[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL65065.1

[Show Plain Result]


## Summary of Sequence Search
    1::306
   34::124     4e-04  37%  271 aa  DAPB_RHOP2 RecName: Full=Dihydrodipicolinate reductase;       
    1::306

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DAPB_RHOP2      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSLRSPLADAYGLAV
DAPB_RHOP2      --------------------------------------------------------ALEAPGSELLGAGV


                         +         .         .         .         .         *         .:210
query           LAKASELGVEAELWVMSPGADGELSLEYLIRRVAEAAREGGLLGTVGLDSKQVEVLEKLVKRCVTEASxx
DAPB_RHOP2      LAGLPANGVEADLWTLSANADGILDFTVTIANVAIAAQRGHVIGTTGLSSSDNAVIQSVTRQAIVVKS--


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DAPB_RHOP2      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxx
DAPB_RHOP2      --------------------------