------
ENGA_PSEF5      ----------------------------------------------------------------------
ENGA_PELCD      ----------------------------------------------------------------------
ENGA_AZOVD      ----------------------------------------------------------------------
ENGA_ALISL      ----------------------------------------------------------------------
OBG_TREPS       ----------------------------------------------------------------------
OBG_TREPA       ----------------------------------------------------------------------
OBG_SULNB       ----------------------------------------------------------------------
OBG_PROM2       ----------------------------------------------------------------------
OBG_OPITP       ----------------------------------------------------------------------
OBG_MYCPN       ----------------------------------------------------------------------
OBG_EXIS2       ----------------------------------------------------------------------
OBG_DEIRA       ----------------------------------------------------------------------
OBG_CAMHC       ----------------------------------------------------------------------
OBG_BUCBP       ----------------------------------------------------------------------
MNME_SYNP6      ----------------------------------------------------------------------
MNME_SHEAM      ----------------------------------------------------------------------
MNME_PSEPG      ----------------------------------------------------------------------
MNME_PECCP      ----------------------------------------------------------------------
MNME_HAES1      ----------------------------------------------------------------------
MNME_DESAP      ----------------------------------------------------------------------
MNME_CHLTR      ----------------------------------------------------------------------
MNME_CHLTB      ----------------------------------------------------------------------
MNME_CHLTA      ----------------------------------------------------------------------
MNME_CHLT2      ----------------------------------------------------------------------
MNME_BORGA      ----------------------------------------------------------------------
MNME_BACSK      ----------------------------------------------------------------------
MNME_ALKMQ      ----------------------------------------------------------------------
MNME_AERHH      ----------------------------------------------------------------------
ERA_GEOSF       ----------------------------------------------------------------------
ERA_EHRCJ       ----------------------------------------------------------------------
ENGA_XYLFT      ----------------------------------------------------------------------
ENGA_XYLF2      ----------------------------------------------------------------------
ENGA_THEP1      ----------------------------------------------------------------------
ENGA_THENN      ----------------------------------------------------------------------
ENGA_PARD8      ----------------------------------------------------------------------
ENGA_CHLAD      ----------------------------------------------------------------------
ENGA_CAMFF      ----------------------------------------------------------------------
ENGA_AZOPC      ----------------------------------------------------------------------
OBG_SYNS3       ----------------------------------------------------------------------
OBG_PROMP       ----------------------------------------------------------------------
OBG_PROM5       ----------------------------------------------------------------------
OBG_LACRJ       ----------------------------------------------------------------------
OBG_LACRD       ----------------------------------------------------------------------
OBG_GRAFK       ----------------------------------------------------------------------
OBG_CLOAB       ----------------------------------------------------------------------
MNME_YERP3      ----------------------------------------------------------------------
MNME_SHIFL      ----------------------------------------------------------------------
MNME_SHIF8      ----------------------------------------------------------------------
MNME_LEPIC      ----------------------------------------------------------------------
MNME_GEOSL      ----------------------------------------------------------------------
MNME_CHLFF      ----------------------------------------------------------------------
MNME_BACCR      ----------------------------------------------------------------------
MNME_ALCBS      ---------------DMLVATCIEAGARQARAGEFSQRAFLNDKMEAIADLIDAGTAASARAALHSLQGV
ERA_LACLS       ----------------------------------------------------------------------
ERA_LACLM       ----------------------------------------------------------------------
ERA_LACLA       ----------------------------------------------------------------------
ERA_GEOLS       ----------------------------------------------------------------------
ENGA_PSEPF      ----------------------------------------------------------------------
ENGA_NITSB      ----------------------------------------------------------------------
ENGA_HELHP      ----------------------------------------------------------------------
ENGA_CLOCE      ----------------------------------------------------------------------
DRG2_MOUSE      ----------------------------------------------------------------------
OBG_STAAW       ----------------------------------------------------------------------
OBG_STAAT       ----------------------------------------------------------------------
OBG_STAAS       ----------------------------------------------------------------------
OBG_STAAR       ----------------------------------------------------------------------
OBG_STAAN       ----------------------------------------------------------------------
OBG_STAAM       ----------------------------------------------------------------------
OBG_STAAE       ----------------------------------------------------------------------
OBG_STAAC       ----------------------------------------------------------------------
OBG_STAAB       ----------------------------------------------------------------------
OBG_STAA9       ----------------------------------------------------------------------
OBG_STAA8       ----------------------------------------------------------------------
OBG_STAA3       ----------------------------------------------------------------------
OBG_STAA2       ----------------------------------------------------------------------
OBG_STAA1       ----------------------------------------------------------------------
OBG_PELUB       ----------------------------------------------------------------------
OBG_METPP       ----------------------------------------------------------------------
OBG_GEOUR       ----------------------------------------------------------------------
MNME_THEP1      ----------------------------------------------------------------------
MNME_SYNAS      -------------------------------------------------------------------RRA
MNME_STRPM      ----------------------------------------------------------------------
MNME_ECO7I      ----------------------------------------------------------------------
MNME_CHLMU      ----------------------------------------------------------------------
MNME_BACWK      ----------------------------------------------------------------------
MNME_BACCN      ----------------------------------------------------------------------
ERA_ELUMP       ----------------------------------------------------------------------
ERA_EHRCR       ----------------------------------------------------------------------
ERA_CALS8       ----------------------------------------------------------------------
ENGA_VIBFM      ----------------------------------------------------------------------
ENGA_VIBF1      ----------------------------------------------------------------------
ENGA_SYMTH      ----------------------------------------------------------------------
ENGA_PSEPK      ----------------------------------------------------------------------
ENGA_PSEPG      ----------------------------------------------------------------------
ENGA_PSEP1      ----------------------------------------------------------------------
ENGA_PHOPR      ----------------------------------------------------------------------
ENGA_MYCPN      ----------------------------------------------------------------------
ENGA_HERA2      ----------------------------------------------------------------------
ENGA_GEOLS      ----------------------------------------------------------------------
DRG1_MOUSE      ----------------------------------------------------------------------
DRG1_HUMAN      ----------------------------------------------------------------------
DRG1_BOVIN      ----------------------------------------------------------------------
OBG_SYNR3       ----------------------------------------------------------------------
OBG_STAHJ       ----------------------------------------------------------------------
OBG_MYCPU       ----------------------------------------------------------------------
OBG_LACPL       ----------------------------------------------------------------------
OBG_CAMC1       ----------------------------------------------------------------------
MNME_YERPY      ----------------------------------------------------------------------
MNME_YERPS      ----------------------------------------------------------------------
MNME_YERPP      ----------------------------------------------------------------------
MNME_YERPN      ----------------------------------------------------------------------
MNME_YERPG      ----------------------------------------------------------------------
MNME_YERPE      ----------------------------------------------------------------------
MNME_YERPB      ----------------------------------------------------------------------
MNME_YERPA      ----------------------------------------------------------------------
MNME_THELT      ----------------------------------------------------------------------
MNME_STRPC      ----------------------------------------------------------------------
MNME_SHISS      ----------------------------------------------------------------------
MNME_SHIDS      ----------------------------------------------------------------------
MNME_SHIBS      ----------------------------------------------------------------------
MNME_SHIB3      ----------------------------------------------------------------------
MNME_PSYIN      ----------------------------------------------------------------------
MNME_PSEPU      ----------------------------------------------------------------------
MNME_PSEPK      ----------------------------------------------------------------------
MNME_PSEP1      ----------------------------------------------------------------------
MNME_NITEC      ------------------------------------------------------GPAVMNLLLTRCLQLP
MNME_HERAR      ----------------------------------------------------------------------
MNME_ESCF3      ----------------------------------------------------------------------
MNME_ERWCT      ----------------------------------------------------------------------
MNME_ECOSM      ----------------------------------------------------------------------
MNME_ECOSE      ----------------------------------------------------------------------
MNME_ECOLU      ----------------------------------------------------------------------
MNME_ECOLI      ----------------------------------------------------------------------
MNME_ECOLC      ----------------------------------------------------------------------
MNME_ECOHS      ----------------------------------------------------------------------
MNME_ECODH      ----------------------------------------------------------------------
MNME_ECOBW      ----------------------------------------------------------------------
MNME_ECO8A      ----------------------------------------------------------------------
MNME_ECO81      ----------------------------------------------------------------------
MNME_ECO5E      ----------------------------------------------------------------------
MNME_ECO57      ----------------------------------------------------------------------
MNME_ECO55      ----------------------------------------------------------------------
MNME_ECO27      ----------------------------------------------------------------------
MNME_ECO24      ----------------------------------------------------------------------
ERA_THEAB       ----------------------------------------------------------------------
ERA_PEDPA       ----------------------------------------------------------------------
ERA_BRUME       ----------------------------------------------------------------------
ERA_ANATD       ----------------------------------------------------------------------
ENGA_STRSY      ----------------------------------------------------------------------
ENGA_STRS2      ----------------------------------------------------------------------
ENGA_RICCK      ----------------------------------------------------------------------
ENGA_MICAN      ----------------------------------------------------------------------
DRG1_XENLA      ----------------------------------------------------------------------
OBG_STAES       ----------------------------------------------------------------------
OBG_STAEQ       ----------------------------------------------------------------------
OBG_LACLS       ----------------------------------------------------------------------
OBG_LACLM       ----------------------------------------------------------------------
OBG_DEHSC       ----------------------------------------------------------------------
OBG_DEHSB       ----------------------------------------------------------------------
MNME_SYNWW      ----------------------------------------------------------------------
MNME_STAHJ      ----------------------------------------------------------------------
MNME_SHESH      ----------------------------------------------------------------------
MNME_SHELP      ----------------------------------------------------------------------
MNME_SHEB9      ----------------------------------------------------------------------
MNME_SHEB8      ----------------------------------------------------------------------
MNME_SHEB5      ----------------------------------------------------------------------
MNME_SACD2      ----------------------------------------------------------------------
MNME_PSEHT      ----------------------------------------------------------------------
MNME_PARUW      ----------------------------------------------------------------------
MNME_METCA      ----------------------------------------------------------------------
MNME_HELMI      ----------------------------------------------------------------------
MNME_HAES2      ----------------------------------------------------------------------
MNME_ANAMM      ----------------------------------------------------------------------
ERA_THETN       ----------------------------------------------------------------------
ERA_THEPX       ----------------------------------------------------------------------
ERA_THEP3       ----------------------------------------------------------------------
ERA_BRUSU       ----------------------------------------------------------------------
ENGA_PSEU5      ----------------------------------------------------------------------
ENGA_PSEAE      ----------------------------------------------------------------------
ENGA_PSEAB      ----------------------------------------------------------------------
ENGA_PSEA8      ----------------------------------------------------------------------
ENGA_PSEA7      ----------------------------------------------------------------------
ENGA_PELPD      ----------------------------------------------------------------------
ENGA_OCHA4      ----------------------------------------------------------------------
ENGA_BIFLO      ----------------------------------------------------------------------
ENGA_AZOSE      ----------------------------------------------------------------------
OBG_WOLPP       ----------------------------------------------------------------------
OBG_LACF3       ----------------------------------------------------------------------
OBG_ERYLH       ----------------------------------------------------------------------
OBG_CLOBB       ----------------------------------------------------------------------
OBG_CAMC5       ----------------------------------------------------------------------
MNME_STRP1      ----------------------------------------------------------------------
MNME_STAES      ----------------------------------------------------------------------
MNME_STAEQ      ----------------------------------------------------------------------
MNME_SHESR      ----------------------------------------------------------------------
MNME_SHESM      ----------------------------------------------------------------------
MNME_PSEE4      ----------------------------------------------------------------------
MNME_PROMH      ----------------------------------------------------------------------
MNME_FRAP2      ----------------------------------------------------------------------
MNME_DESRM      ----------------------------------------------------------------------
ERA_CLOPS       ----------------------------------------------------------------------
ERA_CLOPE       ----------------------------------------------------------------------
ENGA_PROMH      ----------------------------------------------------------------------
ENGA_PASMU      ----------------------------------------------------------------------
ENGA_LEGPL      ----------------------------------------------------------------------
ENGA_GEOSL      ----------------------------------------------------------------------
ENGA_ERWT9      ----------------------------------------------------------------------
ENGA_DESAH      ----------------------------------------------------------------------
ENGA_DECAR      ----------------------------------------------------------------------
ENGA_COXB2      ----------------------------------------------------------------------
ENGA_CORGL      ----------------------------------------------------------------------
ENGA_CHLSY      ----------------------------------------------------------------------
ENGA_CHLAA      ----------------------------------------------------------------------
ENGA_AMOA5      ----------------------------------------------------------------------
OBG_SULMW       ----------------------------------------------------------------------
OBG_CLOBA       ----------------------------------------------------------------------
MNME_THEPX      ----------------------------------------------------------------------
MNME_THEP3      ----------------------------------------------------------------------
MNME_STRPG      ----------------------------------------------------------------------
MNME_STRPD      ----------------------------------------------------------------------
MNME_STRP8      ----------------------------------------------------------------------
MNME_STRP3      ----------------------------------------------------------------------
MNME_PELTS      ----------------------------------------------------------------------
MNME_NATTJ      ----------------------------------------------------------------------
MNME_ERWT9      ----------------------------------------------------------------------
MNME_BORAP      ----------------------------------------------------------------------
MNME_BDEBA      ----------------------------------------------------------------------
MNME_ALHEH      ----------------------------------------------------------------------
ERA_RHIME       ----------------------------------------------------------------------
ERA_FUSNN       ----------------------------------------------------------------------
ERA_ALKOO       ----------------------------------------------------------------------
ENGA_YERPY      ----------------------------------------------------------------------
ENGA_YERPS      ----------------------------------------------------------------------
ENGA_YERPP      ----------------------------------------------------------------------
ENGA_YERPN      ----------------------------------------------------------------------
ENGA_YERPG      ----------------------------------------------------------------------
ENGA_YERPE      ----------------------------------------------------------------------
ENGA_YERPB      ----------------------------------------------------------------------
ENGA_YERPA      ----------------------------------------------------------------------
ENGA_YERP3      ----------------------------------------------------------------------
ENGA_SERP5      ----------------------------------------------------------------------
ENGA_RICTY      ----------------------------------------------------------------------
ENGA_ENTS8      ----------------------------------------------------------------------
ENGA_COXBU      ----------------------------------------------------------------------
ENGA_COXBR      ----------------------------------------------------------------------
ENGA_COXBN      ----------------------------------------------------------------------
ENGA_COXB1      ----------------------------------------------------------------------
ENGA_ACIB5      ----------------------------------------------------------------------
OBG_SYNPX       ----------------------------------------------------------------------
OBG_SYNPW       ----------------------------------------------------------------------
OBG_PROMM       ----------------------------------------------------------------------
OBG_PROM3       ----------------------------------------------------------------------
OBG_MYCA5       ----------------------------------------------------------------------
OBG_LEPBP       ----------------------------------------------------------------------
OBG_LEPBA       ----------------------------------------------------------------------
OBG_CHLTR       ----------------------------------------------------------------------
OBG_CHLTB       ----------------------------------------------------------------------
OBG_CHLTA       ----------------------------------------------------------------------
OBG_CHLT2       ----------------------------------------------------------------------
MNME_SHESW      ----------------------------------------------------------------------
MNME_SHESA      ----------------------------------------------------------------------
MNME_SHEPC      ----------------------------------------------------------------------
MNME_SHEPA      ----------------------------------------------------------------------
MNME_SHEON      ----------------------------------------------------------------------
MNME_SHEHH      ----------------------------------------------------------------------
MNME_PSEPW      ----------------------------------------------------------------------
MNME_PSEF5      ----------------------------------------------------------------------
MNME_CITK8      ----------------------------------------------------------------------
MNME_CHRSD      ----------------------------------------------------------------------
MNME_BACHK      ----------------------------------------------------------------------
MNME_BACCZ      ----------------------------------------------------------------------
MNME_BACAN      ----------------------------------------------------------------------
MNME_BACAH      ----------------------------------------------------------------------
FEOB_METJA      ----------------------------------------------------------------------
ERA_PASMU       ----------------------------------------------------------------------
ERA_LEUMM       ----------------------------------------------------------------------
ERA_CLOK5       ----------------------------------------------------------------------
ERA_CLOK1       ----------------------------------------------------------------------
ENGA_STRPZ      ----------------------------------------------------------------------
ENGA_STRPM      ----------------------------------------------------------------------
ENGA_STRPF      ----------------------------------------------------------------------
ENGA_STRPD      ----------------------------------------------------------------------
ENGA_STRPC      ----------------------------------------------------------------------
ENGA_STRPB      ----------------------------------------------------------------------
ENGA_STRP8      ----------------------------------------------------------------------
ENGA_STRP6      ----------------------------------------------------------------------
ENGA_STRP3      ----------------------------------------------------------------------
ENGA_STRP1      ----------------------------------------------------------------------
ENGA_NITEC      ----------------------------------------------------------------------
ENGA_LEGPH      ----------------------------------------------------------------------
ENGA_KLEP7      ----------------------------------------------------------------------
ENGA_HAHCH      ----------------------------------------------------------------------
ENGA_GEOUR      ----------------------------------------------------------------------
ENGA_FUSNN      ----------------------------------------------------------------------
ENGA_CYAP7      ----------------------------------------------------------------------
ENGA_BAUCH      ----------------------------------------------------------------------
ENGA_ALTMD      ----------------------------------------------------------------------
128UP_DROME     ----------------------------------------------------------------------
OBG_WIGBR       ----------------------------------------------------------------------
OBG_TROWT       ----------------------------------------------------------------------
OBG_TROW8       ----------------------------------------------------------------------
OBG_SYNS9       ----------------------------------------------------------------------
OBG_NAUPA       ----------------------------------------------------------------------
OBG_HYPNA       ----------------------------------------------------------------------
OBG_CHLMU       ----------------------------------------------------------------------
OBG_ARCB4       ----------------------------------------------------------------------
MNME_STRPF      ----------------------------------------------------------------------
MNME_PSEU5      ----------------------------------------------------------------------
MNME_PELUB      ----------------------------------------------------------------------
MNME_NITEU      ------------------------------------------------------GPAVMNLLLDRCLQLP
MNME_LEPIN      ----------------------------------------------------------------------
MNME_HELPJ      ----------------------------------------------------------------------
MNME_ENT38      ----------------------------------------------------------------------
MNME_ECOUT      ----------------------------------------------------------------------
MNME_ECOL6      ----------------------------------------------------------------------
MNME_ECOL5      ----------------------------------------------------------------------
MNME_ECOK1      ----------------------------------------------------------------------
MNME_ECO45      ----------------------------------------------------------------------
MNME_CLOAB      ----------------------------------------------------------------------
ERA_RICAH       ----------------------------------------------------------------------
ERA_LACS1       ----------------------------------------------------------------------
ERA_HELMI       ----------------------------------------------------------------------
ERA_EHRRW       ----------------------------------------------------------------------
ERA_CLOCE       ----------------------------------------------------------------------
ENGA_STRU0      ----------------------------------------------------------------------
ENGA_STRPG      ----------------------------------------------------------------------
ENGA_PROVI      ----------------------------------------------------------------------
ENGA_NITEU      ----------------------------------------------------------------------
ENGA_MESFL      ----------------------------------------------------------------------
ENGA_LEGPC      ----------------------------------------------------------------------
ENGA_LEGPA      ----------------------------------------------------------------------
ENGA_HELMI      ----------------------------------------------------------------------
ENGA_GEOSF      ----------------------------------------------------------------------
ENGA_FLAJ1      ----------------------------------------------------------------------
ENGA_CELJU      ----------------------------------------------------------------------
ENGA_BRASO      ----------------------------------------------------------------------
ENGA_ACIF5      ----------------------------------------------------------------------
ENGA_ACIF2      ----------------------------------------------------------------------
OBG_CHLCV       ----------------------------------------------------------------------
MNME_STRP6      ----------------------------------------------------------------------
MNME_SHEWM      ----------------------------------------------------------------------
MNME_NITMU      ----------------------------------------------------------------------
MNME_LYSSC      ----------------------------------------------------------------------
MNME_ENTS8      ----------------------------------------------------------------------
MNME_CHRVO      ----------------------------------------------------------------------
MNME_BORBZ      ----------------------------------------------------------------------
MNME_BORBU      ----------------------------------------------------------------------
MNME_AZOSE      ----------------------------------------------------------------------
FEOB_LEGPN      ----------------------------------------------------------------------
FEOB_LEGPL      ----------------------------------------------------------------------
FEOB_LEGPH      ----------------------------------------------------------------------
FEOB_LEGPA      ----------------------------------------------------------------------
ERA_STAAW       ----------------------------------------------------------------------
ERA_STAAT       ----------------------------------------------------------------------
ERA_STAAS       ----------------------------------------------------------------------
ERA_STAAR       ----------------------------------------------------------------------
ERA_STAAN       ----------------------------------------------------------------------
ERA_STAAM       ----------------------------------------------------------------------
ERA_STAAE       ----------------------------------------------------------------------
ERA_STAAC       ----------------------------------------------------------------------
ERA_STAAB       ----------------------------------------------------------------------
ERA_STAA9       ----------------------------------------------------------------------
ERA_STAA3       ----------------------------------------------------------------------
ERA_STAA2       ----------------------------------------------------------------------
ERA_STAA1       ----------------------------------------------------------------------
ERA_OLICO       ----------------------------------------------------------------------
ERA_HAES2       ----------------------------------------------------------------------
ERA_HAES1       ----------------------------------------------------------------------
ERA_CLOP1       ----------------------------------------------------------------------
ERA_AQUAE       ----------------------------------------------------------------------
ENGA_VIBVY      ----------------------------------------------------------------------
ENGA_VIBVU      ----------------------------------------------------------------------
ENGA_SHESW      ----------------------------------------------------------------------
ENGA_SHEPC      ----------------------------------------------------------------------
ENGA_RICPR      ----------------------------------------------------------------------
ENGA_BORAP      ----------------------------------------------------------------------
ENGA_ACIBY      ----------------------------------------------------------------------
ENGA_ACIBT      ----------------------------------------------------------------------
ENGA_ACIBS      ----------------------------------------------------------------------
ENGA_ACIBC      ----------------------------------------------------------------------
ENGA_ACIB3      ----------------------------------------------------------------------
OBG_NOVAD       ----------------------------------------------------------------------
OBG_CAMFF       ----------------------------------------------------------------------
MNME_THESQ      ----------------------------------------------------------------------
MNME_THEMA      ----------------------------------------------------------------------
MNME_SERP5      ----------------------------------------------------------------------
MNME_JANMA      ----------------------------------------------------------------------
MNME_IDILO      ----------------------------------------------------------------------
MNME_GLUOX      ----------------------------------------------------------------------
MNME_EHRCJ      ----------------------------------------------------------------------
MNME_BURVG      --------------------------------------------QLLLQRCLDAGRGFGLRLAEPGTRRA
MNME_BUCBP      ----------------------------------------------------------------------
MNME_BUCAP      ----------------------------------------------------------------------
MNME_BACC1      ----------------------------------------------------------------------
MNME_ACIBL      ----------------------------------------------------------------------
ERA_SINMW       ----------------------------------------------------------------------
ERA_MARMM       ----------------------------------------------------------------------
ERA_HALOH       ----------------------------------------------------------------------
ERA_HAEIN       ----------------------------------------------------------------------
ERA_CLOBL       ----------------------------------------------------------------------
ERA_CLOBA       ----------------------------------------------------------------------
ENGA_THIDA      ----------------------------------------------------------------------
ENGA_THERP      ----------------------------------------------------------------------
ENGA_STRGC      ----------------------------------------------------------------------
ENGA_SHESR      ----------------------------------------------------------------------
ENGA_SHESM      ----------------------------------------------------------------------
ENGA_SHESH      ----------------------------------------------------------------------
ENGA_SHESA      ----------------------------------------------------------------------
ENGA_SHEON      ----------------------------------------------------------------------
ENGA_RICAH      ----------------------------------------------------------------------
ENGA_NOSP7      ----------------------------------------------------------------------
ENGA_GEOSM      ----------------------------------------------------------------------
ENGA_ALCBS      ----------------------------------------------------------------------
MNME_VIBVY      ---------------DMLIKRILTISGVRPARGEFSERAFLNDKMEAIADLIDASSEEAAKSALQSLQGQ
MNME_VIBVU      ---------------DMLIKRILTISGVRPARGEFSERAFLNDKMEAIADLIDASSEEAAKSALQSLQGQ
MNME_STAAW      ----------------------------------------------------------------------
MNME_STAAT      ----------------------------------------------------------------------
MNME_STAAS      ----------------------------------------------------------------------
MNME_STAAR      ----------------------------------------------------------------------
MNME_STAAN      ----------------------------------------------------------------------
MNME_STAAE      ----------------------------------------------------------------------
MNME_STAAC      ----------------------------------------------------------------------
MNME_STAAB      ----------------------------------------------------------------------
MNME_STAA9      ----------------------------------------------------------------------
MNME_STAA8      ----------------------------------------------------------------------
MNME_STAA3      ----------------------------------------------------------------------
MNME_STAA2      ----------------------------------------------------------------------
MNME_PSEA6      ----------------------------------------------------------------------
MNME_COLP3      ---------------------------------------FSEQAFLNDKLDLTQAEAIADLINEQAARSA
MNME_CLOTE      ----------------------------------------------------------------------
MNME_BUCCC      ----------------------------------------------------------------------
ERA_STRSY       ----------------------------------------------------------------------
ERA_STRS2       ----------------------------------------------------------------------
ERA_ERYLH       ----------------------------------------------------------------------
ENGA_WOLSU      ----------------------------------------------------------------------
ENGA_THEEB      ----------------------------------------------------------------------
ENGA_SYNS9      ----------------------------------------------------------------------
ENGA_STRMU      ----------------------------------------------------------------------
ENGA_PECCP      ----------------------------------------------------------------------
ENGA_NITHX      ----------------------------------------------------------------------
ENGA_NATTJ      ----------------------------------------------------------------------
ENGA_MYCPE      ----------------------------------------------------------------------
ENGA_LACLA      ----------------------------------------------------------------------
ENGA_GEOBB      ----------------------------------------------------------------------
OBG_MYCPE       ----------------------------------------------------------------------
MNME_VIBPA      ----------------------------------------------------------------------
MNME_VIBHB      ----------------------------------------------------------------------
MNME_VIBCH      ----------------------------------------------------------------------
MNME_VIBC3      ----------------------------------------------------------------------
MNME_SYNR3      ----------------------------------------------------------------------
MNME_SYMTH      ----------------------------------------------------------------------
MNME_SODGM      ----------------------------------------------------------------------
MNME_SALTY      ----------------------------------------------------------------------
MNME_SALTI      ----------------------------------------------------------------------
MNME_SALSV      ----------------------------------------------------------------------
MNME_SALPK      ----------------------------------------------------------------------
MNME_SALPC      ----------------------------------------------------------------------
MNME_SALPB      ----------------------------------------------------------------------
MNME_SALPA      ----------------------------------------------------------------------
MNME_SALNS      ----------------------------------------------------------------------
MNME_SALG2      ----------------------------------------------------------------------
MNME_SALEP      ----------------------------------------------------------------------
MNME_SALCH      ----------------------------------------------------------------------
MNME_SALAR      ----------------------------------------------------------------------
MNME_RALSO      ----------------------------------------------------------------------
MNME_PHOPR      ----------------------------------------------------------------------
FEOB_SYNY3      ----------------------------------------------------------------------
ERA_STRSV       ----------------------------------------------------------------------
ERA_STRGC       ----------------------------------------------------------------------
ERA_PSEPF       ----------------------------------------------------------------------
ERA_HAEPS       ----------------------------------------------------------------------
ERA_EHRRG       ----------------------------------------------------------------------
ERA_CLOB8       ----------------------------------------------------------------------
ENGB_PELLD      ----------------------------------------------------------------------
ENGA_STRZT      ----------------------------------------------------------------------
ENGA_STRZP      ----------------------------------------------------------------------
ENGA_STRZJ      ----------------------------------------------------------------------
ENGA_STRR6      ----------------------------------------------------------------------
ENGA_STRPS      ----------------------------------------------------------------------
ENGA_STRPN      ----------------------------------------------------------------------
ENGA_STRPJ      ----------------------------------------------------------------------
ENGA_STRPI      ----------------------------------------------------------------------
ENGA_STRP7      ----------------------------------------------------------------------
ENGA_STRP4      ----------------------------------------------------------------------
ENGA_STRP2      ----------------------------------------------------------------------
ENGA_SHEB9      ----------------------------------------------------------------------
ENGA_SHEB8      ----------------------------------------------------------------------
ENGA_SHEB5      ----------------------------------------------------------------------
ENGA_SHEB2      ----------------------------------------------------------------------
ENGA_PSEA6      ----------------------------------------------------------------------
ENGA_LACLS      ----------------------------------------------------------------------
ENGA_LACLM      ----------------------------------------------------------------------
ENGA_FLAPJ      ----------------------------------------------------------------------
ENGA_CLOBL      ----------------------------------------------------------------------
ENGA_CLOBJ      ----------------------------------------------------------------------
ENGA_CHRSD      ----------------------------------------------------------------------
ENGA_BRUO2      ----------------------------------------------------------------------
ENGA_BRASB      ----------------------------------------------------------------------
ENGA_BORBU      ----------------------------------------------------------------------
RHEB1_CAEEL     ----------------------------------------------------------------------
MTG2_YEAST      ----------------------------------------------------------------------
MNME_MARMM      ----------------------------------------------------------------------
MNME_LACBA      ----------------------------------------------------------------------
MNME_HELPH      ----------------------------------------------------------------------
ERA_STRU0       ----------------------------------------------------------------------
ERA_ENT38       ----------------------------------------------------------------------
ERA_ALKMQ       ----------------------------------------------------------------------
ENGA_STRA5      ----------------------------------------------------------------------
ENGA_STRA1      ----------------------------------------------------------------------
ENGA_SHEWM      ----------------------------------------------------------------------
ENGA_NITMU      ----------------------------------------------------------------------
ENGA_DESRM      ----------------------------------------------------------------------
ENGA_CYAA5      ----------------------------------------------------------------------
ENGA_CLOBM      ----------------------------------------------------------------------
ENGA_CLOBK      ----------------------------------------------------------------------
ENGA_CHRVO      ----------------------------------------------------------------------
ENGA_BRUSU      ----------------------------------------------------------------------
ENGA_BRUME      ----------------------------------------------------------------------
ENGA_BRUMB      ----------------------------------------------------------------------
ENGA_BRUC2      ----------------------------------------------------------------------
ENGA_BRUAB      ----------------------------------------------------------------------
ENGA_BRUA2      ----------------------------------------------------------------------
ENGA_BRUA1      ----------------------------------------------------------------------
ENGA_BORGA      ----------------------------------------------------------------------
MNME_VIBF1      ----------------------------------------------------------------------
MNME_RHOPB      ----------------------------------------------------------------------
MNME_POLSQ      ---------------------------------------------LVMKRCLELGKALGLVIAEFTLRAY
MNME_FUSNN      ----------------------------------------------------------------------
MNME_BURCM      ----------------------------------------------------------------------
MNME_BARHE      ----------------------------------------------------------------------
MNME_AZOC5      ----------------------------------------------------------------------
MNME_AMOA5      ----------------------------------------------------------------------
ERA_STRPZ       ----------------------------------------------------------------------
ERA_STRPM       ----------------------------------------------------------------------
ERA_STRPG       ----------------------------------------------------------------------
ERA_STRPF       ----------------------------------------------------------------------
ERA_STRPD       ----------------------------------------------------------------------
ERA_STRPC       ----------------------------------------------------------------------
ERA_STRPB       ----------------------------------------------------------------------
ERA_STRP9       ----------------------------------------------------------------------
ERA_STRP8       ----------------------------------------------------------------------
ERA_STRP6       ----------------------------------------------------------------------
ERA_STRP3       ----------------------------------------------------------------------
ERA_STRP1       ----------------------------------------------------------------------
ERA_STRE4       ----------------------------------------------------------------------
ERA_STRA5       ----------------------------------------------------------------------
ERA_STRA3       ----------------------------------------------------------------------
ERA_STRA1       ----------------------------------------------------------------------
ERA_RHILO       ----------------------------------------------------------------------
ERA_ENTS8       ----------------------------------------------------------------------
ERA_CLOBH       ----------------------------------------------------------------------
ERA_CLOBB       ----------------------------------------------------------------------
ERA_CLOB1       ----------------------------------------------------------------------
ENGA_STRTD      ----------------------------------------------------------------------
ENGA_SILST      ----------------------------------------------------------------------
ENGA_PROM4      ----------------------------------------------------------------------
ENGA_POLSJ      ----------------------------------------------------------------------
ENGA_MARMS      ----------------------------------------------------------------------
ENGA_GRAFK      ----------------------------------------------------------------------
ENGA_BACHD      ----------------------------------------------------------------------
OBG_CHLPN       ----------------------------------------------------------------------
MNME_STRGC      ----------------------------------------------------------------------
MNME_RHOFD      ----------------------------------------------------------------------
MNME_LAWIP      ----------------------------------------------------------------------
MNME_HELPY      ----------------------------------------------------------------------
MNME_EHRRG      ----------------------------------------------------------------------
MNME_CLOBM      ----------------------------------------------------------------------
MNME_CLOBK      ----------------------------------------------------------------------
MNME_CLOBH      ----------------------------------------------------------------------
MNME_CLOB1      ----------------------------------------------------------------------
MNME_BURPS      ----------------------------------------------------------------------
MNME_BURP6      ----------------------------------------------------------------------
MNME_BURP1      ----------------------------------------------------------------------
MNME_BURP0      ----------------------------------------------------------------------
MNME_BURMS      ----------------------------------------------------------------------
MNME_BURMA      ----------------------------------------------------------------------
MNME_BURM9      ----------------------------------------------------------------------
MNME_BURM7      ----------------------------------------------------------------------
MNME_AYWBP      ----------------------------------------------------------------------
MNME_ACHLI      ----------------------------------------------------------------------
GTPB8_HUMAN     ----------------------------------------------------------------------
ERA_XYLFT       ----------------------------------------------------------------------
ERA_XYLF2       ----------------------------------------------------------------------
ERA_STREM       ----------------------------------------------------------------------
ERA_RICBR       ----------------------------------------------------------------------
ERA_RICB8       ----------------------------------------------------------------------
ERA_RALSO       ----------------------------------------------------------------------
ERA_PSEAE       ----------------------------------------------------------------------
ERA_PSEAB       ----------------------------------------------------------------------
ERA_PSEA8       ----------------------------------------------------------------------
ERA_CLOD6       ----------------------------------------------------------------------
ERA_CLOBM       ----------------------------------------------------------------------
ERA_CLOBK       ----------------------------------------------------------------------
ERA_CLOBJ       ----------------------------------------------------------------------
ERA_CLOB6       ----------------------------------------------------------------------
ENGA_TERTT      ----------------------------------------------------------------------
ENGA_STAS1      ----------------------------------------------------------------------
ENGA_SHELP      ----------------------------------------------------------------------
ENGA_NEIMF      ----------------------------------------------------------------------
ENGA_NEIMB      ----------------------------------------------------------------------
ENGA_NEIMA      ----------------------------------------------------------------------
ENGA_MYXXD      ----------------------------------------------------------------------
ENGA_MARAV      ----------------------------------------------------------------------
ENGA_LEPIN      ----------------------------------------------------------------------
ENGA_LACC3      ----------------------------------------------------------------------
ENGA_CLOTE      ----------------------------------------------------------------------
ENGA_CLOB8      ----------------------------------------------------------------------
MNME_RHILO      ----------------------------------------------------------------------
MNME_MAGSM      ----------------------------------------------------------------------
MNME_LACPL      ----------------------------------------------------------------------
MNME_HELPS      ----------------------------------------------------------------------
MNME_BURTA      --------------------------------------------QLVLQRCLDAGRAYGLRLAEPGTRRA
ERA_PSEPK       ----------------------------------------------------------------------
ERA_PSEPG       ----------------------------------------------------------------------
ERA_PSEP1       ----------------------------------------------------------------------
ERA_LACDB       ----------------------------------------------------------------------
ERA_LACDA       ----------------------------------------------------------------------
ENGA_THEM4      ----------------------------------------------------------------------
ENGA_STRSV      ----------------------------------------------------------------------
ENGA_STAAT      ----------------------------------------------------------------------
ENGA_STAA3      ----------------------------------------------------------------------
ENGA_PROM5      ----------------------------------------------------------------------
ENGA_METCA      ----------------------------------------------------------------------
ENGA_MESSB      ----------------------------------------------------------------------
ENGA_MAGSA      ----------------------------------------------------------------------
ENGA_LACCB      ----------------------------------------------------------------------
ENGA_CLOBH      ----------------------------------------------------------------------
ENGA_CLOB6      ----------------------------------------------------------------------
ENGA_CLOB1      ----------------------------------------------------------------------
ENGA_CAMJD      ----------------------------------------------------------------------
ENGA_BRUSI      ----------------------------------------------------------------------
ENGA_AQUAE      ----------------------------------------------------------------------
MNME_STAAM      ----------------------------------------------------------------------
MNME_STAA1      ----------------------------------------------------------------------
MNME_NEIMF      ----------------------------------------------------------------------
MNME_NEIMB      ----------------------------------------------------------------------
MNME_NEIMA      ----------------------------------------------------------------------
MNME_NEIM0      ----------------------------------------------------------------------
MNME_NEIG2      ----------------------------------------------------------------------
MNME_NEIG1      ----------------------------------------------------------------------
MNME_MYCMS      ----------------------------------------------------------------MALRGE
MNME_MYCCT      ----------------------------------------------------------------MALRGE
MNME_LEPBP      ----------------------------------------------------------------------
MNME_LEPBA      ----------------------------------------------------------------------
MNME_HELAH      ----------------------------------------------------------------------
MNME_EHRRW      ----------------------------------------------------------------------
MNME_DESDG      ----------------------------------------------------------------------
MNME_CAMC5      ----------------------------------------------------------------------
MNME_BURA4      ----------------------------------------------------------------------
ERA_STRZT       ----------------------------------------------------------------------
ERA_STRZP       ----------------------------------------------------------------------
ERA_STRZJ       ----------------------------------------------------------------------
ERA_STRR6       ----------------------------------------------------------------------
ERA_STRPS       ----------------------------------------------------------------------
ERA_STRPN       ----------------------------------------------------------------------
ERA_STRPJ       ----------------------------------------------------------------------
ERA_STRPI       ----------------------------------------------------------------------
ERA_STRP7       ----------------------------------------------------------------------
ERA_STRP2       ----------------------------------------------------------------------
ERA_STAS1       ----------------------------------------------------------------------
ERA_SHIFL       ----------------------------------------------------------------------
ERA_SHIF8       ----------------------------------------------------------------------
ERA_SHIDS       ----------------------------------------------------------------------
ERA_PSEU2       ----------------------------------------------------------------------
ERA_PSEPW       ----------------------------------------------------------------------
ERA_PSEF5       ----------------------------------------------------------------------
ERA_PSEE4       ----------------------------------------------------------------------
ERA_PSE14       ----------------------------------------------------------------------
ERA_ECOLI       ----------------------------------------------------------------------
ERA_ECOLC       ----------------------------------------------------------------------
ERA_ECOHS       ----------------------------------------------------------------------
ERA_ECODH       ----------------------------------------------------------------------
ERA_ECOBW       ----------------------------------------------------------------------
ERA_ECO5E       ----------------------------------------------------------------------
ERA_ECO57       ----------------------------------------------------------------------
ERA_CYAA5       ----------------------------------------------------------------------
ERA_COXBU       ----------------------------------------------------------------------
ERA_COXBR       ----------------------------------------------------------------------
ERA_BRAJA       ----------------------------------------------------------------------
ERA_BACHD       ----------------------------------------------------------------------
ENGD_BACSU      ----------------------------------------------------------------------
ENGB_BDEBA      ----------------------------------------------------------------------
ENGA_SULDN      ----------------------------------------------------------------------
ENGA_STRT2      ----------------------------------------------------------------------
ENGA_STRT1      ----------------------------------------------------------------------
ENGA_ROSDO      ----------------------------------------------------------------------
ENGA_RHOSK      ----------------------------------------------------------------------
ENGA_RHOS5      ----------------------------------------------------------------------
ENGA_RHOS4      ----------------------------------------------------------------------
ENGA_RHOS1      ----------------------------------------------------------------------
ENGA_RHOBA      ----------------------------------------------------------------------
ENGA_RHILO      ----------------------------------------------------------------------
ENGA_PELLD      ----------------------------------------------------------------------
ENGA_NEIG2      ----------------------------------------------------------------------
ENGA_NEIG1      ----------------------------------------------------------------------
ENGA_LEPIC      ----------------------------------------------------------------------
ENGA_JANSC      ----------------------------------------------------------------------
ENGA_AGRRK      ----------------------------------------------------------------------
OBG_THISH       ----------------------------------------------------------------------
OBG_BUCCC       ----------------------------------------------------------------------
MNME_STRTD      ----------------------------------------------------------------------
MNME_STRT2      ----------------------------------------------------------------------
MNME_STRT1      ----------------------------------------------------------------------
MNME_PELCD      ----------------------------------------------------------------------
MNME_MYCH7      ----------------------------------------------------------------------
MNME_LEPBL      ----------------------------------------------------------------------
MNME_LEPBJ      ----------------------------------------------------------------------
MNME_FINM2      ----------------------------------------------------------------------
MNME_EXIS2      ----------------------------------------------------------------------
MNME_DESHY      ----------------------------------------------------------------------
MNME_CLOTH      ----------------------------------------------------------------------
MNME_CLOBL      ----------------------------------------------------------------------
MNME_CLOB8      ----------------------------------------------------------------------
MNME_BORA1      ----------------------------------------------------------------------
ERA_XYLFM       ----------------------------------------------------------------------
ERA_XYLFA       ----------------------------------------------------------------------
ERA_NITEU       ----------------------------------------------------------------------
ERA_COXBN       ----------------------------------------------------------------------
ERA_COXB2       ----------------------------------------------------------------------
ERA_COXB1       ----------------------------------------------------------------------
ERA_CLOTE       ----------------------------------------------------------------------
ERAL_MOUSE      ----------------------------------------------------------------------
ENGB_EXISA      ----------------------------------------------------------------------
ENGA_UREPA      ----------------------------------------------------------------------
ENGA_UREP2      ----------------------------------------------------------------------
ENGA_THEAB      ----------------------------------------------------------------------
ENGA_SYNR3      ----------------------------------------------------------------------
ENGA_PSEHT      ----------------------------------------------------------------------
ENGA_PROA2      ----------------------------------------------------------------------
ENGA_NOVAD      ----------------------------------------------------------------------
ENGA_CYTH3      ----------------------------------------------------------------------
ENGA_CLONN      ----------------------------------------------------------------------
ENGA_CHLTE      ----------------------------------------------------------------------
ENGA_CAMC1      ----------------------------------------------------------------------
OBG_CHLAB       ----------------------------------------------------------------------
MNME_STRSV      ----------------------------------------------------------------------
MNME_SINMW      ----------------------------------------------------------------------
MNME_RHIE6      ----------------------------------------------------------------------
MNME_MYCHJ      ----------------------------------------------------------------------
MNME_MYCH2      ----------------------------------------------------------------------
MNME_LACS1      ----------------------------------------------------------------------
MNME_GEOMG      ----------------------------------------------------------------------
MNME_FLAPJ      ----------------------------------------------------------------------
MNME_EHRCR      ----------------------------------------------------------------------
MNME_CLOD6      ----------------------------------------------------------------------
MNME_BURCH      ----------------------------------------------------------------------
MNME_BURCA      ----------------------------------------------------------------------
MNME_BEII9      ----------------------------------------------------------------------
FEOB2_PORGI     ----------------------------------------------------------------------
ERA_STRS7       ----------------------------------------------------------------------
ERA_STRMU       ----------------------------------------------------------------------
ERA_STAES       ----------------------------------------------------------------------
ERA_STAEQ       ----------------------------------------------------------------------
ERA_SALTY       ----------------------------------------------------------------------
ERA_SALTI       ----------------------------------------------------------------------
ERA_SALSV       ----------------------------------------------------------------------
ERA_SALPK       ----------------------------------------------------------------------
ERA_SALPC       ----------------------------------------------------------------------
ERA_SALPB       ----------------------------------------------------------------------
ERA_SALPA       ----------------------------------------------------------------------
ERA_SALNS       ----------------------------------------------------------------------
ERA_SALHS       ----------------------------------------------------------------------
ERA_SALG2       ----------------------------------------------------------------------
ERA_SALEP       ----------------------------------------------------------------------
ERA_SALDC       ----------------------------------------------------------------------
ERA_SALCH       ----------------------------------------------------------------------
ERA_SALAR       ----------------------------------------------------------------------
ERA_SALA4       ----------------------------------------------------------------------
ERA_RICCN       ----------------------------------------------------------------------
ERA_PSESM       ----------------------------------------------------------------------
ERA_LISIN       ----------------------------------------------------------------------
ERA_LACAC       ----------------------------------------------------------------------
ERA_BACSK       ----------------------------------------------------------------------
ERA_ACTP7       ----------------------------------------------------------------------
ERA_ACTP2       ----------------------------------------------------------------------
ENGA_XANP2      ----------------------------------------------------------------------
ENGA_VIBHB      ----------------------------------------------------------------------
ENGA_SYNPX      ----------------------------------------------------------------------
ENGA_RHIME      ----------------------------------------------------------------------
ENGA_RHIL3      ----------------------------------------------------------------------
ENGA_PHOLL      ----------------------------------------------------------------------
ENGA_HAEDU      ----------------------------------------------------------------------
ENGA_DESHD      ----------------------------------------------------------------------
ENGA_DESAP      ----------------------------------------------------------------------
ENGA_CYAP4      ----------------------------------------------------------------------
ENGA_CLOPS      ----------------------------------------------------------------------
ENGA_CLOPE      ----------------------------------------------------------------------
ENGA_CLOP1      ----------------------------------------------------------------------
ENGA_BRAJA      ----------------------------------------------------------------------
ENGA_ALKOO      ----------------------------------------------------------------------
YKK3_CAEEL      ----------------------------------------------------------------------
MNME_STRSY      ----------------------------------------------------------------------
MNME_STRS2      ----------------------------------------------------------------------
MNME_STRA5      ----------------------------------------------------------------------
MNME_STRA3      ----------------------------------------------------------------------
MNME_STRA1      ----------------------------------------------------------------------
MNME_RHOS4      ----------------------------------------------------------------------
MNME_MESSB      ----------------------------------------------------------------------
MNME_CLOK5      ----------------------------------------------------------------------
MNME_BURS3      ----------------------------------------------------------------------
MNME_BLOPB      ----------------------------------------------------------------------
MNME_BLOFL      ----------------------------------------------------------------------
ERA_STACT       ----------------------------------------------------------------------
ERA_SHISS       ----------------------------------------------------------------------
ERA_SHIBS       ----------------------------------------------------------------------
ERA_SHIB3       ----------------------------------------------------------------------
ERA_ESCF3       ----------------------------------------------------------------------
ERA_ECOUT       ----------------------------------------------------------------------
ERA_ECOSM       ----------------------------------------------------------------------
ERA_ECOSE       ----------------------------------------------------------------------
ERA_ECOLU       ----------------------------------------------------------------------
ERA_ECOL6       ----------------------------------------------------------------------
ERA_ECOL5       ----------------------------------------------------------------------
ERA_ECOK1       ----------------------------------------------------------------------
ERA_ECO8A       ----------------------------------------------------------------------
ERA_ECO81       ----------------------------------------------------------------------
ERA_ECO7I       ----------------------------------------------------------------------
ERA_ECO55       ----------------------------------------------------------------------
ERA_ECO45       ----------------------------------------------------------------------
ERA_ECO27       ----------------------------------------------------------------------
ERA_ECO24       ----------------------------------------------------------------------
ERA_CITK8       ----------------------------------------------------------------------
ERA_ACTPJ       ----------------------------------------------------------------------
ENGA_UREU1      ----------------------------------------------------------------------
ENGA_STRA3      ----------------------------------------------------------------------
ENGA_SODGM      ----------------------------------------------------------------------
ENGA_RHILW      ----------------------------------------------------------------------
ENGA_RHIEC      ----------------------------------------------------------------------
ENGA_RHIE6      ----------------------------------------------------------------------
ENGA_MYCGA      ----------------------------------------------------------------------
ENGA_DESHY      ----------------------------------------------------------------------
ENGA_BURPS      ----------------------------------------------------------------------
ENGA_BURP6      ----------------------------------------------------------------------
ENGA_BURP0      ----------------------------------------------------------------------
ENGA_BURM9      ----------------------------------------------------------------------
ENGA_BURM7      ----------------------------------------------------------------------
MNME_RUTMC      ----------------------------------------------------------------------
MNME_RHOPA      ----------------------------------------------------------------------
MNME_RHOP5      ----------------------------------------------------------------------
MNME_PEDPA      ----------------------------------------------------------------------
MNME_BURCC      ----------------------------------------------------------------------
LSG1_DROME      ----------------------------------------------------------------------
GTPB8_RAT       ----------------------------------------------------------------------
GTPB8_MOUSE     ----------------------------------------------------------------------
ERA_RICCK       ----------------------------------------------------------------------
ERA_OCEIH       ----------------------------------------------------------------------
ERA_LISW6       ----------------------------------------------------------------------
ERA_BRASO       ----------------------------------------------------------------------
ERA_AZOVD       ----------------------------------------------------------------------
ENGA_VARPS      ----------------------------------------------------------------------
ENGA_SYNJA      ----------------------------------------------------------------------
ENGA_STRMK      ----------------------------------------------------------------------
ENGA_SHEPW      ----------------------------------------------------------------------
ENGA_SHEPA      ----------------------------------------------------------------------
ENGA_SHEHH      ----------------------------------------------------------------------
ENGA_HERAR      ----------------------------------------------------------------------
ENGA_DINSH      ----------------------------------------------------------------------
ENGA_COLP3      ----------------------------------------------------------------------
ENGA_ACIAC      ----------------------------------------------------------------------
MNME_WOLSU      ----------------------------------------------------------------------
MNME_NITHX      ----------------------------------------------------------------------
MNME_FLAJ1      ----------------------------------------------------------------------
MNME_CLONN      ----------------------------------------------------------------------
MNME_BORDL      ----------------------------------------------------------------------
MNME_BARQU      ----------------------------------------------------------------------
MNME_ACIAD      ----------------------------------------------------------------------
FEOB_SALTY      ----------------------------------------------------------------------
FEOB_SALTI      ----------------------------------------------------------------------
FEOB_SALPA      ----------------------------------------------------------------------
FEOB_SALCH      ----------------------------------------------------------------------
ERA_RICFE       ----------------------------------------------------------------------
ERA_LISMO       ----------------------------------------------------------------------
ERA_LISMH       ----------------------------------------------------------------------
ERA_LISMF       ----------------------------------------------------------------------
ERA_LISMC       ----------------------------------------------------------------------
ERA_LACH4       ----------------------------------------------------------------------
ERA_CLONN       ----------------------------------------------------------------------
ERA_CLOAB       ----------------------------------------------------------------------
ENGB_PETMO      ----------------------------------------------------------------------
ENGA_VIBPA      ----------------------------------------------------------------------
ENGA_THETN      ----------------------------------------------------------------------
ENGA_RHOFD      ----------------------------------------------------------------------
ENGA_MYCMM      ----------------------------------------------------------------------
ENGA_CHLAB      ----------------------------------------------------------------------
ENGA_CAMJR      ----------------------------------------------------------------------
ENGA_CAMJE      ----------------------------------------------------------------------
ENGA_BURP8      ----------------------------------------------------------------------
ENGA_AGRT5      ----------------------------------------------------------------------
Y024_MYCGE      ----------------------------------------------------------------------
TC120_ARATH     ----------------------------------------------------------------------
MNME_XYLFA      ----------------------------------------------------------------------
MNME_SILST      ----------------------------------------------------------------------
MNME_PELPD      ----------------------------------------------------------------------
MNME_HELHP      ----------------------------------------------------------------------
MNME_BORRA      ----------------------------------------------------------------------
GTPB8_DANRE     ----------------------------------------------------------------------
FEOB_SHIFL      ----------------------------------------------------------------------
FEOB_ECO57      ----------------------------------------------------------------------
FEOB1_PORGI     ----------------------------------------------------------------------
ERA_YERPY       ----------------------------------------------------------------------
ERA_YERPS       ----------------------------------------------------------------------
ERA_YERPP       ----------------------------------------------------------------------
ERA_YERPN       ----------------------------------------------------------------------
ERA_YERPG       ----------------------------------------------------------------------
ERA_YERPE       ----------------------------------------------------------------------
ERA_YERPB       ----------------------------------------------------------------------
ERA_YERPA       ----------------------------------------------------------------------
ERA_YERP3       ----------------------------------------------------------------------
ERA_STRP4       ----------------------------------------------------------------------
ERA_KLEP7       ----------------------------------------------------------------------
ENGA_SILPO      ----------------------------------------------------------------------
ENGA_RHISN      ----------------------------------------------------------------------
ENGA_PARUW      ----------------------------------------------------------------------
ENGA_NITWN      ----------------------------------------------------------------------
ENGA_JANMA      ----------------------------------------------------------------------
ENGA_CLOBB      ----------------------------------------------------------------------
ENGA_CLOBA      ----------------------------------------------------------------------
ENGA_CLOAB      ----------------------------------------------------------------------
ENGA_CAMJJ      ----------------------------------------------------------------------
ENGA_CAMJ8      ----------------------------------------------------------------------
ENGA_BURPP      ----------------------------------------------------------------------
ENGA_AGRVS      ----------------------------------------------------------------------
ENGA_ACAM1      ----------------------------------------------------------------------
MNME_VESOH      ----------------------------------------------------------------------
MNME_SOLUE      ----------------------------------------------------------------------
MNME_PETMO      ----------------------------------------------------------------------
MNME_NITWN      ----------------------------------------------------------------------
MNME_MYCGA      ----------------------------------------------------------------------
MNME_METPP      ----------------------------------------------------------------------
MNME_LEPCP      ----------------------------------------------------------------------
MNME_LACSS      ----------------------------------------------------------------------
MNME_ENTFA      ----------------------------------------------------------------------
MNME_CLOPE      ----------------------------------------------------------------------
MNME_CLOP1      ----------------------------------------------------------------------
ERA_XANCP       ----------------------------------------------------------------------
ERA_XANCB       ----------------------------------------------------------------------
ERA_XANC8       ----------------------------------------------------------------------
ERA_DEIGD       ----------------------------------------------------------------------
ERA_CARHZ       ----------------------------------------------------------------------
ENGB_RICTY      ----------------------------------------------------------------------
ENGA_THEYD      ----------------------------------------------------------------------
ENGA_SHEAM      ----------------------------------------------------------------------
ENGA_PELTS      ----------------------------------------------------------------------
ENGA_MYCUA      ----------------------------------------------------------------------
ENGA_HAMD5      ----------------------------------------------------------------------
ENGA_DIAST      ----------------------------------------------------------------------
ENGA_CAMHC      ----------------------------------------------------------------------
ENGA_CAMC5      ----------------------------------------------------------------------
ENGA_BURM1      ----------------------------------------------------------------------
ENGA_AZOC5      ----------------------------------------------------------------------
ENGA_ACISJ      ----------------------------------------------------------------------
EFG_THENN       ----------------------------------------------------------------------
Y026_MYCPN      ----------------------------------------------------------------------
SRCA_CHICK      ----------------------------------------------------------------------
MNME_XYLFT      ----------------------------------------------------------------------
MNME_SYNS9      -----------------------------------------------LERVLEHPGVRRALPGEFSQRAV
MNME_RHOS1      ----------------------------------------------------------------------
MNME_CYTH3      ----------------------------------------------------------------------
ERA_THELT       ----------------------------------------------------------------------
ERA_MYCAP       ----------------------------------------------------------------------
ERA_KLEP3       ----------------------------------------------------------------------
ERA_HAEDU       ----------------------------------------------------------------------
ERA_DESVV       ----------------------------------------------------------------------
ERA_DESVH       ----------------------------------------------------------------------
ERA_CAUCR       ----------------------------------------------------------------------
ERA_CAUCN       ----------------------------------------------------------------------
ENGB_RICPR      ----------------------------------------------------------------------
ENGB_CHLT3      ----------------------------------------------------------------------
ENGA_XANC5      ----------------------------------------------------------------------
ENGA_XANAC      ----------------------------------------------------------------------
ENGA_THISH      ----------------------------------------------------------------------
ENGA_SYNFM      ----------------------------------------------------------------------
ENGA_PSYIN      ----------------------------------------------------------------------
ENGA_POLNA      ----------------------------------------------------------------------
ENGA_NITOC      ----------------------------------------------------------------------
ENGA_CLOK5      ----------------------------------------------------------------------
ENGA_CLOK1      ----------------------------------------------------------------------
ENGA_CHLL2      ----------------------------------------------------------------------
ENGA_BART1      ----------------------------------------------------------------------
EFG_THEMA       ----------------------------------------------------------------------
RF1_NITOC       ----------------------------------------------------------------------
OBG_CHLFF       ----------------------------------------------------------------------
MNME_WOLWR      ----------------------------------------------------------------------
MNME_WOLPP      ----------------------------------------------------------------------
MNME_WOLPM      ----------------------------------------------------------------------
MNME_RHOPT      ----------------------------------------------------------------------
MNME_RHIL3      ----------------------------------------------------------------------
MNME_OPITP      ----------------------------------------------------------------------
MNME_METPB      ----------------------------------------------------------------------
MNME_LACC3      ----------------------------------------------------------------------
MNME_CAMFF      ----------------------------------------------------------------------
MNME_CAMC1      ----------------------------------------------------------------------
MNME_ACICJ      ----------------------------------------------------------------------
HFLX_ECOLI      ----------------------------------------------------------------------
GTPB8_BOVIN     ----------------------------------------------------------------------
GTPB3_RAT       ----------------------------------------------------------------------
FEOB_HELPY      ----------------------------------------------------------------------
FEOB_ECOLI      ----------------------------------------------------------------------
FEOB_ECOL6      ----------------------------------------------------------------------
ERA_YERE8       ----------------------------------------------------------------------
ERA_XANOR       ----------------------------------------------------------------------
ERA_XANOM       ----------------------------------------------------------------------
ERA_XANC5       ----------------------------------------------------------------------
ERA_XANAC       ----------------------------------------------------------------------
ERA_VIBPA       ----------------------------------------------------------------------
ERA_TREPS       ----------------------------------------------------------------------
ERA_TREPA       ----------------------------------------------------------------------
ERA_LACPL       ----------------------------------------------------------------------
ERA_BRASB       ----------------------------------------------------------------------
ENGB_MYCPE      ----------------------------------------------------------------------
ENGA_XYLFM      ----------------------------------------------------------------------
ENGA_RALME      ----------------------------------------------------------------------
ENGA_PROMM      ----------------------------------------------------------------------
ENGA_GEOMG      ----------------------------------------------------------------------
ENGA_CHLCV      ----------------------------------------------------------------------
ENGA_BURVG      ----------------------------------------------------------------------
ENGA_BURS3      ----------------------------------------------------------------------
ENGA_BURCM      ----------------------------------------------------------------------
ENGA_BURCJ      ----------------------------------------------------------------------
ENGA_BURCH      ----------------------------------------------------------------------
ENGA_BURCC      ----------------------------------------------------------------------
ENGA_BURCA      ----------------------------------------------------------------------
ENGA_BURA4      ----------------------------------------------------------------------
ENGA_BORPE      ----------------------------------------------------------------------
ENGA_BORPA      ----------------------------------------------------------------------
ENGA_BORBR      ----------------------------------------------------------------------
ENGA_BARHE      ----------------------------------------------------------------------
ENGA_ANAVT      ----------------------------------------------------------------------
ENGA_ALKMQ      ----------------------------------------------------------------------
Y1332_METJA     ----------------------------------------------------------------------
OBG_LEIXX       ----------------------------------------------------------------------
MTG1_MOUSE      -----------------------------------------------LKKMQSSLKSVDCVIEVHDARIP
MNME_THIDA      ----------------------------------------------------------------------
MNME_RHIEC      ----------------------------------------------------------------------
MNME_PSYCK      ----------------------------------------------------------------------
MNME_PSYA2      ----------------------------------------------------------------------
MNME_POLNA      ----------------------------------------------------------------------
MNME_OCHA4      ----------------------------------------------------------------------
MNME_MYCPE      ----------------------------------------------------------------------
MNME_MYCGE      ----------------------------------------------------------------------
MNME_HALHL      ----------------------------------------------------------------------
MNME_GLUDA      ----------------------------------------------------------------------
MNME_CLOPS      ----------------------------------------------------------------------
MNME_CALS8      ----------------------------------------------------------------------
ERA_VIBVY       ----------------------------------------------------------------------
ERA_VIBVU       ----------------------------------------------------------------------
ERA_STRMK       ----------------------------------------------------------------------
ERA_STRM5       ----------------------------------------------------------------------
ENGB_CLOB8      ----------------------------------------------------------------------
ENGA_TREPS      ----------------------------------------------------------------------
ENGA_TREPA      ----------------------------------------------------------------------
ENGA_SHIB3      ----------------------------------------------------------------------
ENGA_MYCPU      ----------------------------------------------------------------------
ENGA_MYCCT      ----------------------------------------------------------------------
ENGA_MOOTA      ----------------------------------------------------------------------
ENGA_LACBA      ----------------------------------------------------------------------
ENGA_ECO81      ----------------------------------------------------------------------
ENGA_ECO45      ----------------------------------------------------------------------
ENGA_DESOH      ----------------------------------------------------------------------
ENGA_CLOTH      ----------------------------------------------------------------------
ENGA_CHLMU      ----------------------------------------------------------------------
ENGA_CAMLR      ----------------------------------------------------------------------
ENGA_ANASP      ----------------------------------------------------------------------
ENGA_ALHEH      ----------------------------------------------------------------------
ENGA_AKKM8      ----------------------------------------------------------------------
EFG_THELT       ----------------------------------------------------------------------
EFG_CALS8       ----------------------------------------------------------------------
MNME_VEREI      ----------------------------------------------------------------------
MNME_TREPS      ----------------------------------------------------------------------
MNME_TREPA      ----------------------------------------------------------------------
MNME_SYNS3      ---------------------------------------------------------------EFSQRAV
MNME_RHIME      ----------------------------------------------------------------------
MNME_PHEZH      ----------------------------------------------------------------------
MNME_NITOC      ----------------------------------------------------------------------
MNME_BRASO      ----------------------------------------------------------------------
MNME_AKKM8      ----------------------------------------------------------------------
GTPB3_MOUSE     ----------------------------------------------------------------------
ERG_ANTMA       ----------------------------------------------------------------------
ENGA_XANOM      ----------------------------------------------------------------------
ENGA_XANCP      ----------------------------------------------------------------------
ENGA_XANCB      ----------------------------------------------------------------------
ENGA_XANC8      ----------------------------------------------------------------------
ENGA_RALEJ      ----------------------------------------------------------------------
ENGA_EUBE2      ----------------------------------------------------------------------
ENGA_DESMR      ----------------------------------------------------------------------
ENGA_CYAP8      ----------------------------------------------------------------------
ENGA_CUPTR      ----------------------------------------------------------------------
ENGA_CHLPD      ----------------------------------------------------------------------
ENGA_CHLP8      ----------------------------------------------------------------------
ENGA_CHLCH      ----------------------------------------------------------------------
ENGA_BORPD      ----------------------------------------------------------------------
EFG_THESQ       ----------------------------------------------------------------------
EFG_THEP1       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FLDRLHPFYRELIDAVIGARAYKHVVAKVGNANLAVKAIAKEAITAVRTAPDKKALLDARRMYKARIIDL
NOG1_YEAST      NINDVHPFHRDLMDTLYEKNHYKISLAAISRAKSLVEQVARDYVRLLKFGQSLFQCKQLKRAALGRMATI
NOG1_KLULA      NINDVHPFHRDLMDTLYEKNHFKVSLAAVSRAKTLVEQVERDYTRLLKFGQSLFQCKQLKRAALGRMATI
NOG1_ASHGO      NINDVHPFHRDLMDTLYEKNHYKVSLASVSRAKTLVEQVARDYVRLLKFGQSLFQCKQLKRAALGRMATI
NOG1_CANGA      NINDVHPFHRDLMDTLYEKNHYKISLAAVSRAKTLVEQVSRDYTRLLKFGQSLFQCKQLKRAALGRMATI
NOG1_ENCCU      RIEDIHPFYGDLINVLYDRDHYKLALGHVNAAKNGIEKVSKEFVKLLKFADSLYRCKQLKRAALGRMASA
NOG1_DROME      KLDDVHPFYADLMNVLYDKDHYKLALGQLNTARHLVDNVAKDYVRLLKYGDSLYRCKQLKKAALGRMATI
NOG1_CAEEL      KMEEIHPFYSDLMNILYDRDHYKIALGQMNTARHLIDGIAREYVRLMKYADSLYRCKMLKRAALGRMVKL
NOG1_DICDI      LLDDIHPFYADLINVLYDKDHYKLALGQLNTARNLIDNLSKDYLRLLKYGDSLYRCKQLKRASLGRMCTL
NOG1_MOUSE      KLDDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTI
NOG1_HUMAN      KLDDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTV
NOG1_RAT        KLDDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTI
NOG1_ARATH      RLEQIHPFYGDLLHVLYNKDHYKLALGQVNTARNLISKISKDYVKLLKYGDSLYRCKCLKVAALGRMCTV
Y1408_METJA     PVRKLPKFYQEMVEVLVGIDDFKKSMGAFKWASELVRKLGNEYARKIRKARTPQQAGKLRKEFVGRVKSI
NOG1_TRYBB      RMDDIHPFYGDLMHVLYDRDHYKVALGQVGAVRHMVDNVGRDYVRLLKYGDSLYRCKQLKRAALGRMATA
NOG1_SCHPO      KLNDIHPFHADLLNILYDRDHLKIALSQLSTAKHLVENVARDYIRLLKYGDSLYRCKQLKRAALGRMATI
OBG_BIFLO       ----------------------------------------------------------------------
OBG_BIFLI       ----------------------------------------------------------------------
OBG_BIFLD       ----------------------------------------------------------------------
OBG_SYNJA       ----------------------------------------------------------------------
OBG_VIBF1       ----------------------------------------------------------------------
OBG_BURP8       ----------------------------------------------------------------------
OBG_PELCD       ----------------------------------------------------------------------
OBG_CELJU       ----------------------------------------------------------------------
OBG_RICBR       ----------------------------------------------------------------------
OBG_RICB8       ----------------------------------------------------------------------
OBG_VIBFM       ----------------------------------------------------------------------
OBG_FRATM       ----------------------------------------------------------------------
OBG_CALS8       ----------------------------------------------------------------------
OBG_RICCN       ----------------------------------------------------------------------
OBG_ERWT9       ----------------------------------------------------------------------
OBG_DECAR       ----------------------------------------------------------------------
OBG_ANATD       ----------------------------------------------------------------------
OBG_SYNJB       ----------------------------------------------------------------------
OBG_PSYCK       ----------------------------------------------------------------------
OBG_SHEDO       ----------------------------------------------------------------------
OBG_SHEB9       ----------------------------------------------------------------------
OBG_SHEB8       ----------------------------------------------------------------------
OBG_SHEB5       ----------------------------------------------------------------------
OBG_SHEB2       ----------------------------------------------------------------------
OBG_FRATW       ----------------------------------------------------------------------
OBG_FRATT       ----------------------------------------------------------------------
OBG_FRATN       ----------------------------------------------------------------------
OBG_FRAT1       ----------------------------------------------------------------------
OBG_BIFA0       ----------------------------------------------------------------------
OBG_PSYA2       ----------------------------------------------------------------------
OBG_AZOSE       ----------------------------------------------------------------------
OBG_RICFE       ----------------------------------------------------------------------
OBG_SHEWM       ----------------------------------------------------------------------
OBG_SHEPW       ----------------------------------------------------------------------
OBG_PSEMY       ----------------------------------------------------------------------
OBG_MYCSS       ----------------------------------------------------------------------
OBG_MYCSK       ----------------------------------------------------------------------
OBG_MYCSJ       ----------------------------------------------------------------------
OBG_HERAR       ----------------------------------------------------------------------
OBG_VESOH       ----------------------------------------------------------------------
OBG_SHEHH       ----------------------------------------------------------------------
OBG_RICAH       ----------------------------------------------------------------------
OBG_PROMH       ----------------------------------------------------------------------
OBG_PHOLL       ----------------------------------------------------------------------
OBG_MYCS2       ----------------------------------------------------------------------
OBG_DICT6       ----------------------------------------------------------------------
GTPB5_HUMAN     ----------------------------------------------------------------------
OBG_POLSQ       ----------------------------------------------------------------------
OBG_MARMS       ----------------------------------------------------------------------
OBG_JANMA       ----------------------------------------------------------------------
OBG_SACD2       ----------------------------------------------------------------------
OBG_RICM5       ----------------------------------------------------------------------
OBG_COPPD       ----------------------------------------------------------------------
OBG_VIBPA       ----------------------------------------------------------------------
OBG_RICRS       ----------------------------------------------------------------------
OBG_RICRO       ----------------------------------------------------------------------
OBG_PSYIN       ----------------------------------------------------------------------
OBG_COLP3       ----------------------------------------------------------------------
OBG_ACTSZ       ----------------------------------------------------------------------
OBG_ACIBY       ----------------------------------------------------------------------
OBG_ACIBT       ----------------------------------------------------------------------
OBG_ACIBS       ----------------------------------------------------------------------
OBG_ACIBC       ----------------------------------------------------------------------
OBG_ACIB5       ----------------------------------------------------------------------
OBG_ACIB3       ----------------------------------------------------------------------
OBG_THICR       ----------------------------------------------------------------------
OBG_THESQ       ----------------------------------------------------------------------
OBG_THEP1       ----------------------------------------------------------------------
OBG_THEMA       ----------------------------------------------------------------------
OBG_SHEPA       ----------------------------------------------------------------------
OBG_MYCVP       ----------------------------------------------------------------------
OBG_BLOPB       ----------------------------------------------------------------------
OBG_ACIAD       ----------------------------------------------------------------------
OBG_VIBSL       ----------------------------------------------------------------------
OBG_THEM4       ----------------------------------------------------------------------
OBG_PSEU2       ----------------------------------------------------------------------
OBG_PSE14       ----------------------------------------------------------------------
OBG_BURXL       ----------------------------------------------------------------------
OBG_BURCM       ----------------------------------------------------------------------
OBG_BURCJ       ----------------------------------------------------------------------
OBG_BURCH       ----------------------------------------------------------------------
OBG_BURCC       ----------------------------------------------------------------------
OBG_BURCA       ----------------------------------------------------------------------
OBG_BURA4       ----------------------------------------------------------------------
GTPB5_PONAB     ----------------------------------------------------------------------
OBG_SOLUE       ----------------------------------------------------------------------
OBG_SACEN       ----------------------------------------------------------------------
OBG_FRATO       ----------------------------------------------------------------------
OBG_FRATH       ----------------------------------------------------------------------
OBG_FRATF       ----------------------------------------------------------------------
OBG_DESDA       ----------------------------------------------------------------------
MNME_SYNP2      ----------------------------------------------------------------------
OBG_VIBVY       ----------------------------------------------------------------------
OBG_RHOP5       ----------------------------------------------------------------------
OBG_OLICO       ----------------------------------------------------------------------
OBG_CLAMS       ----------------------------------------------------------------------
OBG_CLAM3       ----------------------------------------------------------------------
OBG_BURPP       ----------------------------------------------------------------------
OBG_ALKOO       ----------------------------------------------------------------------
OBG_SYNAS       ----------------------------------------------------------------------
OBG_RHOPB       ----------------------------------------------------------------------
OBG_PSEPK       ----------------------------------------------------------------------
OBG_PSEP1       ----------------------------------------------------------------------
OBG_PSEA6       ----------------------------------------------------------------------
OBG_MYCGI       ----------------------------------------------------------------------
OBG_MANSM       ----------------------------------------------------------------------
OBG_HAES2       ----------------------------------------------------------------------
OBG_DICTD       ----------------------------------------------------------------------
OBG_CHRVO       ----------------------------------------------------------------------
OBG_BORPE       ----------------------------------------------------------------------
OBG_BORPA       ----------------------------------------------------------------------
OBG_BORBR       ----------------------------------------------------------------------
OBG2_ANAMM      ----------------------------------------------------------------------
OBG2_ANAMF      ----------------------------------------------------------------------
OBG1_ANAMM      ----------------------------------------------------------------------
OBG1_ANAMF      ----------------------------------------------------------------------
OBG_SYNWW       ----------------------------------------------------------------------
OBG_RHOCS       ----------------------------------------------------------------------
OBG_PSEPG       ----------------------------------------------------------------------
OBG_PHOPR       ----------------------------------------------------------------------
OBG_JANSC       ----------------------------------------------------------------------
OBG_DESVV       ----------------------------------------------------------------------
OBG_DESVH       ----------------------------------------------------------------------
OBG_BURP6       ----------------------------------------------------------------------
OBG_ALKMQ       ----------------------------------------------------------------------
OBG_YERPY       ----------------------------------------------------------------------
OBG_YERPS       ----------------------------------------------------------------------
OBG_YERPP       ----------------------------------------------------------------------
OBG_YERPN       ----------------------------------------------------------------------
OBG_YERPG       ----------------------------------------------------------------------
OBG_YERPE       ----------------------------------------------------------------------
OBG_YERPB       ----------------------------------------------------------------------
OBG_YERPA       ----------------------------------------------------------------------
OBG_YERP3       ----------------------------------------------------------------------
OBG_VIBHB       ----------------------------------------------------------------------
OBG_VIBHA       ----------------------------------------------------------------------
OBG_RICCK       ----------------------------------------------------------------------
OBG_PSYWF       ----------------------------------------------------------------------
OBG_BORPD       ----------------------------------------------------------------------
OBG_AERS4       ----------------------------------------------------------------------
OBG_YERE8       ----------------------------------------------------------------------
OBG_THIDA       ----------------------------------------------------------------------
OBG_THENN       ----------------------------------------------------------------------
OBG_SILPO       ----------------------------------------------------------------------
OBG_SHEAM       ----------------------------------------------------------------------
OBG_NITWN       ----------------------------------------------------------------------
OBG_NITOC       ----------------------------------------------------------------------
OBG_MARAV       ----------------------------------------------------------------------
OBG_GEOLS       ----------------------------------------------------------------------
OBG_FRAP2       ----------------------------------------------------------------------
OBG_CLOTH       ----------------------------------------------------------------------
OBG_BURVG       ----------------------------------------------------------------------
OBG_BURPS       ----------------------------------------------------------------------
OBG_BURP1       ----------------------------------------------------------------------
OBG_BURP0       ----------------------------------------------------------------------
OBG_BURMS       ----------------------------------------------------------------------
OBG_BURMA       ----------------------------------------------------------------------
OBG_BURM9       ----------------------------------------------------------------------
OBG_BURM7       ----------------------------------------------------------------------
OBG_RHOBA       ----------------------------------------------------------------------
OBG_PSEE4       ----------------------------------------------------------------------
OBG_MYCMM       ----------------------------------------------------------------------
OBG_METSB       ----------------------------------------------------------------------
OBG_EHRCR       ----------------------------------------------------------------------
OBG_EHRCJ       ----------------------------------------------------------------------
OBG_DESDG       ----------------------------------------------------------------------
OBG_CORJK       ----------------------------------------------------------------------
OBG_CHLL2       ----------------------------------------------------------------------
OBG_BURS3       ----------------------------------------------------------------------
OBG_VIBVU       ----------------------------------------------------------------------
OBG_PARUW       ----------------------------------------------------------------------
OBG_HAES1       ----------------------------------------------------------------------
OBG_ANADF       ----------ELI-ADLGAADERLVVAKGGRGGLGNMNFATSTNQAPRYAEDGT----------------
OBG_AERHH       ----------------------------------------------------------------------
OBG_STRCO       ----------------------------------------------------------------------
OBG_SODGM       ----------------------------------------------------------------------
OBG_SHESH       ----------------------------------------------------------------------
OBG_PSEPF       ----------------------------------------------------------------------
OBG_NITHX       ----------------------------------------------------------------------
OBG_BURM1       ----------------------------------------------------------------------
OBG_ALTMD       ----------------------------------------------------------------------
OBG_AKKM8       ----------------------------------------------------------------------
OBG_THELT       ----------------------------------------------------------------------
OBG_RICTY       ----------------------------------------------------------------------
OBG_RALME       ----------------------------------------------------------------------
OBG_MYCUA       ----------------------------------------------------------------------
OBG_DESVM       ----------------------------------------------------------------------
OBG_CHLCH       ----------------------------------------------------------------------
OBG_BRASO       ----------------------------------------------------------------------
OBG_BART1       ----------------------------------------------------------------------
OBG_AZOSB       ----------------------------------------------------------------------
OBG_ALISL       ----------------------------------------------------------------------
OBG_ACTPJ       ----------------------------------------------------------------------
OBG_ACTP7       ----------------------------------------------------------------------
OBG_ACTP2       ----------------------------------------------------------------------
MNME_AQUAE      LHGELSKHIRPLRETLLELLAY--VEADIEFAEEDIPTLTKEQVIQ---------MVD-------KVIEG
OBG_STRGR       ----------------------------------------------------------------------
OBG_STRGG       ----------------------------------------------------------------------
OBG_SHELP       ----------------------------------------------------------------------
OBG_RALEJ       ----------------------------------------------------------------------
OBG_PSEPW       ----------------------------------------------------------------------
OBG_PHYMT       ----------------------------------------------------------------------
OBG_PARDP       ----------------------------------------------------------------------
OBG_METEP       ----------------------------------------------------------------------
OBG_METC4       ----------------------------------------------------------------------
OBG_HAEIN       ----------------------------------------------------------------------
OBG_HAEI8       ----------------------------------------------------------------------
OBG_GLUDA       ----------------------------------------------------------------------
OBG_RUTMC       ----------------------------------------------------------------------
OBG_RHOP2       ----------------------------------------------------------------------
OBG_RALPJ       ----------------------------------------------------------------------
OBG_RALEH       ----------------------------------------------------------------------
OBG_ORITI       ----------------------------------------------------------------------
OBG_ORITB       ----------------------------------------------------------------------
OBG_IDILO       ----------------------------------------------------------------------
OBG_HAEIG       ----------------------------------------------------------------------
OBG_HAEIE       ----------------------------------------------------------------------
OBG_BRASB       ----------------------------------------------------------------------
GTPBA_XENLA     ----------------------------------------------------------------------
OBG_RHOPT       ----------------------------------------------------------------------
OBG_RHOPA       ----------------------------------------------------------------------
OBG_PSEU5       ----------------------------------------------------------------------
OBG_NEIMF       ----------------------------------------------------------------------
OBG_NEIMB       ----------------------------------------------------------------------
OBG_KINRD       ----------------------------------------------------------------------
OBG_FERNB       ----------------------------------------------------------------------
OBG_BDEBA       ----------------------------------------------------------------------
OBG_ACISJ       ----------------------------------------------------------------------
MNME_PROM1      LNGRLSLTQAESISELVSARSRKA-------AELAINGIEGNIQTTIQSI--RKRLIEQLTEIEARI-DF
OBG_UNCTG       ----------------------------------------------------------------------
OBG_STRAW       ----------------------------------------------------------------------
OBG_ROSDO       ----------------------------------------------------------------------
OBG_RHOSK       ----------------------------------------------------------------------
OBG_RHOPS       ----------------------------------------------------------------------
OBG_PSEHT       ----------------------------------------------------------------------
OBG_CYAP4       ----------------------------------------------------------------------
OBG_CUPTR       ----------------------------------------------------------------------
OBG_BURTA       ----------------------------------------------------------------------
OBG_BRAJA       ----------------------------------------------------------------------
OBG_AGRRK       ----------------------------------------------------------------------
OBG_RHOS4       ----------------------------------------------------------------------
OBG_RHOS1       ----------------------------------------------------------------------
OBG_NEIMA       ----------------------------------------------------------------------
OBG_NEIM0       ----------------------------------------------------------------------
OBG_NEIG2       ----------------------------------------------------------------------
OBG_NEIG1       ----------------------------------------------------------------------
OBG_MOOTA       ----------------------------------------------------------------------
OBG_LEGPH       ----------------------------------------------------------------------
OBG_LEGPC       ----------------------------------------------------------------------
OBG_LEGPA       ----------------------------------------------------------------------
OBG_GLOVI       ----------------------------------------------------------------------
OBG_GEOMG       ----------------------------------------------------------------------
OBG_COXBU       ----------------------------------------------------------------------
OBG_COXBR       ----------------------------------------------------------------------
OBG_COXBN       ----------------------------------------------------------------------
OBG_COXB2       ----------------------------------------------------------------------
OBG_COXB1       ----------------------------------------------------------------------
OBG_CLONN       ----------------------------------------------------------------------
OBG_CHRSD       ----------------------------------------------------------------------
OBG_CHLP8       ----------------------------------------------------------------------
OBG_BRAHW       ----------------------------------------------------------------------
OBG_ACIBL       ----------------------------------------------------------------------
OBG_THETN       ----------------------------------------------------------------------
OBG_SHEFN       ----------------------------------------------------------------------
OBG_RHOS5       ----------------------------------------------------------------------
OBG_PSEF5       ----------------------------------------------------------------------
OBG_PERMH       ----------------------------------------------------------------------
OBG_LEGPL       ----------------------------------------------------------------------
OBG_DIAST       ----------------------------------------------------------------------
OBG_CORDI       ----------------------------------------------------------------------
OBG_CHLTE       ----------------------------------------------------------------------
OBG_CHLPD       ----------------------------------------------------------------------
OBG_BORA1       ----------------------------------------------------------------------
OBG_AYWBP       ----------------------------------------------------------------------
OBG_ANAPZ       ----------------------------------------------------------------------
OBG_ACIC1       ----------------------------------------------------------------------
MNME_PROMT      LNGRLSLTQAESISELVSARSRKA-------AELAINGIEGNIQTTIQSI--RKRLIEQLTEIEARI-DF
OBG_VIBCH       ----------------------------------------------------------------------
OBG_THET8       -----------------------------------------------------------------