[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL65069.1

[Show Plain Result]


## Summary of Sequence Search
    1::315
   89::261     2e-09  28%  391 aa  AAT_PYRHO RecName: Full=Aspartate aminotransferase;       
   68::242     5e-09  27%  351 aa  HIS8_CHRSD RecName: Full=Histidinol-phosphate aminotransferase;    
   64::231     1e-07  28%  349 aa  HIS8_HYDS0 RecName: Full=Histidinol-phosphate aminotransferase;    
  135::351     1e-07  27%  364 aa  AAT_PYRKO RecName: Full=Aspartate aminotransferase;       
   78::221     2e-07  30%  335 aa  HIS8_THENN RecName: Full=Histidinol-phosphate aminotransferase;    
  152::237     2e-07  36%  361 aa  HIS8_DINSH RecName: Full=Histidinol-phosphate aminotransferase;    
  152::237     3e-07  35%  362 aa  HIS8_SILST RecName: Full=Histidinol-phosphate aminotransferase;    
   72::240     3e-07  28%  364 aa  COBD_SALTI RecName: Full=Threonine-phosphate decarboxylase;        
   92::364     4e-07  26%  402 aa  AAT_SULSO RecName: Full=Aspartate aminotransferase;       
  152::238     5e-07  39%  363 aa  HIS8_MAGSA RecName: Full=Histidinol-phosphate aminotransferase;    
  152::424     7e-07  28%  454 aa  ATTY_RAT RecName: Full=Tyrosine aminotransferase;       
  152::424     9e-07  30%  454 aa  ATTY_HUMAN RecName: Full=Tyrosine aminotransferase;       
  157::240     1e-06  39%  365 aa  HIS8_NITWN RecName: Full=Histidinol-phosphate aminotransferase;    
   84::199     1e-06  33%  351 aa  HIS8_RUBXD RecName: Full=Histidinol-phosphate aminotransferase;    
  141::247     1e-06  34%  365 aa  HIS8_RHOPT RecName: Full=Histidinol-phosphate aminotransferase;    
  141::247     1e-06  34%  365 aa  HIS8_RHOPA RecName: Full=Histidinol-phosphate aminotransferase;    
  157::247     1e-06  36%  365 aa  HIS82_BRAJA RecName: Full=Histidinol-phosphate aminotransferase 2; 
   63::240     1e-06  29%  367 aa  COBD_THETN RecName: Full=Putative threonine-phosphate
  120::254     3e-06  27%  369 aa  HIS82_LEGPA RecName: Full=Histidinol-phosphate aminotransferase 2; 
   95::392     3e-06  26%  394 aa  AAT_AQUAE RecName: Full=Aspartate aminotransferase;       
  153::247     3e-06  34%  365 aa  HIS8_RHOPS RecName: Full=Histidinol-phosphate aminotransferase;    
  145::247     3e-06  35%  365 aa  HIS8_RHOP5 RecName: Full=Histidinol-phosphate aminotransferase;    
  150::244     3e-06  32%  360 aa  HIS8_PELUB RecName: Full=Histidinol-phosphate aminotransferase;    
  166::211     3e-06  37%  398 aa  DAPAT_CHLAB RecName: Full=LL-diaminopimelate aminotransferase;     
  152::424     3e-06  28%  454 aa  ATTY_MOUSE RecName: Full=Tyrosine aminotransferase;       
  164::218     3e-06  35%  389 aa  AAT_PYRAB RecName: Full=Aspartate aminotransferase;       
   74::221     4e-06  26%  335 aa  HIS8_THEMA RecName: Full=Histidinol-phosphate aminotransferase;    
   89::237     4e-06  30%  348 aa  HIS8_CYAA5 RecName: Full=Histidinol-phosphate aminotransferase;    
  120::254     4e-06  27%  369 aa  HIS82_LEGPL RecName: Full=Histidinol-phosphate aminotransferase 2; 
  120::254     4e-06  27%  369 aa  HIS82_LEGPH RecName: Full=Histidinol-phosphate aminotransferase 2; 
  110::168     4e-06  42%  331 aa  COBC_PSEAE RecName: Full=Threonine-phosphate decarboxylase;        
  261::360     4e-06  33%  495 aa  1A112_ARATH RecName: Full=Probable aminotransferase ACS12;       
   96::211     6e-06  30%  398 aa  DAPAT_CHLFF RecName: Full=LL-diaminopimelate aminotransferase;     
   72::233     6e-06  26%  364 aa  COBD_SALTY RecName: Full=Threonine-phosphate decarboxylase;        
  147::247     7e-06  33%  365 aa  HIS8_RHOP2 RecName: Full=Histidinol-phosphate aminotransferase;    
   66::230     7e-06  26%  336 aa  HIS8_PYRKO RecName: Full=Histidinol-phosphate aminotransferase;    
  157::247     7e-06  33%  365 aa  HIS8_NITHX RecName: Full=Histidinol-phosphate aminotransferase;    
  155::249     7e-06  32%  366 aa  HIS8_MESSB RecName: Full=Histidinol-phosphate aminotransferase;    
  107::248     7e-06  26%  366 aa  HIS82_BACC1 RecName: Full=Histidinol-phosphate aminotransferase 2; 
   70::239     7e-06  28%  354 aa  HIS81_OCEIH RecName: Full=Histidinol-phosphate aminotransferase 1; 
  168::385     7e-06  25%  385 aa  AAT_THET8 RecName: Full=Aspartate aminotransferase;       
   74::221     1e-05  27%  335 aa  HIS8_THESQ RecName: Full=Histidinol-phosphate aminotransferase;    
   73::240     1e-05  27%  354 aa  HIS8_CLOBK RecName: Full=Histidinol-phosphate aminotransferase;    
   91::263     1e-05  26%  400 aa  AAT_SULAC RecName: Full=Aspartate aminotransferase;       
   74::221     1e-05  27%  335 aa  HIS8_THEP1 RecName: Full=Histidinol-phosphate aminotransferase;    
  151::238     1e-05  32%  362 aa  HIS8_MARMM RecName: Full=Histidinol-phosphate aminotransferase;    
   73::240     1e-05  28%  358 aa  HIS8_CLOB8 RecName: Full=Histidinol-phosphate aminotransferase;    
  156::211     1e-05  38%  395 aa  DAPAT_CHLCV RecName: Full=LL-diaminopimelate aminotransferase;     
  236::282     1e-05  30%  461 aa  DAPAT_ARATH RecName: Full=LL-diaminopimelate aminotransferase,
  144::239     2e-05  32%  352 aa  HIS8_STRGC RecName: Full=Histidinol-phosphate aminotransferase;    
  163::244     2e-05  37%  378 aa  HIS8_BEII9 RecName: Full=Histidinol-phosphate aminotransferase;    
  147::252     2e-05  30%  369 aa  HIS82_RHILO RecName: Full=Histidinol-phosphate aminotransferase 2; 
  149::246     2e-05  30%  356 aa  HIS82_BURMA RecName: Full=Histidinol-phosphate aminotransferase 2; 
  159::248     2e-05  31%  366 aa  HIS82_BACHK RecName: Full=Histidinol-phosphate aminotransferase 2; 
  159::248     2e-05  31%  366 aa  HIS82_BACCR RecName: Full=Histidinol-phosphate aminotransferase 2; 
  149::246     2e-05  30%  356 aa  HIS81_BURPS RecName: Full=Histidinol-phosphate aminotransferase 1; 
  149::246     2e-05  30%  356 aa  HIS81_BURP1 RecName: Full=Histidinol-phosphate aminotransferase 1; 
  197::277     2e-05  31%  429 aa  AAT_MYCTU RecName: Full=Probable aspartate aminotransferase;       
  197::277     2e-05  31%  429 aa  AAT_MYCBO RecName: Full=Probable aspartate aminotransferase;       
  164::251     2e-05  36%  378 aa  HIS8_AZOC5 RecName: Full=Histidinol-phosphate aminotransferase;    
  159::248     2e-05  31%  366 aa  HIS82_BACCZ RecName: Full=Histidinol-phosphate aminotransferase 2; 
  159::248     2e-05  31%  366 aa  HIS82_BACAN RecName: Full=Histidinol-phosphate aminotransferase 2; 
  170::223     2e-05  31%  410 aa  DAPAT_LAWIP RecName: Full=LL-diaminopimelate aminotransferase;     
   63::233     3e-05  29%  354 aa  HIS8_AQUAE RecName: Full=Histidinol-phosphate aminotransferase;    
  147::248     3e-05  32%  357 aa  HIS82_THIDA RecName: Full=Histidinol-phosphate aminotransferase 2; 
  149::246     3e-05  33%  355 aa  HIS82_BURS3 RecName: Full=Histidinol-phosphate aminotransferase 2; 
  185::225     3e-05  39%  410 aa  DAPAT_METTH RecName: Full=LL-diaminopimelate aminotransferase;     
   80::249     3e-05  21%  375 aa  AAT1_METJA RecName: Full=Probable aspartate aminotransferase 1;    
  155::253     4e-05  25%  368 aa  HIS8_RHISN RecName: Full=Histidinol-phosphate aminotransferase;    
  160::347     4e-05  23%  360 aa  HIS8_LISW6 RecName: Full=Histidinol-phosphate aminotransferase;    
   73::240     4e-05  26%  354 aa  HIS8_CLOBH RecName: Full=Histidinol-phosphate aminotransferase;    
   73::240     4e-05  26%  354 aa  HIS8_CLOB1 RecName: Full=Histidinol-phosphate aminotransferase;    
  153::224     4e-05  32%  411 aa  DAPAT_SYNP6 RecName: Full=LL-diaminopimelate aminotransferase;     
  153::224     4e-05  32%  411 aa  DAPAT_SYNE7 RecName: Full=LL-diaminopimelate aminotransferase;     
  131::240     5e-05  27%  362 aa  HIS8_RHOBA RecName: Full=Histidinol-phosphate aminotransferase;    
  153::256     5e-05  33%  367 aa  HIS8_ERYLH RecName: Full=Histidinol-phosphate aminotransferase;    
  142::243     5e-05  28%  357 aa  HIS81_METCA RecName: Full=Histidinol-phosphate aminotransferase 1; 
  172::226     5e-05  35%  411 aa  DAPAT_DESHY RecName: Full=LL-diaminopimelate aminotransferase;     
  172::226     5e-05  35%  411 aa  DAPAT_DESHD RecName: Full=LL-diaminopimelate aminotransferase;     
  190::291     5e-05  41%  470 aa  1A19_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   64::223     6e-05  26%  338 aa  HIS8_PYRFU RecName: Full=Histidinol-phosphate aminotransferase;    
  160::347     6e-05  23%  360 aa  HIS8_LISIN RecName: Full=Histidinol-phosphate aminotransferase;    
  151::239     6e-05  26%  356 aa  HIS8_CLONN RecName: Full=Histidinol-phosphate aminotransferase;    
   73::240     6e-05  26%  354 aa  HIS8_CLOBL RecName: Full=Histidinol-phosphate aminotransferase;    
  171::226     6e-05  30%  408 aa  DAPAT_PROMA RecName: Full=LL-diaminopimelate aminotransferase;     
  166::211     6e-05  41%  397 aa  DAPAT_CHLPN RecName: Full=LL-diaminopimelate aminotransferase;     
  145::260     6e-05  30%  447 aa  ATTY_BOVIN RecName: Full=Tyrosine aminotransferase;       
   91::262     6e-05  27%  399 aa  AAT_SULTO RecName: Full=Aspartate aminotransferase;       
  202::252     6e-05  43%  447 aa  1A17_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase
  303::424     8e-05  29%  618 aa  Y4RO_RHISN RecName: Full=Uncharacterized protein y4rO;
  144::239     8e-05  30%  352 aa  HIS8_STRSV RecName: Full=Histidinol-phosphate aminotransferase;    
   72::239     8e-05  26%  347 aa  HIS8_GEOUR RecName: Full=Histidinol-phosphate aminotransferase;    
   72::239     8e-05  28%  347 aa  HIS8_GEOSF RecName: Full=Histidinol-phosphate aminotransferase;    
   89::237     8e-05  27%  348 aa  HIS8_CYAP8 RecName: Full=Histidinol-phosphate aminotransferase;    
   73::240     8e-05  26%  354 aa  HIS8_CLOB6 RecName: Full=Histidinol-phosphate aminotransferase;    
  156::243     8e-05  31%  368 aa  HIS81_RHIME RecName: Full=Histidinol-phosphate aminotransferase 1; 
  115::241     8e-05  27%  353 aa  HIS81_ANASP RecName: Full=Histidinol-phosphate aminotransferase 1; 
  171::225     8e-05  33%  408 aa  DAPAT_PROM0 RecName: Full=LL-diaminopimelate aminotransferase;     
  153::224     8e-05  31%  411 aa  DAPAT_CYAP8 RecName: Full=LL-diaminopimelate aminotransferase;     
  111::233     1e-04  32%  358 aa  PATR_RHOE4 RecName: Full=Putative phenylalanine aminotransferase;  
  145::240     1e-04  34%  365 aa  HIS8_RHOPB RecName: Full=Histidinol-phosphate aminotransferase;    
  155::249     1e-04  32%  370 aa  HIS8_METNO RecName: Full=Histidinol-phosphate aminotransferase;    
  171::224     1e-04  31%  408 aa  DAPAT_SYNPX RecName: Full=LL-diaminopimelate aminotransferase;     
  171::225     1e-04  33%  408 aa  DAPAT_PROMS RecName: Full=LL-diaminopimelate aminotransferase;     
  153::224     1e-04  29%  409 aa  DAPAT_ACAM1 RecName: Full=LL-diaminopimelate aminotransferase;     
  152::237     1e-04  32%  361 aa  HIS8_SILPO RecName: Full=Histidinol-phosphate aminotransferase;    
  143::241     1e-04  33%  368 aa  HIS8_RHORT RecName: Full=Histidinol-phosphate aminotransferase;    
  148::243     1e-04  32%  368 aa  HIS8_AGRT5 RecName: Full=Histidinol-phosphate aminotransferase;    
  171::224     1e-04  31%  408 aa  DAPAT_SYNS3 RecName: Full=LL-diaminopimelate aminotransferase;     
  171::225     1e-04  33%  408 aa  DAPAT_PROM9 RecName: Full=LL-diaminopimelate aminotransferase;     
  155::223     1e-04  32%  411 aa  DAPAT_METST RecName: Full=LL-diaminopimelate aminotransferase;     
  172::225     1e-04  31%  404 aa  DAPAT_EUBE2 RecName: Full=LL-diaminopimelate aminotransferase;     
  235::302     1e-04  31%  507 aa  ALAT_YEAST RecName: Full=Probable alanine aminotransferase;        
  190::291     1e-04  38%  470 aa  1A15_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   93::269     2e-04  29%  421 aa  YDT4_SCHPO RecName: Full=Uncharacterized aminotransferase
  132::242     2e-04  37%  398 aa  MEGL_PSEPU RecName: Full=Methionine gamma-lyase;       
  155::255     2e-04  33%  370 aa  HIS8_METS4 RecName: Full=Histidinol-phosphate aminotransferase;    
  115::241     2e-04  27%  350 aa  HIS81_ANAVT RecName: Full=Histidinol-phosphate aminotransferase 1; 
  169::225     2e-04  30%  410 aa  DAPAT_SYNP2 RecName: Full=LL-diaminopimelate aminotransferase;     
  171::224     2e-04  33%  410 aa  DAPAT_GEOSF RecName: Full=LL-diaminopimelate aminotransferase;     
  174::226     2e-04  30%  404 aa  DAPAT_CLOPH RecName: Full=LL-diaminopimelate aminotransferase;     
  160::255     2e-04  34%  392 aa  HIS8_XANP2 RecName: Full=Histidinol-phosphate aminotransferase;    
  173::224     2e-04  35%  410 aa  DAPAT_THEEB RecName: Full=LL-diaminopimelate aminotransferase;     
  171::224     2e-04  31%  408 aa  DAPAT_SYNS9 RecName: Full=LL-diaminopimelate aminotransferase;     
  153::224     2e-04  31%  411 aa  DAPAT_MICAN RecName: Full=LL-diaminopimelate aminotransferase;     
   85::265     2e-04  22%  397 aa  AAT_STRVG RecName: Full=Aspartate aminotransferase;       
  165::221     3e-04  35%  390 aa  MALY_ECOLI RecName: Full=Protein malY;Includes:  RecName:
  155::242     3e-04  30%  369 aa  HIS8_ZYMMO RecName: Full=Histidinol-phosphate aminotransferase;    
  136::228     3e-04  30%  346 aa  HIS8_VIBFM RecName: Full=Histidinol-phosphate aminotransferase;    
   64::230     3e-04  27%  340 aa  HIS8_THEGJ RecName: Full=Histidinol-phosphate aminotransferase;    
  160::347     3e-04  23%  360 aa  HIS8_LISMO RecName: Full=Histidinol-phosphate aminotransferase;    
  160::253     3e-04  31%  360 aa  HIS8_BACA2 RecName: Full=Histidinol-phosphate aminotransferase;    
  158::244     3e-04  31%  366 aa  HIS82_HAEIN RecName: Full=Histidinol-phosphate aminotransferase 2; 
   76::248     3e-04  27%  362 aa  HIS82_CARHZ RecName: Full=Histidinol-phosphate aminotransferase 2; 
  143::243     3e-04  28%  356 aa  HIS81_THICR RecName: Full=Histidinol-phosphate aminotransferase 1; 
  173::224     3e-04  31%  408 aa  DAPAT_SYNSC RecName: Full=LL-diaminopimelate aminotransferase;     
  171::224     3e-04  31%  408 aa  DAPAT_SYNPW RecName: Full=LL-diaminopimelate aminotransferase;     
  178::221     3e-04  34%  411 aa  DAPAT_PARUW RecName: Full=LL-diaminopimelate aminotransferase;     
  173::224     3e-04  29%  408 aa  DAPAT_LEPBP RecName: Full=LL-diaminopimelate aminotransferase;     
  173::224     3e-04  29%  408 aa  DAPAT_LEPBA RecName: Full=LL-diaminopimelate aminotransferase;     
  172::225     3e-04  30%  404 aa  DAPAT_EUBR3 RecName: Full=LL-diaminopimelate aminotransferase;     
  172::217     4e-04  35%  405 aa  YFBQ_SHIFL RecName: Full=Uncharacterized aminotransferase yfbQ;    
  172::217     4e-04  35%  405 aa  YFBQ_ECOLI RecName: Full=Uncharacterized aminotransferase yfbQ;    
  172::217     4e-04  35%  405 aa  YFBQ_ECOL6 RecName: Full=Uncharacterized aminotransferase yfbQ;    
  211::304     4e-04  24%  457 aa  KAT1_RAT RecName: Full=Kynurenine--oxoglutarate transaminase 1,
  177::270     4e-04  24%  424 aa  KAT1_MOUSE RecName: Full=Kynurenine--oxoglutarate transaminase 1;  
  152::233     4e-04  36%  362 aa  HIS8_RHOCS RecName: Full=Histidinol-phosphate aminotransferase;    
  160::362     4e-04  28%  365 aa  HIS8_BACP2 RecName: Full=Histidinol-phosphate aminotransferase;    
  122::243     4e-04  27%  356 aa  HIS8_ACEPA RecName: Full=Histidinol-phosphate aminotransferase;    
  173::224     4e-04  33%  410 aa  DAPAT_GEOMG RecName: Full=LL-diaminopimelate aminotransferase;     
  185::224     4e-04  38%  411 aa  DAPAT_CYAP4 RecName: Full=LL-diaminopimelate aminotransferase;     
  160::246     5e-04  35%  359 aa  PATR_THEFY RecName: Full=Putative phenylalanine aminotransferase;  
   90::270     5e-04  25%  422 aa  KAT1_HUMAN RecName: Full=Kynurenine--oxoglutarate transaminase 1;  
  136::228     5e-04  30%  346 aa  HIS8_VIBF1 RecName: Full=Histidinol-phosphate aminotransferase;    
  151::243     5e-04  26%  351 aa  HIS8_THEPX RecName: Full=Histidinol-phosphate aminotransferase;    
   77::250     5e-04  28%  361 aa  HIS8_SYNAS RecName: Full=Histidinol-phosphate aminotransferase;    
   74::194     5e-04  27%  357 aa  HIS8_PELLD RecName: Full=Histidinol-phosphate aminotransferase;    
  143::243     5e-04  29%  351 aa  HIS82_RHIME RecName: Full=Histidinol-phosphate aminotransferase 2; 
  153::224     5e-04  29%  416 aa  DAPAT_SYNJB RecName: Full=LL-diaminopimelate aminotransferase;     
  171::224     5e-04  31%  408 aa  DAPAT_PROMP RecName: Full=LL-diaminopimelate aminotransferase;     
  184::223     5e-04  38%  408 aa  DAPAT_DESDA RecName: Full=LL-diaminopimelate aminotransferase;     
  184::224     5e-04  39%  409 aa  DAPAT_DESAH RecName: Full=LL-diaminopimelate aminotransferase;     
  171::224     5e-04  30%  411 aa  DAPAT_CYAP7 RecName: Full=LL-diaminopimelate aminotransferase;     
  153::225     5e-04  30%  411 aa  DAPAT_CYAA5 RecName: Full=LL-diaminopimelate aminotransferase;     
  203::242     5e-04  40%  496 aa  1A12_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase
  151::243     7e-04  26%  351 aa  HIS8_THEP3 RecName: Full=Histidinol-phosphate aminotransferase;    
  159::252     7e-04  31%  365 aa  HIS8_GEOTN RecName: Full=Histidinol-phosphate aminotransferase;    
  155::242     7e-04  31%  365 aa  HIS8_BRUSU RecName: Full=Histidinol-phosphate aminotransferase;    
  155::242     7e-04  31%  365 aa  HIS8_BRUO2 RecName: Full=Histidinol-phosphate aminotransferase;    
  155::242     7e-04  31%  365 aa  HIS8_BRUAB RecName: Full=Histidinol-phosphate aminotransferase;    
  155::242     7e-04  31%  365 aa  HIS8_BRUA2 RecName: Full=Histidinol-phosphate aminotransferase;    
  161::255     7e-04  28%  373 aa  HIS82_THICR RecName: Full=Histidinol-phosphate aminotransferase 2; 
  153::224     7e-04  32%  411 aa  DAPAT_TRIEI RecName: Full=LL-diaminopimelate aminotransferase;     
  173::224     7e-04  31%  410 aa  DAPAT_GEOUR RecName: Full=LL-diaminopimelate aminotransferase;     
  171::224     7e-04  30%  410 aa  DAPAT_CLOTH RecName: Full=LL-diaminopimelate aminotransferase;     
  111::233     9e-04  32%  358 aa  PATR_RHOSR RecName: Full=Putative phenylalanine aminotransferase;  
  190::281     9e-04  28%  435 aa  KAT_DICDI RecName: Full=Kynurenine--oxoglutarate transaminase;     
  136::228     9e-04  30%  346 aa  HIS8_VIBHB RecName: Full=Histidinol-phosphate aminotransferase;    
   81::172     9e-04  28%  286 aa  HIS8_SULTO RecName: Full=Histidinol-phosphate aminotransferase;    
  160::347     9e-04  22%  360 aa  HIS8_LISMF RecName: Full=Histidinol-phosphate aminotransferase;    
  160::347     9e-04  22%  360 aa  HIS8_LISMC RecName: Full=Histidinol-phosphate aminotransferase;    
  152::239     9e-04  33%  370 aa  HIS8_GRABC RecName: Full=Histidinol-phosphate aminotransferase;    
  145::239     9e-04  30%  350 aa  HIS8_GEOBB RecName: Full=Histidinol-phosphate aminotransferase;    
  153::203     9e-04  40%  372 aa  HIS8_BDEBA RecName: Full=Histidinol-phosphate aminotransferase;    
  143::182     9e-04  42%  346 aa  HIS8_BACV8 RecName: Full=Histidinol-phosphate aminotransferase;    
  150::247     9e-04  29%  356 aa  HIS8_AZOSE RecName: Full=Histidinol-phosphate aminotransferase;    
  148::242     9e-04  30%  359 aa  HIS81_CAUCR RecName: Full=Histidinol-phosphate aminotransferase 1; 
  173::224     9e-04  31%  410 aa  DAPAT_PELPD RecName: Full=LL-diaminopimelate aminotransferase;     
  185::224     9e-04  38%  409 aa  DAPAT_HELMI RecName: Full=LL-diaminopimelate aminotransferase;     
  173::224     9e-04  33%  410 aa  DAPAT_GEOSL RecName: Full=LL-diaminopimelate aminotransferase;     
  328::373     9e-04  37%  592 aa  ALAM_YEAST RecName: Full=Probable alanine aminotransferase,
  190::237     9e-04  46%  469 aa  1A18_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase
    1::315

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVLIELYDIPRQNLAIVSGAQEGNFLAFLAVK
AAT_PYRHO       ---------------------------------------------DIEVENVIITAGAYEGTYLAFESII
HIS8_CHRSD      ----------------------------------------LAETYDVATEQVFVGNGSDEVLALAFQAFF
HIS8_HYDS0      ----------------------------------------LSKLYEVEPENIMVCNGSDEAIQYLMLGIG
AAT_PYRKO       ----------------------------------------------------------------------
HIS8_THENN      --------------------------------------------------NVSIGNGADEIIYVMMLMF-
HIS8_DINSH      ----------------------------------------------------------------------
HIS8_SILST      ----------------------------------------------------------------------
COBD_SALTI      --------------------------------------------HQVPASWILAGNGETESIFTVASGLK
AAT_SULSO       ---------------------------------------------DVKKEEVIVTPGAKPALFLVFLYIN
HIS8_MAGSA      ----------------------------------------------------------------------
ATTY_RAT        ---------------------------------------------------------------LAVLANP
ATTY_HUMAN      ---------------------------------------------------------------LAVLANP
HIS8_NITWN      ----------------------------------------------------------------------
HIS8_RUBXD      --------------------------------------------------NVLVGNGSSEVQNLLMLVER
HIS8_RHOPT      ----------------------------------------------------------------------
HIS8_RHOPA      ----------------------------------------------------------------------
HIS82_BRAJA     ----------------------------------------------------------------------
COBD_THETN      ----------------------------------------IAEYVGCDRENIIVGNGAAELIHLFARAFK
HIS82_LEGPA     ----------------------------------------------------------------------
AAT_AQUAE       ---------------------------------------------------IVVSAGAKMVLFLIFMAIL
HIS8_RHOPS      ----------------------------------------------------------------------
HIS8_RHOP5      ----------------------------------------------------------------------
HIS8_PELUB      ----------------------------------------------------------------------
DAPAT_CHLAB     ----------------------------------------------------------------------
ATTY_MOUSE      ---------------------------------------------------------------LAVLANP
AAT_PYRAB       ----------------------------------------------------------------------
HIS8_THEMA      ----------------------------------------------LSKNNVSVGNGADEIIYVMMLMF-
HIS8_CYAA5      --------------------------------------------------NIALRTFVNPGETVAFLD--
HIS82_LEGPL     ----------------------------------------------------------------------
HIS82_LEGPH     ----------------------------------------------------------------------
COBC_PSEAE      ----------------------------------------------------------------------
1A112_ARATH     ----------------------------------------------------------------------
DAPAT_CHLFF     -------------------------------------------------EEIFISDGAKTDIFRLFSLFG
COBD_SALTY      --------------------------------------------HQVPASWILAGNGETESIFTVASGLK
HIS8_RHOP2      ----------------------------------------------------------------------
HIS8_PYRKO      ------------------------------------------EFYGLPAENVAVGKGGDELIGYLVRLFE
HIS8_NITHX      ----------------------------------------------------------------------
HIS8_MESSB      ----------------------------------------------------------------------
HIS82_BACC1     -------------------------------------------------------------NIVTAGATF
HIS81_OCEIH     ------------------------------------------EMYGLSQDHIFIGNGSDEVLAFSFMSFR
AAT_THET8       ----------------------------------------------------------------------
HIS8_THESQ      ----------------------------------------------LSKNNVSVGNGADEIIYVMMLMF-
HIS8_CLOBK      --------------------------------------------YNLSKEEVFIGNGSDEVLALSFLTFN
AAT_SULAC       ---------------------------------------------NISSKEVIITPGAKVSLYLAFLLVN
HIS8_THEP1      ----------------------------------------------LSKSNVSVGNGADEIIYVMMLMF-
HIS8_MARMM      ----------------------------------------------------------------------
HIS8_CLOB8      --------------------------------------------YKLDENEIFIGNGSDEILAFSFMTFF
DAPAT_CHLCV     ----------------------------------------------------------------------
DAPAT_ARATH     ----------------------------------------------------------------------
HIS8_STRGC      ----------------------------------------------------------------------
HIS8_BEII9      ----------------------------------------------------------------------
HIS82_RHILO     ----------------------------------------------------------------------
HIS82_BURMA     ----------------------------------------------------------------------
HIS82_BACHK     ----------------------------------------------------------------------
HIS82_BACCR     ----------------------------------------------------------------------
HIS81_BURPS     ----------------------------------------------------------------------
HIS81_BURP1     ----------------------------------------------------------------------
AAT_MYCTU       ----------------------------------------------------------------------
AAT_MYCBO       ----------------------------------------------------------------------
HIS8_AZOC5      ----------------------------------------------------------------------
HIS82_BACCZ     ----------------------------------------------------------------------
HIS82_BACAN     ----------------------------------------------------------------------
DAPAT_LAWIP     ----------------------------------------------------------------------
HIS8_AQUAE      ---------------------------------------VLADFFGVKEENLVLGNGSDELIYYLSIAIG
HIS82_THIDA     ----------------------------------------------------------------------
HIS82_BURS3     ----------------------------------------------------------------------
DAPAT_METTH     ----------------------------------------------------------------------
AAT1_METJA      ---------------------------------------------DVDKDNIIVTCGASEALMLSIMTLR
HIS8_RHISN      ----------------------------------------------------------------------
HIS8_LISW6      ----------------------------------------------------------------------
HIS8_CLOBH      --------------------------------------------YNLSKEEVFIGNGSDEVLSLSFLTFN
HIS8_CLOB1      --------------------------------------------YNLSKEEVFIGNGSDEVLSLSFLTFN
DAPAT_SYNP6     ----------------------------------------------------------------------
DAPAT_SYNE7     ----------------------------------------------------------------------
HIS8_RHOBA      ----------------------------------------------------------------------
HIS8_ERYLH      ----------------------------------------------------------------------
HIS81_METCA     ----------------------------------------------------------------------
DAPAT_DESHY     ----------------------------------------------------------------------
DAPAT_DESHD     ----------------------------------------------------------------------
1A19_ARATH      ----------------------------------------------------------------------
HIS8_PYRFU      ----------------------------------------LAEFYGLKKENIAVGNGSDELINYLVKMFK
HIS8_LISIN      ----------------------------------------------------------------------
HIS8_CLONN      ----------------------------------------------------------------------
HIS8_CLOBL      --------------------------------------------YNLSKEEVFIGNGSDEVLSLSFLTFN
DAPAT_PROMA     ----------------------------------------------------------------------
DAPAT_CHLPN     ----------------------------------------------------------------------
ATTY_BOVIN      ---------------------------------------------------------------LAVLANP
AAT_SULTO       ----------------------------------------------VRKEEVIVTPGAKTALYLAFLLIN
1A17_ARATH      ----------------------------------------------------------------------
Y4RO_RHISN      ----------------------------------------LSEMTDLPARNLAVGNGVGELIKALYGYLD
HIS8_STRSV      ----------------------------------------------------------------------
HIS8_GEOUR      -------------------------------------------LYGFLPEWIVMANGSDENNLIRAFADE
HIS8_GEOSF      -------------------------------------------LYGFPPEWVIMANGSDENNLIRAFADE
HIS8_CYAP8      --------------------------------------------------NIAVRTFVNPGEVVAFLDLT
HIS8_CLOB6      --------------------------------------------YNLSKEEVFIGNGSDEILAFSFLTFN
HIS81_RHIME     ----------------------------------------------------------------------
HIS81_ANASP     ----------------------------------------------------------------------
DAPAT_PROM0     ----------------------------------------------------------------------
DAPAT_CYAP8     ----------------------------------------------------------------------
PATR_RHOE4      ----------------------------------------------------------------------
HIS8_RHOPB      ----------------------------------------------------------------------
HIS8_METNO      ----------------------------------------------------------------------
DAPAT_SYNPX     ----------------------------------------------------------------------
DAPAT_PROMS     ----------------------------------------------------------------------
DAPAT_ACAM1     ----------------------------------------------------------------------
HIS8_SILPO      ----------------------------------------------------------------------
HIS8_RHORT      ----------------------------------------------------------------------
HIS8_AGRT5      ----------------------------------------------------------------------
DAPAT_SYNS3     ----------------------------------------------------------------------
DAPAT_PROM9     ----------------------------------------------------------------------
DAPAT_METST     ----------------------------------------------------------------------
DAPAT_EUBE2     ----------------------------------------------------------------------
ALAT_YEAST      ----------------------------------------------------------------------
1A15_ARATH      ----------------------------------------------------------------------
YDT4_SCHPO      -----------------------------------------------PDTEIVVTAGANEGFFSVFAALN
MEGL_PSEPU      ----------------------------------------------------------------------
HIS8_METS4      ----------------------------------------------------------------------
HIS81_ANAVT     ----------------------------------------------------------------------
DAPAT_SYNP2     ----------------------------------------------------------------------
DAPAT_GEOSF     ----------------------------------------------------------------------
DAPAT_CLOPH     ----------------------------------------------------------------------
HIS8_XANP2      ----------------------------------------------------------------------
DAPAT_THEEB     ----------------------------------------------------------------------
DAPAT_SYNS9     ----------------------------------------------------------------------
DAPAT_MICAN     ----------------------------------------------------------------------
AAT_STRVG       --------------------------------------------YEVEASQVLVTNGGKQAIYEAFAAIL
MALY_ECOLI      ----------------------------------------------------------------------
HIS8_ZYMMO      ----------------------------------------------------------------------
HIS8_VIBFM      ----------------------------------------------------------------------
HIS8_THEGJ      ----------------------------------------IADFYGVSPDNVAVGNGSDE--LLSYLVFE
HIS8_LISMO      ----------------------------------------------------------------------
HIS8_BACA2      ----------------------------------------------------------------------
HIS82_HAEIN     ----------------------------------------------------------------------
HIS82_CARHZ     --------------------------------------------YGVTPDNIILGNGSDEVMFLAMALID
HIS81_THICR     ----------------------------------------------------------------------
DAPAT_SYNSC     ----------------------------------------------------------------------
DAPAT_SYNPW     ----------------------------------------------------------------------
DAPAT_PARUW     ----------------------------------------------------------------------
DAPAT_LEPBP     ----------------------------------------------------------------------
DAPAT_LEPBA     ----------------------------------------------------------------------
DAPAT_EUBR3     ----------------------------------------------------------------------
YFBQ_SHIFL      ----------------------------------------------------------------------
YFBQ_ECOLI      ----------------------------------------------------------------------
YFBQ_ECOL6      ----------------------------------------------------------------------
KAT1_RAT        ----------------------------------------------------------------------
KAT1_MOUSE      ----------------------------------------------------------------------
HIS8_RHOCS      ----------------------------------------------------------------------
HIS8_BACP2      ----------------------------------------------------------------------
HIS8_ACEPA      ----------------------------------------------------------------------
DAPAT_GEOMG     ----------------------------------------------------------------------
DAPAT_CYAP4     ----------------------------------------------------------------------
PATR_THEFY      ----------------------------------------------------------------------
KAT1_HUMAN      -----------------------------------------------PLRNVLVTVGGYGALFTAFQALV
HIS8_VIBF1      ----------------------------------------------------------------------
HIS8_THEPX      ----------------------------------------------------------------------
HIS8_SYNAS      --------------------------------------------YSVDVDNIFVGNGSDE--ILSFVLVF
HIS8_PELLD      ------------------------------------------EFLGVPAGRVIMGNGSNELLYTIFMACL
HIS82_RHIME     ----------------------------------------------------------------------
DAPAT_SYNJB     ----------------------------------------------------------------------
DAPAT_PROMP     ----------------------------------------------------------------------
DAPAT_DESDA     ----------------------------------------------------------------------
DAPAT_DESAH     ----------------------------------------------------------------------
DAPAT_CYAP7     ----------------------------------------------------------------------
DAPAT_CYAA5     ----------------------------------------------------------------------
1A12_ARATH      ----------------------------------------------------------------------
HIS8_THEP3      ----------------------------------------------------------------------
HIS8_GEOTN      ----------------------------------------------------------------------
HIS8_BRUSU      ----------------------------------------------------------------------
HIS8_BRUO2      ----------------------------------------------------------------------
HIS8_BRUAB      ----------------------------------------------------------------------
HIS8_BRUA2      ----------------------------------------------------------------------
HIS82_THICR     ----------------------------------------------------------------------
DAPAT_TRIEI     ----------------------------------------------------------------------
DAPAT_GEOUR     ----------------------------------------------------------------------
DAPAT_CLOTH     ----------------------------------------------------------------------
PATR_RHOSR      ----------------------------------------------------------------------
KAT_DICDI       ----------------------------------------------------------------------
HIS8_VIBHB      ----------------------------------------------------------------------
HIS8_SULTO      ----------------------------------------------------------------------
HIS8_LISMF      ----------------------------------------------------------------------
HIS8_LISMC      ----------------------------------------------------------------------
HIS8_GRABC      ----------------------------------------------------------------------
HIS8_GEOBB      ----------------------------------------------------------------------
HIS8_BDEBA      ----------------------------------------------------------------------
HIS8_BACV8      ----------------------------------------------------------------------
HIS8_AZOSE      ----------------------------------------------------------------------
HIS81_CAUCR     ----------------------------------------------------------------------
DAPAT_PELPD     ----------------------------------------------------------------------
DAPAT_HELMI     ----------------------------------------------------------------------
DAPAT_GEOSL     ----------------------------------------------------------------------
ALAM_YEAST      ----------------------------------------------------------------------
1A18_ARATH      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PEYAVITVPEYEPIIKLPSSLGVRHVKVWDVWEAPIKPGGVLIFSNPNNPTGRYLEKRELAELADEARRK
AAT_PYRHO       PDPAFVSYAEDAKVAEAPVRIPLREENNFELLEKISKNTRMIVINYPNNPTGATLDKELAKTIADIAEDY
HIS8_CHRSD      RQSRPLLMPSFYPVYCKLYDVAYRSVALDDQWRVPLTANGGIVFANPNAPTGHGHSRDAIAALLE--RNT
HIS8_HYDS0      EEGVLIPRPTFPMYEVIANALGK---PIYDVQKALEKKPSIAFISNPNNPTGNLFRDEDIALI-----RK
AAT_PYRKO       ----------------------------------------LIIINYPNNPTGRVLSGKEIRGLLDVAEEN
HIS8_THENN      -ERAVFFPPTYSCYRIFAKAVGAKYLEILKIPEVDVGEGDVVFIPNPNNPTGHVFEREEIEKIL----KK
HIS8_DINSH      ----------------------------------------LVFIANPNNPTGTMIGGNALARLAD-GLPE
HIS8_SILST      ----------------------------------------LVFIANPNNPTGTMISEAEVARLAD-GIPE
COBD_SALTI      PRRAIIVTPGFAEYGRALAQIGLREADGWQLTDAILEALDCLFLCTPNNPTGLLPERQLLQAIADRCKSL
AAT_SULSO       PSDEVI-LPDYAEVVKLLGGKPIYANLKWDLQSKISKRTKMIVFNNPHNPTGTLFSPNDVKKIVDISRDN
HIS8_MAGSA      ----------------------------------------ILFLANPNNPTGTYLPATEVARLR-AGLRA
ATTY_RAT        GQNILIPRPGFSLYRTLAESMGIE-VKLYNLWEIDLKQTACLVVNNPSNPCGSVFSKRHLQKILAVAERQ
ATTY_HUMAN      GQNILVPRPGFSLYKTLAESMGIE-VKLYNLWEIDLKQTACLIVNNPSNPCGSVFSKRHLQKILAVAARQ
HIS8_NITWN      --------------------------------------------ANPNNPTGTYLPFDEIRRLR-AGLPP
HIS8_RUBXD      PGEVLFPWPTFTLYPSIAGTLGLRARRVPLTEEHRVKPEALLILCNPNNPTGTHLTLEEVSALAD-ALPE
HIS8_RHOPT      -----------------------------DAMLAAVTPNTKLVWANPNNPTGTYIPFDEVKRLR-AGLPS
HIS8_RHOPA      -----------------------------DAMLAAVTPNTKLVWANPNNPTGTYIPFDEVKRLR-AGLPS
HIS82_BRAJA     --------------------------------------------ANPNNPTGTYIPFDEVKRLR-AGLPS
COBD_THETN      LKKPLIPSPEYERAVKLPVYLKLEEEEGFRVNFAKIEEADGLILGNPNNPTGQGIIREEIGILLKKAELM
HIS82_LEGPA     -DYAFSTYAIQANSLQIPNSVPIGHVNITDIVNACNQQTGIIFIANPNNPTGMLIQQEEIKYLLEQI-PK
AAT_AQUAE       DEGDEVLLPSYPEQIRFFGGVPVEQLSLEDVKEKVTERTKAIVINSPNNPTGAVYEEEELKKIAEFCVER
HIS8_RHOPS      ----------------------------------------IVWLANPNNPTGTYIPFDEVKRL--RAGLP
HIS8_RHOP5      ---------------------------------AKVSPNTKLVWANPNNPTGTYIPFDEVRRLR-AGLPE
HIS8_PELUB      ----------------------------------------LVFIANPNNPTGTYLTRAELIDLRKKL-NK
DAPAT_CHLAB     ----------------------------------------IFCICSPNNPTGTVLNREQLKELVDYANAQ
ATTY_MOUSE      GQNILIPRPGFSLYRTLAESMGIE-VKLYNLWEIDLKQTACLVVNNPSNPCGSVFSKRHLQKILAVAERQ
AAT_PYRAB       -----------------------------------------LIINSPCNPTGSVLKKKDLEEIADFAVEH
HIS8_THEMA      -DRSVFFPPTYSCYRIFAKAVGAKFLEVLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERIL----KT
HIS8_CYAA5      -----LTYSLYETIAKVHGAT-IQTISTNENFELDICPEAKLIFASPNPPLGKHLNRQYLKETCEQAT--
HIS82_LEGPL     -DYAFSTYAIQANSLQIPNSVPIGHVNITDIVNACNQKTGIIFIANPNNPTGVLIQQEEIKYLLEQI-PK
HIS82_LEGPH     -DYAFSTYAIQANSLQIPNSVPIGHVNITDIVNACNQQTGIIFIANPNNPTGVLIQQEEIKYLLEQI-PK
COBC_PSEAE      ---------------------------VREIGEAEVEPYDVLLVVNPNNPTGRVFEPAELLAWHARLQRR
1A112_ARATH     -----------------------------------------ILFSNPSNPVGNILSRETLCDILRFAQEK
DAPAT_CHLFF     PGKTIVQDPSYPAYIDAAILAGARKIKETDFFPVIPQEENIDIFCSPNNPTGTVLNREQLKELIDYANSH
COBD_SALTY      PRRAMIVTPGFAEYGRALAQSGLREADGWQLTDAILEALDCLFLCTPNNPTGLLPERPLLQAIADRCKSL
HIS8_RHOP2      -----------------------------------VTPNTKLVWANPNNPTGTYIPFDEVKRLR-AGLPS
HIS8_PYRKO      GDYIVTTPPTFGPVIEVP--LREDFTIDGDTIAEKAKKASAVFIASPNNPTGNLQPVEEVLKVLE----T
HIS8_NITHX      --------------------------------------------ANPNNPTGTYLPFDEIKRL-HGGLPP
HIS8_MESSB      ----------------------------------------IVFLANPNNPTGTYLPMEEVKRLRSGLPRK
HIS82_BACC1     PQYRHHAIIEGCEVKEVPLNNGVYDLD--EISSAVNNNTKIVWICNPNNPTGTYVNDRKLTQFI-EGISE
HIS81_OCEIH     IKYPEITYSFYPVYAKL-FNISTDVIPLNDDYTIPVEEGGV-IFPNPNAPTGIFLEIDQIKRILE--NNP
AAT_THET8       -----------------------------------------LVVNSPNNPTGAVYPKEVLEALARLAVEH
HIS8_THESQ      -DRSVFFPPTYSCYRIFAKAVGAKFLEVLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERIL----KT
HIS8_CLOBK      PEETVVFYPVYANLYKLDYKLAIREDFSIDINDFKNARGGAVI-TNPNAPTGVYLSLDSIKQILEDNVNK
AAT_SULAC       PDEVIIFDPSYYSYPEVVKMLGGKPVYVKMKWREDTDKTKMVVLNNPHNPTGMVFDPKEIDQLIEIAKSK
HIS8_THEP1      -DRSVFFPPTYSCYRIFAKAVGAKFLEVLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERIL----KT
HIS8_MARMM      ----------------------------------------IVFLANPNNPTGTYISAAEVRRLRD-GLPA
HIS8_CLOB8      SKNKKILFPDYKVYAEL-FDLNYELVKLDDNFDIPLKTNGGVIIPNPNAPTGKYINTESLKSLIE--ANK
DAPAT_CHLCV     ----------------------------------PVIPQGIFCLCSPNNPTGTVLTKEQLEELITYANSH
DAPAT_ARATH     ----------------------------------------IIFFCSPNNPTGAAATREQLTQLVEFAKKN
HIS8_STRGC      ---------------------------------------GGIILANPNAPTGIYLPLKQLEEIL--ASNQ
HIS8_BEII9      ----------------------------------------IVYIANPNNPTGTYLPFAEVKRLA-TSLPP
HIS82_RHILO     -----------------------------DAMLAAVTPRTKIVFANPNNPTGTYVPFQEVRRLHAGLPRH
HIS82_BURMA     ---------------------------------------GCVLFPNPNAPTGRALPLADIERIV--AANP
HIS82_BACHK     ---------------------------------------------NPNNPTGTYVNDRKLTQFI-EGISE
HIS82_BACCR     ---------------------------------------------NPNNPTGTYVNDRKLTQFI-EGISE
HIS81_BURPS     ---------------------------------------GCVLFPNPNAPTGRALPLADIERIV--AANP
HIS81_BURP1     ---------------------------------------GCVLFPNPNAPTGRALPLADIERIV--AANP
AAT_MYCTU       -----------------------------------------LVVINPNNPTGAVYSCEILTQMVDLARKH
AAT_MYCBO       -----------------------------------------LVVINPNNPTGAVYSCEILTQMVDLARKH
HIS8_AZOC5      ----------------------------------------VIFLANPNNPTGTYLPFNEVRRL-HAALPP
HIS82_BACCZ     ---------------------------------------------NPNNPTGTYVNDRKLTQFI-EGISE
HIS82_BACAN     ---------------------------------------------NPNNPTGTYVNDRKLTQFI-EGISE
DAPAT_LAWIP     --------------------------------ELPTQHPDIIYLCYPNNPTGTVLSKDQLTIWVNYAKKE
HIS8_AQUAE      ELYIPVTFPMYEISAKV---LGRPLVKVQENFDIDLERSIELIFAYPNNPTGNLFSRGKI----EEIRNR
HIS82_THIDA     -----------------------------------LAPKGGVIFPNPNAPTGRLLALGEIERLL--AANR
HIS82_BURS3     --------------------------------------GGVL-FPNPNAPTGRALPLADVERIV--AANP
DAPAT_METTH     ----------------------------------------------PNNPTGTTLTEKQLAEWVDYARDS
AAT1_METJA      GDEVLIPNPSFVSYFSLTEFAEGKNIDLEKVKESITKKTKLIIFNSPSNPTGKVYDKETIKGLAEIAEDY
HIS8_RHISN      ----------------------------------PAKQAKFILLANPNNPTGTFV---PIADIESLVALS
HIS8_LISW6      ---------------------------------------------NPNNPTGNYIELADIQAFLDKV-PS
HIS8_CLOBH      PEETVVFYPVYANLYKLDYELALREDFSIDIEDFKNTKGGAII-TNPNAPTGLYLSLDSIKQILEDNINK
HIS8_CLOB1      PEETVVFYPVYANLYKLDYELALREDFSIDIEDFKNTKGGAII-TNPNAPTGLYLSLDSIKQILEDNINK
DAPAT_SYNP6     ---------EYDGLVYLPISAENNFTA-----EIPSEKVDLIYLCFPNNPTGAVASREYLQAWVDYARAN
DAPAT_SYNE7     ---------EYDGLVYLPISAENNFTA-----EIPSEKVDLIYLCFPNNPTGAVASREYLQAWVDYARAN
HIS8_RHOBA      -----------------------------DPWELPQSFGELVLLPNPNSPSGTIVSKPQIAELSNSL---
HIS8_ERYLH      ----------------------------------------VVFVANPNNPTGSFLPRDEIARL-HAGLPQ
HIS81_METCA     -----------------------------------LRPNGGVVFPNPNAPTGRLLPLADIETLL--SKNR
DAPAT_DESHY     --------------------------------ELPTAPVDMIYLCFPNNPTGMTLTKEELKVWVDYAREN
DAPAT_DESHD     --------------------------------ELPTAPVDMIYLCFPNNPTGMTLTKEELKVWVDYAREN
1A19_ARATH      -----------------------------------LKVKGVLV-TNPSNPLGTMLTRRELNLLVDFITSK
HIS8_PYRFU      GKYIVVTSPTYSFFAKL-HGIPVKDIPLKEDFTIDGKAASAIFIASPNNPTGNSQPENEVLKVLD----S
HIS8_LISIN      ---------------------------------------------NPNNPTGNYIELADIQAFLDRV-PS
HIS8_CLONN      ----------------------------------------MFIFSNPNNPTGGVIPKYDIIKIIENV---
HIS8_CLOBL      PEETIVFYPVYANLYKLDYKLALREDFSIDIEDFKNARGGAVI-TNPNAPTGLYLSLDSIKQILEDNINK
DAPAT_PROMA     --------------------------------ELPSEPVDLIYLCFPNNPTGAVASKVQLTKWVEYAKKN
DAPAT_CHLPN     ----------------------------------------ILCLCYPNNPTGTVLTFQQLQALVNYANQH
ATTY_BOVIN      GQNILVPRPGFSLYRTLAESMGIE-VKLYNLWEIDLKQTVCLIVNNPSNPCGSVFSRRHLQKILAVAARQ
AAT_SULTO       PGDEVIIFDSYAEVVKMLGGVPV-YVKMLSELESKIKKTKMIVLNNPHNPTGMVFDPIEIEKLMEITKEK
1A17_ARATH      --------------------------------DANIRVRGVLI-TNPSNPLGATVQKKVLEDLLDFCVRK
Y4RO_RHISN      PRIVIPTPTSAQYIFELPPENFDLDVEAFANF-AKRRQASVAVLVNPNNPTGRLVPVQEIEWLASQLAIE
HIS8_STRSV      ---------------------------------------GGIILANPNAPTGIYLPLEQLEEIL--ASNQ
HIS8_GEOUR      GDEIAYVYPSYSYYATLAEIQGAR-VKTYDDWKLANFPGKIFFLTNPNAPYGFTFSREFIEELAG---RV
HIS8_GEOSF      GDEIAFVYPSYSYYATLAEVQGAR-VKTWKLKDFPIYEGRIFFLTNPNAPLGFTFSQTYIEELAG---RV
HIS8_CYAP8      YSYETIARVHGASIVQIPTN------NQFELNGPIICPEAKLIFASPNPPVGKHLNRDYLEETCKQAT--
HIS8_CLOB6      PEETVVFYPVYANLYKLDYKLALREDFSIDINDFKNAKGGAVI-TNPNAPTGVYLSLDSVKQILEDNVNK
HIS81_RHIME     ----------------------------------------IVFIANPANPTGTYIPVEEVRRL-HAGLPA
HIS81_ANASP     --YRTLTEMQAADILEIP----YREYNILPVADLIAAHGSVTFIASPNSPSGHVVPSDDLRKLASEL---
DAPAT_PROM0     --------------------------------ELPEKKVDILYLCFPNNPTGATINKADLKKWVDYALQN
DAPAT_CYAP8     ---------EYEGLVYLPINAENNFIA-----EIPSQKVDIIYLCFPNNPTGATATKDYLKNWVDYAKAN
PATR_RHOE4      --YPVVTQVGHAVSVKVPLTEDFGHDL--DAMLAAITDRTRLIFCNPNNPTGNALSKAELESFLD-AVPA
HIS8_RHOPB      ---------------------------------AKVSPSTKLVWANPNNPTGTYVPFDEVKRLR-AGLPE
HIS8_METNO      ----------------------------------------IVYLANPNNPTGTYLPFDEVRRL-HAGLPG
DAPAT_SYNPX     --------------------------------QIPSEPVDLIYLCFPNNPTGAVATKGQLKAWVDYARSN
DAPAT_PROMS     --------------------------------ELPEKKVDILYLCFPNNPTGATINKEELKKWVDYALQN
DAPAT_ACAM1     ---------EYEGLTYLPINAGNNFTA-----QIPSQKVDLIYLCFPNNPTGAVASKSHLQDWVNYAKSH
HIS8_SILPO      ----------------------------------------LVFLANPANPTGTMISEAEVTRLAD-GLPG
HIS8_RHORT      -----------------------------DAMLAAVRDTTKLVFANPNNPTGTCLPTSEVVRLR-EGLRD
HIS8_AGRT5      ---------------------------------AAVTPKTKMVFANPGNPTGTYVPVAEIRRL-QAGLPK
DAPAT_SYNS3     --------------------------------QIPSEPVDLIYLCYPNNPTGAVATKAQLKKWVDYARAN
DAPAT_PROM9     --------------------------------ELPQKKVDILYLCFPNNPTGATITKEELKKWVDYALQN
DAPAT_METST     ----------YENIVYLPATSENDFVP-----SLPSEKVDIIYLCYPNNPTGTTLTKEQLKEWVDYAHEN
DAPAT_EUBE2     --------------------------------ELPKETPDIIYLCFPNNPTGSTITKDELQKWVDYANKV
ALAT_YEAST      ---------------------------VQDALKKQIRPS-VLIVINPGNPTGAVLSEETIARICLIAAKY
1A15_ARATH      -----------------------------------LKVKGVLV-TNPSNPLGTALTRRELNLLVDFITSK
YDT4_SCHPO      PGDEVIVMPFFDQYISKPVSAGAWKLDMNKLRNAITEKTKMIVINTPHNPLGKIFSEEELNEIADLVLKH
MEGL_PSEPU      ----------------------LRHVDMADLQEAAMTPATVIYFESPANPN---MHMADIAGVAKIARKH
HIS8_METS4      ----------------------------------------IVYLANPNNPTGTYLPFDEVRRL--HAGLP
HIS81_ANAVT     --YRTLTQMQAADILEIP----YQENNVLPVAELIAADGAVTFIASPNSPSGHIVPNDDLRKLASEL---
DAPAT_SYNP2     ------------------------------VAQIPTEKVDLIYLCFPNNPTGATATKEQLQAWVDYAKTN
DAPAT_GEOSF     --------------------------------ELPKEKVDIIYLCFPNNPTGTVASKAELKKWVDYANAN
DAPAT_CLOPH     ----------------------------------PAETPDIIYLCFPNNPTGSAITKMKLQKWVDYAIEK
HIS8_XANP2      ---------------------------------ALVTPRTRLVFANPNNPTGTYLPFDEVRRL-HAGLPA
DAPAT_THEEB     ----------------------------------PSEPVDLIYLCFPNNPTGAVASREHLQAWVDYARAH
DAPAT_SYNS9     --------------------------------EIPSEPVDLIYLCFPNNPTGAVATRAQLKAWVDYARSH
DAPAT_MICAN     ---------EYEGLIYLPITAENNFTA-----QIPAEKVDLIYLCFPNNPTGATATKEHLTAWVNYARAN
AAT_STRVG       DPGDEVIVPAYPESIRLAGGVPVDRVSVEQLEAARTERTKVVLFVSPSNPTGSVYSEADAKAIGEWAAEH
MALY_ECOLI      ----------------------------------------IMLLCSPQNPTGKVWTCDELEIMADLCERH
HIS8_ZYMMO      ----------------------------------------VVFIANPNNPTGTWITRAEVEKLHNGLPR-
HIS8_VIBFM      --------------------------------EASLENVKVVFVCSPNNPTGNIVDRKDILSLL-EMTKD
HIS8_THEGJ      GNHIVITPPTFGMYSFYAKLNGVPVVEVGEAVAEKAKNARVVFIASPNNPTGNLQPEEEIIRVLETRRP-
HIS8_LISMO      ---------------------------------------------NPNNPTGNYIDLADIQAFLDKV-PS
HIS8_BACA2      ---------------------------------------------NPNNPTGTYTSEQELIAFLNRV-PE
HIS82_HAEIN     ----------------------------------------LIYIANPNNPTGNFLTSQEIEDFLAEV-PE
HIS82_CARHZ     PDEAIMPVPSYEPVVTMMNGIAEHRLDLKTMAEAVNEKTRLVYLCNPNNPTGTYITKXXXXXXXXXXXXX
HIS81_THICR     -----------------------------------IENGGI-IFPNPNAPTGRLLPLQAIEQIVQQ--NA
DAPAT_SYNSC     ----------------------------------PSEPVDLIYLCFPNNPTGAVATREQLQAWVNYARAN
DAPAT_SYNPW     --------------------------------QIPSDPVDLIYLCFPNNPTGAVATKEQLKAWVDYARAN
DAPAT_PARUW     ----------------------------------------LIYFCSPNNPTGSAATNEQLRELVQFAKKR
DAPAT_LEPBP     ----------------------------------PKEKADIIYLCYPNNPTGMVATKARLTEWVNYAKKM
DAPAT_LEPBA     ----------------------------------PKEKADIIYLCYPNNPTGMVATKARLTEWVNYAKKM
DAPAT_EUBR3     --------------------------------ELPKEVPDMIYLCLPNNPTGTTLKKEQLQVWVDYANKN
YFBQ_SHIFL      -----------------------------------------IVIINPNNPTGAVYSKELLMEIVEIARQH
YFBQ_ECOLI      -----------------------------------------IVIINPNNPTGAVYSKELLMEIVEIARQH
YFBQ_ECOL6      -----------------------------------------IVIINPNNPTGAVYSKELLMEIVEIARQH
KAT1_RAT        ----------------------------------------ILVLNTPNNPLGKVFSRMELELVANLCQQH
KAT1_MOUSE      ----------------------------------------ILVLNTPNNPLGKVFSKKELELVAALCQQH
HIS8_RHOCS      ----------------------------------------IVYVANPNNPTGSYLPADALARL-HAGLPP
HIS8_BACP2      ---------------------------------------------NPNNPTGNHLSESELVAFLDQVPAH
HIS8_ACEPA      -------------------SLPFRNVPLTDDMQVNVAPCSGVVVANPNAPTGIALDLADVRKLLE--LQP
DAPAT_GEOMG     ----------------------------------PTEKVDIIYLCFPNNPTGTVATKAELKKWVDYANAN
DAPAT_CYAP4     ----------------------------------------------PNNPTGATASRAHLQQWVDYARAN
PATR_THEFY      ---------------------------------------------NPNNPTGTAVRETELAEFLDTV-PE
KAT1_HUMAN      DEGDEVIIIEYEPMTMMPGPIQNGELGSSSNWQLPMELAGALVLNTPNNPLGKVFSREELELVASLCQQH
HIS8_VIBF1      --------------------------------EASLENVKVVFVCSPNNPTGNIVDRKDILSLL-EMTKD
HIS8_THEPX      ----------------------------------------LVFLCNPNNPTGSVIEREDIIKI---IQKS
HIS8_SYNAS      PQFTYSFYPVYCDFYEIPRRIPLRPDFTLDL-EAMIENGGEMAFPNPNAPTGIALTLKQIEDLLNR-YPT
HIS8_PELLD      GPGRRILIPEYEKIVSVPMRRGLDFDADLILERAKAEAVDLIVLSTPNNPTGKSLSPDDIRRIATES---
HIS82_RHIME     ------------------------------------RPSGAVILPNPNAPTGIGLPLAEIERLV--ADHP
DAPAT_SYNJB     ---------EYEGLVYLPIT-AENHFTA----SLPSQKVDVIYLCFPNNPTGAVATREHLQNWVDYARAH
DAPAT_PROMP     --------------------------------EIPKKKVDIVYLCFPNNPTGATITKQELKKWVDYAIEN
DAPAT_DESDA     ----------------------------------------------PNNPTGTVLSRAALQGWVEYARRE
DAPAT_DESAH     ----------------------------------------------PNNPTGTTITKPELKRWVDYAHEA
DAPAT_CYAP7     --------------------------------ELPSQKVDLIYLCFPNNPTGATATKENLTKWVNYAKEN
DAPAT_CYAA5     ---------EYEGLVYLPISADNHFVA-----DIPSEKVDLIYLCFPNNPTGATATKEYLKAWVDYATAN
1A12_ARATH      -----------------------------------------LILTNPSNPLGTMLDKDTLTNLVRFVTRK
HIS8_THEP3      ----------------------------------------LVFLCNPNNPTGSVIEREDIIKI---IQKS
HIS8_GEOTN      ---------------------------------------------NPNNPTGTYVNETELRAFLDRV-PS
HIS8_BRUSU      ----------------------------------------IVFIANPANPTGTYLPFEEVRRL-HAGLPQ
HIS8_BRUO2      ----------------------------------------IVFIANPANPTGTYLPFEEVRRL-HAGLPQ
HIS8_BRUAB      ----------------------------------------IVFIANPANPTGTYLPFEEVRRL-HAGLPQ
HIS8_BRUA2      ----------------------------------------IVFIANPANPTGTYLPFEEVRRL-HAGLPQ
HIS82_THICR     ----------------------------------------LIYLANPNNPTGTLFTQKEWEAFISKV-PS
DAPAT_TRIEI     ---------EYEGLVYLP----IRAENNFTA-EIPTQKVDLIYLCFPNNPTGATATKEYLQTWVNYARAN
DAPAT_GEOUR     ----------------------------------PTEKVDIIYLCFPNNPTGTVASRAELKKWVDYANAN
DAPAT_CLOTH     --------------------------------ELPKEKVDIIYLCFPNNPTGMTLSREELKKWVDYAREN
PATR_RHOSR      --YPVVTQVAGATPVKVP--LTADHGHDLDAMLAAITDRTRLIFCNPNNPTGTALTKAELERFLD-AVPA
KAT_DICDI       ----------------------------------------LIILNNPHNPVGKVYSKEELQEIADVVAKH
HIS8_VIBHB      --------------------------------EANLDNVKLVFVCSPNNPTGNLVKREDIVSLL-EMTKD
HIS8_SULTO      ------------------------------------KNARLVIIDDPNNPTGSPMLKAEEDKVRALAESI
HIS8_LISMF      ---------------------------------------------NPNNPTGNYIDLADIQAFLDKV-PS
HIS8_LISMC      ---------------------------------------------NPNNPTGNYIDLADIQAFLDKV-PS
HIS8_GRABC      ----------------------------------------VVCIANPNNPTGTMLPTAEIARLR-ASLPS
HIS8_GEOBB      --------------------------------------GKLFFLTNPNAPLGFTYSQRYIADLAG---RL
HIS8_BDEBA      ----------------------------------PEKNIRLIFVSNPNNPTGTYATKAEVAFLQKVGNRD
HIS8_BACV8      ----------------------------------------LVFLCSPNNPTGNNLDRREMEKLLDTFQ--
HIS8_AZOSE      ---------------------------------------GGIIFPNPNAPTGRLMPLSDIERIV--AGNP
HIS81_CAUCR     ----------------------------------------LVFIANPANPTGTWLTGEEIRAL-HAALPP
DAPAT_PELPD     ----------------------------------PTEKVDIIYLCFPNNPTGTVASREELKKWVDYAIAN
DAPAT_HELMI     ----------------------------------------------PNNPTGMTLTKEELKQWVDYAREN
DAPAT_GEOSL     ----------------------------------PTEKVDIIYLCFPNNPTGTVATKAELKKWVDYAIAN
ALAM_YEAST      -----------------------------------IKPT-VLVVINPGNPTGAVLSPESIAQIFEVAAKY
1A18_ARATH      -----------------------------------LKVKGVLI-TNPSNPLGTTTTRTELNHLLDFISRK


                         +         .         .         .         .         *         .:210
query           GAYLIIDIIFSDFVTDDLRGFPLENVAYSHSTDKFYTHDLRAGWVFGDEEIVRRVKYLKDLANPGPXXXX
AAT_PYRHO       NIYILSDEPYEHFIYEDAKHYPMENTILANSFSKFAMTGWRLGFVVAPSQVIKEMTKL------------
HIS8_CHRSD      ESVVLVDEAYVDFGGESVERFPNLLVTGTFSKSRSLA-GLRLGYAIGSRELIEGLERVKDSFNSFP----
HIS8_HYDS0      HTFTVVDEAYYDFIKDAIKD---DNMAVMRTLSKIGLASLRVGALIGTKEFIREISKLK-----------
AAT_PYRKO       GVKVLSDEVYAEFTRFTPARELYENVVTVKGFSKLYSMTFRLGYAIGERNEIRRIRFIESTVTCVPPFVQ
HIS8_THENN      GAFVALDEAYYEFYIDLLKEY--ENLAIIRTFSKFSLAAQRIGYVISSEKFI------------------
HIS8_DINSH      GCLLVLDGAYAEYVPDYDAGKALENVVMTRTFSKIYLGALRVGWGYGPRHVI------------------
HIS8_SILST      DAILVLDGAYAEYVEGFDAGAQLHNVVMTRTFSKIYLGGARVGWAYGPQEII------------------
COBD_SALTI      NINLILDEAFIDFIPHETGFIPAPHIWVLRSLTKFYAPGLRLGYVNSDDAAVARMR--------------
AAT_SULSO       KIILLSDEIYDNFVYEGKMRSTLEDLIYVNGFSKFSMTGWRLGYIVAKREIIQKMGILAANVYTAPTSFV
HIS8_MAGSA      DILLVIDAAYTEFVSDYSGGIELDNVVVCRTFSKMYAGGLRLGWAYCPENV-------------------
ATTY_RAT        CVPILADEIYGDMVFSDCKYEPLANLSTNGLAKRWLVPGWRLGWIFGNEIRDGLVKLSQRILGPCTIVQG
ATTY_HUMAN      CVPILADEIYGDMVFSDCKYEPLATL----STDRWLVPGWRLGWIFGNEIRDGLVKLSQRILGPCTIVQG
HIS8_NITWN      HVLLVLDGAYSDYVSRNDYEFGIELVATTENTVLTHTFSLRIGWMFGPAHIV------------------
HIS8_RUBXD      DVLLILDEAYQEFVAD------------------------------------------------------
HIS8_RHOPT      HVVLVLDAAYADYVNDYELGIELENTVLTHTFSKVHLAALRIGWMFGPANIVDAVNRIR-----------
HIS8_RHOPA      HVVLVLDAAYADYVNDYELGIELENTVLTHTFSKVHLAALRIGWMFGPANIVDAVNRIR-----------
HIS82_BRAJA     HVLLVLDAAYCDYVSDYEMGIELENTVVTHTFSKIHLAALRIGWMFGPEHIIDAVNRIR-----------
COBD_THETN      NIPVLIDEAFIEFMKDKYEALPLDKLFVVRAVTKFFMPGIRLGYGIGSPSLIQKLEEYKE----------
HIS82_LEGPA     STLLVLDEAYYEFAASQLTVNSLDNLVVTRTFSKIYMAGLRLGYAIANPSIINILK--------------
AAT_AQUAE       GIFIISDECYEYFVYGDAKSFSDEVKNITFTVNAFSKSYSMTGWRIG--YVACPEEYAKVIASLNSQSVS
HIS8_RHOPS      GVVLVLDAAYADYVSRNDYEIGIELVATTDNTVMTHTFSLRIGWMFGPANIVDAVNRIR-----------
HIS8_RHOP5      HVVLVLDGAYADYVNDYETGIELENTVVCHTFSKIHLAALRIGWMFGPANIVDAVNRIR-----------
HIS8_PELUB      NILLVLDDAYFEYMKDYKSGLDLDNVVVIRTFSKIYLASLRVGWGHGPKKIISAMNLIR-----------
DAPAT_CHLAB     GSIILFDAAYSAFISD------------------------------------------------------
ATTY_MOUSE      CVPILADEIYGDMVFSDCKYEPMATLSTNGLAKRWLVPGWRLGWIFGNEIRDGLVKLSQRILGPCTIVQG
AAT_PYRAB       DLIVISDEVYEHFIYDDVKHYSIASL--------------------------------------------
HIS8_THEMA      GAFVALDEAYYEFHGESYVDFKYENLAVIRTFSKFSLAAQRVGYVVASEKFI------------------
HIS8_CYAA5      -GVVLIDEAYVDFSDEDHWDFEYDNVIVSRTMSKSYSAGMRVGFGISSREIIEQMNKVRDSYN-------
HIS82_LEGPL     STLLVLDEAYYEFAASQLTVNSLDNLVVTRTFSKIYMAGLRLGYAIANPSIINILK--------------
HIS82_LEGPH     STLLVLDEAYYEFAASQLTVNSLDNLVVTRTFSKIYMAGLRLGYAIANPSIINILK--------------
COBC_PSEAE      GGWLLVDEAFMD----------------------------------------------------------
1A112_ARATH     NIHVISDEIFAGSVYGDKEFVSMAEIAGSGEFDKTRVHGFRAGVIYSHEDVVNAAKKL------------
DAPAT_CHLFF     GSIILFDAAYSAFISD------------------------------------------------------
COBD_SALTY      NINLILDEAFIDFIPHETGFIPAPHIWVLRSLTKFYAPGLRLGYLVNSDD--------------------
HIS8_RHOP2      HVVLVLDAAYADYVSDYEIGIELDNTVLTHTFSKVHLASLRIGWMFGPANIVDAVNRIR-----------
HIS8_PYRKO      GKAVVVDEAYVEFAGKDLLGLLDENLVLLRTFSKFSLAGARVGYALASEEIIEALYRIK-----------
HIS8_NITHX      HVLLVLDAAYSDYVSRNDYELGIENTVLTHTFSKIHLAALRIGWMFGPAHVVDAVNRIR-----------
HIS8_MESSB      -VLLVLDAAYAEYVNDYEAGVELDNVVMTRTFSKIHLAGLRIGWMYAPIHVVDAVNRVR-----------
HIS82_BACC1     NTLIVIDEAYYEYVTDFPETLPLKNILVLRTFSKAYLASFRVGYAIGQEELIEKLNVVR-----------
HIS81_OCEIH     NQVVIIDEAYIDFALESVEAFPNLLVIQTMSKSRSLA-GLRIGFAIGNPELIIGLERIKNSFN-------
AAT_THET8       DFYLVSDEIYEHLLYEGERVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIA
HIS8_THESQ      GAFVALDEAYYEFYVDLLKKY--ENLAVIRTFSKFSLAAQRVGYVVASEKFI------------------
HIS8_CLOBK      --VVIVDEAYIDFGGESIKDYPNVLVIQTLSKSRSLA-GMRIGFALGQKELIKGLNRIKNSFN-------
AAT_SULAC       NLIVLSDEIYDYFVYEGKMRSVLESIYVNGFSKTFSMTGWRLGYVVAKENVIKKM---------------
HIS8_THEP1      GAFVALDEAYYEFYVDLLKKY--ENLAVIRTFSKFSLAAQRIGYVVSSEKFI------------------
HIS8_MARMM      STLLVLDAAYAEFVPDYEAGIELDDVIVTRTFSKIHLAALRLGWAYGNKAII------------------
HIS8_CLOB8      DRVVIIDEAYIDFGGQSM-------VKYMHEYDNLLVAGLRVGFALGHKDLIEGLNRIKNSIN-------
DAPAT_CHLCV     GSIILFDAAYSAFISD------------------------------------------------------
DAPAT_ARATH     GSIIVYDSAYAMYMSDD-----------------------------------------------------
HIS8_STRGC      DAVVVVDEAYINFGGQSLDTYPNLFITRTFSKDAALA-GLRVGYGIGHPDLIAVMKAVKDSINP------
HIS8_BEII9      NVLLVLDAAYGEYVTDYSAGLELENVVMTRTFSKIYLAALRLGWCY------------------------
HIS82_RHILO     -VLLVLDAAYAEYVNDYEAGIELENVVMTRTFSKIGLGGARIGWMYAPMHIVDAINRVR-----------
HIS82_BURMA     SSVVVIDEAYVDFGAESIARYP--NLLVVHTVSKARSAGMRVGFAFGDAALIDALTRVKDSFNSYP----
HIS82_BACHK     NTLIVIDEAYYEYVTDFPETLPLKNILVLRTFSKAYLASFRIGYAIGQEELIEKLNVVR-----------
HIS82_BACCR     NTLIVIDEAYYEYVTDFPETLPLKNILVLRTFSKAYLASFRVGYAVGQEELIEKLNVVR-----------
HIS81_BURPS     SSVVVIDEAYVDFGAESIARYP--NLLVVHTVSKARSAGMRVGFAFGDAALIDALTRVKDSFNSYP----
HIS81_BURP1     SSVVVIDEAYVDFGAESIARYP--NLLVVHTVSKARSAGMRVGFAFGDAALIDALTRVKDSFNSYP----
AAT_MYCTU       QLLLLADEIYDKILYDDAKHISLASIAFNGLSKAYRVAGYRAGWL-------------------------
AAT_MYCBO       QLLLLADEIYDKILYDDAKHISLASIAFNGLSKAYRVAGYRAGWL-------------------------
HIS8_AZOC5      NVLLVLDAAYSEYVNDYETGLELENVIMCRTFSKIHLAALRIGWAVASEAVI------------------
HIS82_BACCZ     NTLIVIDEAYYEYVTDFPETLPLKNILVLRTFSKAYLASFRVGYAVGHEELIEKLNVVR-----------
HIS82_BACAN     NTLIVIDEAYYEYVTDFPETLPLKNILVLRTFSKAYLASFRVGYAVGHEELIEKLNVVR-----------
DAPAT_LAWIP     GAIILFDAAYEAYITD------------------------------------------------------
HIS8_AQUAE      GVFCVIDEAYETFLEDALK---REDTVVLRTLSKIGMASLRVGILIGKGEIVSEINKVR-----------
HIS82_THIDA     DSVVVIDEAYVDFGGDS--AVPLPQLLVTRTLSKSHAAGLRVGYAVGQAPLIEALNRVKDSFNSYP----
HIS82_BURS3     SSVVVIDEAYVDFGAQSIDRYP--NLLVVHTTSKARSAGMRVGFAFGEAALIDALNRVKDSFNSYP----
DAPAT_METTH     GSLILFDAAYEAYIQED-----------------------------------------------------
AAT1_METJA      NLIIVSDEVYDKIIYDKKHYSPMQFTDRCILINGFSKTYAMTGWRIGYLAVSDELNKELDLIN-------
HIS8_RHISN      DQLVVLDEAYVDFAPDSALRLRYSNLLLLRTFSKSYAAGIRVGFGFGHPEVIGRLRNIQNMFN-------
HIS8_LISW6      DVLVVLDEAYIEYVTPQIRTY--KNVIITRTFSKIYLASARVGYGIADKEIINQLNIVRPPFNTTSIGQK
HIS8_CLOBH      --VVMVDEAYIDFGGESIKDYPNLLVIQTLSKSRSLA-GMRIGFALGKKELIEGLNRIKNSFN-------
HIS8_CLOB1      --VVMVDEAYIDFGGESIKDYPNLLVIQTLSKSRSLA-GMRIGFALGKKELIEGLNRIKNSFN-------
DAPAT_SYNP6     GAIILFDAAYEAFITD------------------------------------------------------
DAPAT_SYNE7     GAIILFDAAYEAFITD------------------------------------------------------
HIS8_RHOBA      NCPLVVDEAYADFAEENCLDLVQENIFVTRTLSKSYLAGIRFGFLVAQPHVIAELTKIKDSYN-------
HIS8_ERYLH      DVLFVLDQAYAEYLTEDDGGFALENVLVTRTFSKAYLAGERIGWATGAPHFINRVRGPFNVTNSG-----
HIS81_METCA     DSVVIVDEAYIDFGGESVNRFPHLLVIQTLSKSRSLA-GLRVGFALGEPGLIEALERVKGSFNSYP----
DAPAT_DESHY     KAIILFDSAYEAFIREE-----------------------------------------------------
DAPAT_DESHD     KAIILFDSAYEAFIREE-----------------------------------------------------
1A19_ARATH      NIHLISDEIYSGSVMDVLKDKNLENIVYSLSKD-LGLPGFRVGAIYSNDEMV------------------
HIS8_PYRFU      GRVVILDEAYSEFSGKSFKISEYENLVILRTFSKFGLAGIRCGYMIANEKII------------------
HIS8_LISIN      DVLVVLDEAYIEYVTPQPEKHTYKNLIITRTFSKIYLASARVGYGIADKEIIRQLNIVRPPFNTTSIGQK
HIS8_CLONN      NCIVVVDEAYMEFYGDSILDYKYDNLIVLRTASKIGSAALRLGFLITNDTLLREIKKVK-----------
HIS8_CLOBL      --VVMVDEAYIDFGGESIKDYPNLLVIQTLSKSRSLA-GMRIGFALGQKELIEGLNRIKNSFN-------
DAPAT_PROMA     HALILFDAAYESFIQDPL----------------------------------------------------
DAPAT_CHLPN     GTVLIFDAAYSAFVSD------------------------------------------------------
ATTY_BOVIN      CVPILADEIYGDMVFSDSKFEPLATLS-------------------------------------------
AAT_SULTO       KVLLLSDEIYDYFIYEGKMKSVLEDVIYVNGFSKFSMTGWRLGYVVAKEKVIKKM---------------
1A17_ARATH      NIHLVSDEIYSGSV--------------------------------------------------------
Y4RO_RHISN      KCRLVVDETFIEF---------------------------------------------------------
HIS8_STRSV      DVVVVVDEAYIHFGGQSLETYPNLFITRTFSKDAALA-GLRVGYGLGHPDLIAVMKAVKDSINP------
HIS8_GEOUR      AGMLVVDETYADFAGDTALDLKYENVVVTRTLSKSYSAGMRLGLAVARPEVIAALDKIRDHYN-------
HIS8_GEOSF      SGTLVIDETYADFVTSLELVRKYDNVVVTRTFSKSYSAGMRLGLAVARPEVISALDKIRDHYN-------
HIS8_CYAP8      -GVVLIDEAYVDFSDENHLDFKYDNVIISRTMSKSYSAGMRVGFGVSSTEIIEQMDKVRDSYN-------
HIS8_CLOB6      --VVIVDEAYIDFGGESIKDYPNLLVIQTLSKSRSLA-GMRIGFALGQKELIKGLNRIKNSFN-------
HIS81_RHIME     GVLLVLDAAYAEYVNDYEAGLELRNVVMTRTFSKIYLAGLRIGWMYAPRDVV------------------
HIS81_ANASP     SGVLVIDEAYVDFAEESALNLDHENVILIRTLSKGYSAGLRLGFGVGNPQLLNGLFKVKDSYN-------
DAPAT_PROM0     KSLILFDAAYEAFIQDD-----------------------------------------------------
DAPAT_CYAP8     GSIIFFDAAYEAFITD------------------------------------------------------
PATR_RHOE4      HVVVALDEAYFEYSRSDADGIELPNVVVLRTFSKAYLAGIRVGYAVADPEII------------------
HIS8_RHOPB      HVILVLDGAYADYVNDYESGIELDNTVVTRTFSKIHLAALRIGWMFGPANIV------------------
HIS8_METNO      NVLLVLDAAYAEYVNDYAAGLELENVVMTRTFSKVYLAALRIGWMVAPAAVVDAVNRIR-----------
DAPAT_SYNPX     GSLILFDAAYEAFIQD------------------------------------------------------
DAPAT_PROMS     KSLILFDAAYEAFIQDN-----------------------------------------------------
DAPAT_ACAM1     GSIILFDAAYEAFITD------------------------------------------------------
HIS8_SILPO      HVLLVLDGAYAEFVEGFDGGAALDNVIMTRTFSKIYLGGLRIGWGYAPREII------------------
HIS8_RHORT      DIILVVDAAYAEYVNDYDAGARLPNTVMLRTFSKIGLGGLRLGWSYGPAHII------------------
HIS8_AGRT5      HVVLVLDAAYAEYVNDYEAGLELRNVVMTRTFSKVYLAALRVGWMYAPVDII------------------
DAPAT_SYNS3     KALILFDAAYEAFIQD------------------------------------------------------
DAPAT_PROM9     KSLILFDAAYEAFIQDN-----------------------------------------------------
DAPAT_METST     DALILFDAAYESFI--------------------------------------------------------
DAPAT_EUBE2     GAVIIYDAAYEAYISE------------------------------------------------------
ALAT_YEAST      GITIISDEVYQENIFNDVKFHSMKKV--------------------------------------------
1A15_ARATH      NIHLISDEIYSGSVMDVLKDKKLEDTEVSKRVHVVYSKDLRVGAIYSNDEMI------------------
YDT4_SCHPO      NL-----LVVSDEVYDRLSFVPFVRLAFKHGGKTFGCTGWRVGWLIGDESLIK-----------------
MEGL_PSEPU      GATVVVD---NTYCTPYLQR-PLELGAVVHSATKYLSGDITAGIVVGSQALVDRIRLLKDM---------
HIS8_METS4      GVLLVLDAAYAEYVNDYAAGLELENVVMTRTFSKAYLAALRIGWMVAPPAVADAVNRIRGPFNLG-----
HIS81_ANAVT     SGVLVIDEAYVDFAEESALDLEYENVILIRTLSKGYSAGLRLGFGVGNPKLLDGLFKVKDSYN-------
DAPAT_SYNP2     GSIIFFDAAYEAFITDE-----------------------------------------------------
DAPAT_GEOSF     DAVIFFDAAYEAFITD------------------------------------------------------
DAPAT_CLOPH     GAVIIYDAAYEAYISEE-----------------------------------------------------
HIS8_XANP2      NVLLVLDAAYAEYVNDYETGLELDNVLMSRTFSKIHLAALRIGWAVGPAHVI------------------
DAPAT_THEEB     KAILFFDAAYEAFITD------------------------------------------------------
DAPAT_SYNS9     NALILFDAAYEAFIQD------------------------------------------------------
DAPAT_MICAN     GSIIFFDAAYEAFITD------------------------------------------------------
AAT_STRVG       GLWVLTDEIYEHLVYGEAKFTSLDKCIIVNGVAKTYATGWRVGWVIAPQDVIKAATNLQSHA--------
MALY_ECOLI      GVRVISDEIHMDMVWGEQPHIPWSNVA-------------------------------------------
HIS8_ZYMMO      NCLLVIDQAYAEYLDPECDDGALKNVLVTRTFSKIYLAAERIGWAYACPEII------------------
HIS8_VIBFM      RAIVVMDEAYIDFTVDLLADYP--HLAILRTLSKFALAGLRCGFTLANEELI------------------
HIS8_THEGJ      ---VVLDEAYAEFVGKSLWRLIEENLVVLRTFSKFGMAGIRAGYMLAGEEIVDALYRIK-----------
HIS8_LISMO      DILVVLDEAYIEYVTPQPKKHTYKNLIITRTFSKIYLASARVGYGIADKEIINQLNIVRPPFNTTSIGQK
HIS8_BACA2      HILVVLDEAYYEYVTDYPESIPLPNVMILRTFSKAYLAALRVGYGIADEALIRQIEPAREPFN-------
HIS82_HAEIN     NVIVVLDEAYTEFTRSEERSFSLSNLIISRSLSKAYLAGLRIGYAVSNPEI-------------------
HIS82_CARHZ     XAYFEFARLFNDY-PDGLNFFKKRNTVVLRTFSKAYLAGLRVGYGFAPENLAKAINSLR-----------
HIS81_THICR     SSVVVVDEAYIDFGGESVLRYPNLLVVQTFSKSRALA-GLRVGFAIGDKALIDGLERVKNSFNSYP----
DAPAT_SYNSC     GALILFDAAYEAFIQD------------------------------------------------------
DAPAT_SYNPW     DALILFDAAYEAFIQD------------------------------------------------------
DAPAT_PARUW     QSIIIFDAAYASFV--------------------------------------------------------
DAPAT_LEPBP     GSIILYDSAYESFIQD------------------------------------------------------
DAPAT_LEPBA     GSIILYDSAYESFIQD------------------------------------------------------
DAPAT_EUBR3     GSVIIFDAAYEAYISE------------------------------------------------------
YFBQ_SHIFL      NLIIFADEIYDKILYDD-----------------------------------------------------
YFBQ_ECOLI      NLIIFADEIYDKILYDD-----------------------------------------------------
YFBQ_ECOL6      NLIIFADEIYDKILYDD-----------------------------------------------------
KAT1_RAT        DVVCISDEVYQWLVYDSLPGMWDRTLTIGSAGKSFSATGWKVGWVMGPDNIMKHLR--------------
KAT1_MOUSE      DVLCFSDEVYQWLVYDSLPGMWERTLTIGSAGKSFSATGWKVGWVMGPDNIMKHLR--------------
HIS8_RHOCS      HVLLVIDAAYAEYVTDYADGTALDNVVMTRTFSKFGLGGMRLGWAY------------------------
HIS8_BACP2      -VLVVLDEAYVEYVRAE--DYPYQNVIVLRTFSKAYLAALRVGYGIASEELITAIEPAREPFNTSXXXXX
HIS8_ACEPA      NRVVLIDEAYVDFGAESIKEYPNLLVVQTFSKSRALA-GLRVGFAFGQPELIEGLVRIKDSFNSYP----
DAPAT_GEOMG     DAVIFFDAAYEAFITD------------------------------------------------------
DAPAT_CYAP4     GSIIFFDAAYEAFITD------------------------------------------------------
PATR_THEFY      HVLVVLDEAYREYVQDPRDGVQLPNVAVLRTFSKAYLAALRVGFLIGHPQVVDAVR--------------
KAT1_HUMAN      DVVCITDEVYQWMVYDSLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLR--------------
HIS8_VIBF1      RAIVVMDEAYIDFTVDLLVDYP--HLAILRTLSKFALAGLRCGFTLANEELI------------------
HIS8_THEPX      NGIVVVDEAYFEFIVDAINEF--ENLIVLRTLSKFGLAGLRVGYAVANENILKYLNLVKSPYN-------
HIS8_SYNAS      DRVVVIDEAYIDFGGESAVGLRYANLLVARTFSKFSLAGLRLGYALGSPELIRALFVTKDSFN-------
HIS8_PELLD      GAIVLVDEAYIEF---------------------------------------------------------
HIS82_RHIME     GQPVVIDEAYIDFGGESAIALKYDNLLVVQTFSKSRAAGLRVGFAIGQRPLIEALERVKDSFNSYP----
DAPAT_SYNJB     GSLILFDAAYEAYITE------------------------------------------------------
DAPAT_PROMP     KSLILFDAAYEAFIQD------------------------------------------------------
DAPAT_DESDA     GCVILYDSAYEAFITE------------------------------------------------------
DAPAT_DESAH     KALILFDAAYEAFIRDD-----------------------------------------------------
DAPAT_CYAP7     GSIIFFDAAYEAFITD------------------------------------------------------
DAPAT_CYAA5     DSIIFFDAAYEAFITDE-----------------------------------------------------
1A12_ARATH      NIHLVVDEIYA-----------------------------------------------------------
HIS8_THEP3      NGIVVVDEAYFEFIVDVINEF--ENLIVLRTLSKFGLAGLRVGYAVANENILKYLNLVKSPYN-------
HIS8_GEOTN      HVLVVLDEAYYEYVTADPQTVPLEQLVIMRTFSKAYLAALRVGYGIASESLIRAVEPAREPFN-------
HIS8_BRUSU      HVLLVLDAAYAEYVNDYEAGLELENVVMTRTFSKIHLPGLRIGWIYAPLHII------------------
HIS8_BRUO2      HVLLVLDAAYAEYVNDYEAGLELENVVMTRTFSKIHLPGLRIGWIYAPLHII------------------
HIS8_BRUAB      HVLLVLDAAYAEYVNDYEAGLELENVVMTRTFSKIHLPGLRIGWIYAPLHII------------------
HIS8_BRUA2      HVLLVLDAAYAEYVNDYEAGLELENVVMTRTFSKIHLPGLRIGWIYAPLHII------------------
HIS82_THICR     NVIVVLDEAYTEYVTHDLEQYP--NLIVSRTFSKAYLAALRIGYMVANEELIAYINRLR-----------
DAPAT_TRIEI     DAIILFDAAYEAFITD------------------------------------------------------
DAPAT_GEOUR     DAVIFFDAAYEAFITD------------------------------------------------------
DAPAT_CLOTH     RAIILFDSAYEAYIRE------------------------------------------------------
PATR_RHOSR      DVLVALDEAYFEYNRSDADGIELPNVVVLRTFSKAYLAGIRVGYAVADPAVV------------------
KAT_DICDI       GTTVISDEVYEWMTFDTLPGMWERTITIGSAGKTFSITGWKVGWCIGPSNII------------------
HIS8_VIBHB      RAIVVMDEAYIDFTVDLLAQYP--NLAILRTLSKFALAGLRCGFTLANEELI------------------
HIS8_SULTO      NGFILIDEAYYEFVAKLINKYP--NLLIVRTLSKFSLASYRVGYLIGNEEVIKNL---------------
HIS8_LISMF      DVLVVLDEAYIEYVTPQIRTY--KNLIITRTFSKIYLASARVGYGIADKAIIEQLNIVRPPFNTTSIGQK
HIS8_LISMC      DVLVVLDEAYIEYVTPQIRTY--KNLIITRTFSKIYLASARVGYGIADKAIIEQLNIVRPPFNTTSIGQK
HIS8_GRABC      DVLLVLDAAYAEYVDDPDPGVKLDNTVMTRTFSKFGLGGLRLGWAYAPPAIV------------------
HIS8_GEOBB      SGVLVVDEAYVDFAEETVRSF--DNVVVTRTFSKSYSAGMRLGLAIARPEIIAALNKIRDHYN-------
HIS8_BDEBA      DVMIIFDEAYNEFV--------------------------------------------------------
HIS8_BACV8      -GLVIIDEAYSDF---------------------------------------------------------
HIS8_AZOSE      QCVVVIDEAYVDFGGESVRHHPNLLVVQTLSKSRSLA-GLRVGFAVGNPDLIEALDRVKDSFNSYP----
HIS81_CAUCR     SVVLVLDGAYAEFCSDPEDGLELENVIVTRTFSKIHLAALRVGWGYAPEHIIAPIERIR-----------
DAPAT_PELPD     NAVIFFDAAYEAFITD------------------------------------------------------
DAPAT_HELMI     KSIILYDAAYEAFIQE------------------------------------------------------
DAPAT_GEOSL     DAVIFFDAAYEAFITD------------------------------------------------------
ALAM_YEAST      GTVVIADEVYQE----------------------------------------------------------
1A18_ARATH      KIHLISDEIYSGTV--------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXXVKRRNLSIIKPNATALLTRFPNALYKPHMPIALIPTGCNDAKLAERLLAMGVKTVPG
AAT_PYRHO       ----------------------------------------------------------------------
HIS8_CHRSD      ----------------------------------------------------------------------
HIS8_HYDS0      ----------------------------------------------------------------------
AAT_PYRKO       RAGVKALELRDELIKERRAYLERVRMASKMLRGFDFVEPEGAFYIFLRTPQDGMAFAERLLSRGVAVFPG
HIS8_THENN      ----------------------------------------------------------------------
HIS8_DINSH      ----------------------------------------------------------------------
HIS8_SILST      ----------------------------------------------------------------------
COBD_SALTI      ----------------------------------------------------------------------
AAT_SULSO       QKAAVKAFDTFDEVNQM-VSLFKKRRDVMLTKVPNGAFYPNVSKILKTSGFDVKSLAIKLIEKGVVTIPG
HIS8_MAGSA      ----------------------------------------------------------------------
ATTY_RAT        ALKSILQRTPQEFY-HDTLSFLKSNADGALAAIPGAMYMVGIEMEHFPEFENDVEFTERLIAQAVHCLPA
ATTY_HUMAN      ALKSILCRTPGEFY-HNTLSFLKSNADGALAAIPGAMYMVGIEMEHFPEFENDVEFTERLVAQSVHCLPA
HIS8_NITWN      ----------------------------------------------------------------------
HIS8_RUBXD      ----------------------------------------------------------------------
HIS8_RHOPT      ----------------------------------------------------------------------
HIS8_RHOPA      ----------------------------------------------------------------------
HIS82_BRAJA     ----------------------------------------------------------------------
COBD_THETN      ----------------------------------------------------------------------
HIS82_LEGPA     ----------------------------------------------------------------------
AAT_AQUAE       NVTTFAQYGALEALKRNAFERRRDTAVEELSKIPGMVVKPEGAFYIFPDFSGDVKLSEFLLEKAVAVVPG
HIS8_RHOPS      ----------------------------------------------------------------------
HIS8_RHOP5      ----------------------------------------------------------------------
HIS8_PELUB      ----------------------------------------------------------------------
DAPAT_CHLAB     ----------------------------------------------------------------------
ATTY_MOUSE      ALKSILQRTPQEFY-QDTLSFLKSNADGALSAIPGAMYMVGIEMEHFPEFENDVEFTERLIAQSVHCLPA
AAT_PYRAB       ----------------------------------------------------------------------
HIS8_THEMA      ----------------------------------------------------------------------
HIS8_CYAA5      ----------------------------------------------------------------------
HIS82_LEGPL     ----------------------------------------------------------------------
HIS82_LEGPH     ----------------------------------------------------------------------
COBC_PSEAE      ----------------------------------------------------------------------
1A112_ARATH     ----------------------------------------------------------------------
DAPAT_CHLFF     ----------------------------------------------------------------------
COBD_SALTY      ----------------------------------------------------------------------
HIS8_RHOP2      ----------------------------------------------------------------------
HIS8_PYRKO      ----------------------------------------------------------------------
HIS8_NITHX      ----------------------------------------------------------------------
HIS8_MESSB      ----------------------------------------------------------------------
HIS82_BACC1     ----------------------------------------------------------------------
HIS81_OCEIH     ----------------------------------------------------------------------
AAT_THET8       QWATLEALTNQEASRRRDXXXXXXXXXXXKAVRPSGAFYVLMDTS--PIAPDEVRAAERLLEAGVAVVPG
HIS8_THESQ      ----------------------------------------------------------------------
HIS8_CLOBK      ----------------------------------------------------------------------
AAT_SULAC       ----------------------------------------------------------------------
HIS8_THEP1      ----------------------------------------------------------------------
HIS8_MARMM      ----------------------------------------------------------------------
HIS8_CLOB8      ----------------------------------------------------------------------
DAPAT_CHLCV     ----------------------------------------------------------------------
DAPAT_ARATH     ----------------------------------------------------------------------
HIS8_STRGC      ----------------------------------------------------------------------
HIS8_BEII9      ----------------------------------------------------------------------
HIS82_RHILO     ----------------------------------------------------------------------
HIS82_BURMA     ----------------------------------------------------------------------
HIS82_BACHK     ----------------------------------------------------------------------
HIS82_BACCR     ----------------------------------------------------------------------
HIS81_BURPS     ----------------------------------------------------------------------
HIS81_BURP1     ----------------------------------------------------------------------
AAT_MYCTU       ----------------------------------------------------------------------
AAT_MYCBO       ----------------------------------------------------------------------
HIS8_AZOC5      ----------------------------------------------------------------------
HIS82_BACCZ     ----------------------------------------------------------------------
HIS82_BACAN     ----------------------------------------------------------------------
DAPAT_LAWIP     ----------------------------------------------------------------------
HIS8_AQUAE      ----------------------------------------------------------------------
HIS82_THIDA     ----------------------------------------------------------------------
HIS82_BURS3     ----------------------------------------------------------------------
DAPAT_METTH     ----------------------------------------------------------------------
AAT1_METJA      ----------------------------------------------------------------------
HIS8_RHISN      ----------------------------------------------------------------------
HIS8_LISW6      LAIEAIKDQAFIEACRTSNANGIKQYEAFAKRFEQVLYPANGNFVLIDLGIEAGTIFSYLEKNGYITRSG
HIS8_CLOBH      ----------------------------------------------------------------------
HIS8_CLOB1      ----------------------------------------------------------------------
DAPAT_SYNP6     ----------------------------------------------------------------------
DAPAT_SYNE7     ----------------------------------------------------------------------
HIS8_RHOBA      ----------------------------------------------------------------------
HIS8_ERYLH      ----------------------------------------------------------------------
HIS81_METCA     ----------------------------------------------------------------------
DAPAT_DESHY     ----------------------------------------------------------------------
DAPAT_DESHD     ----------------------------------------------------------------------
1A19_ARATH      ----------------------------------------------------------------------
HIS8_PYRFU      ----------------------------------------------------------------------
HIS8_LISIN      LAIEAIKDQAFIGECRTSNANGIKQYEAFAKRFEKVLYPANGNFVLIDLGIEAGTIFSYLEKNGYITRSG
HIS8_CLONN      ----------------------------------------------------------------------
HIS8_CLOBL      ----------------------------------------------------------------------
DAPAT_PROMA     ----------------------------------------------------------------------
DAPAT_CHLPN     ----------------------------------------------------------------------
ATTY_BOVIN      ----------------------------------------------------------------------
AAT_SULTO       ----------------------------------------------------------------------
1A17_ARATH      ----------------------------------------------------------------------
Y4RO_RHISN      ----------------------------------------------------------------------
HIS8_STRSV      ----------------------------------------------------------------------
HIS8_GEOUR      ----------------------------------------------------------------------
HIS8_GEOSF      ----------------------------------------------------------------------
HIS8_CYAP8      ----------------------------------------------------------------------
HIS8_CLOB6      ----------------------------------------------------------------------
HIS81_RHIME     ----------------------------------------------------------------------
HIS81_ANASP     ----------------------------------------------------------------------
DAPAT_PROM0     ----------------------------------------------------------------------
DAPAT_CYAP8     ----------------------------------------------------------------------
PATR_RHOE4      ----------------------------------------------------------------------
HIS8_RHOPB      ----------------------------------------------------------------------
HIS8_METNO      ----------------------------------------------------------------------
DAPAT_SYNPX     ----------------------------------------------------------------------
DAPAT_PROMS     ----------------------------------------------------------------------
DAPAT_ACAM1     ----------------------------------------------------------------------
HIS8_SILPO      ----------------------------------------------------------------------
HIS8_RHORT      ----------------------------------------------------------------------
HIS8_AGRT5      ----------------------------------------------------------------------
DAPAT_SYNS3     ----------------------------------------------------------------------
DAPAT_PROM9     ----------------------------------------------------------------------
DAPAT_METST     ----------------------------------------------------------------------
DAPAT_EUBE2     ----------------------------------------------------------------------
ALAT_YEAST      ----------------------------------------------------------------------
1A15_ARATH      ----------------------------------------------------------------------
YDT4_SCHPO      ----------------------------------------------------------------------
MEGL_PSEPU      ----------------------------------------------------------------------
HIS8_METS4      ----------------------------------------------------------------------
HIS81_ANAVT     ----------------------------------------------------------------------
DAPAT_SYNP2     ----------------------------------------------------------------------
DAPAT_GEOSF     ----------------------------------------------------------------------
DAPAT_CLOPH     ----------------------------------------------------------------------
HIS8_XANP2      ----------------------------------------------------------------------
DAPAT_THEEB     ----------------------------------------------------------------------
DAPAT_SYNS9     ----------------------------------------------------------------------
DAPAT_MICAN     ----------------------------------------------------------------------
AAT_STRVG       ----------------------------------------------------------------------
MALY_ECOLI      ----------------------------------------------------------------------
HIS8_ZYMMO      ----------------------------------------------------------------------
HIS8_VIBFM      ----------------------------------------------------------------------
HIS8_THEGJ      ----------------------------------------------------------------------
HIS8_LISMO      LAIEAIKDQAFIEACRSNANGIK-QYEAFAKRFEQVLYPANGNFVLIDLGIEARTIFSYLEKNGYITRSG
HIS8_BACA2      ----------------------------------------------------------------------
HIS82_HAEIN     ----------------------------------------------------------------------
HIS82_CARHZ     ----------------------------------------------------------------------
HIS81_THICR     ----------------------------------------------------------------------
DAPAT_SYNSC     ----------------------------------------------------------------------
DAPAT_SYNPW     ----------------------------------------------------------------------
DAPAT_PARUW     ----------------------------------------------------------------------
DAPAT_LEPBP     ----------------------------------------------------------------------
DAPAT_LEPBA     ----------------------------------------------------------------------
DAPAT_EUBR3     ----------------------------------------------------------------------
YFBQ_SHIFL      ----------------------------------------------------------------------
YFBQ_ECOLI      ----------------------------------------------------------------------
YFBQ_ECOL6      ----------------------------------------------------------------------
KAT1_RAT        ----------------------------------------------------------------------
KAT1_MOUSE      ----------------------------------------------------------------------
HIS8_RHOCS      ----------------------------------------------------------------------
HIS8_BACP2      XXXXXXKDQDFIQSCRQKNEAGLKQYQEFADRFGLFIYPSQTNFVLIDFKRDADELFHALLKKGYIVRSG
HIS8_ACEPA      ----------------------------------------------------------------------
DAPAT_GEOMG     ----------------------------------------------------------------------
DAPAT_CYAP4     ----------------------------------------------------------------------
PATR_THEFY      ----------------------------------------------------------------------
KAT1_HUMAN      ----------------------------------------------------------------------
HIS8_VIBF1      ----------------------------------------------------------------------
HIS8_THEPX      ----------------------------------------------------------------------
HIS8_SYNAS      ----------------------------------------------------------------------
HIS8_PELLD      ----------------------------------------------------------------------
HIS82_RHIME     ----------------------------------------------------------------------
DAPAT_SYNJB     ----------------------------------------------------------------------
DAPAT_PROMP     ----------------------------------------------------------------------
DAPAT_DESDA     ----------------------------------------------------------------------
DAPAT_DESAH     ----------------------------------------------------------------------
DAPAT_CYAP7     ----------------------------------------------------------------------
DAPAT_CYAA5     ----------------------------------------------------------------------
1A12_ARATH      ----------------------------------------------------------------------
HIS8_THEP3      ----------------------------------------------------------------------
HIS8_GEOTN      ----------------------------------------------------------------------
HIS8_BRUSU      ----------------------------------------------------------------------
HIS8_BRUO2      ----------------------------------------------------------------------
HIS8_BRUAB      ----------------------------------------------------------------------
HIS8_BRUA2      ----------------------------------------------------------------------
HIS82_THICR     ----------------------------------------------------------------------
DAPAT_TRIEI     ----------------------------------------------------------------------
DAPAT_GEOUR     ----------------------------------------------------------------------
DAPAT_CLOTH     ----------------------------------------------------------------------
PATR_RHOSR      ----------------------------------------------------------------------
KAT_DICDI       ----------------------------------------------------------------------
HIS8_VIBHB      ----------------------------------------------------------------------
HIS8_SULTO      ----------------------------------------------------------------------
HIS8_LISMF      LAIEAIKDQAFIEACRTSNANGIKQYEAFAKRFEQVLYPANGNFVLIDLGIEAGTIFSYLEKNGYITRSG
HIS8_LISMC      LAIEAIKDQAFIEACRTSNANGIKQYEAFAKRFEQVLYPANGNFVLIDLGIEAGTIFSYLEKNGYITRSG
HIS8_GRABC      ----------------------------------------------------------------------
HIS8_GEOBB      ----------------------------------------------------------------------
HIS8_BDEBA      ----------------------------------------------------------------------
HIS8_BACV8      ----------------------------------------------------------------------
HIS8_AZOSE      ----------------------------------------------------------------------
HIS81_CAUCR     ----------------------------------------------------------------------
DAPAT_PELPD     ----------------------------------------------------------------------
DAPAT_HELMI     ----------------------------------------------------------------------
DAPAT_GEOSL     ----------------------------------------------------------------------
ALAM_YEAST      ----------------------------------------------------------------------
1A18_ARATH      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RLFQAPYSIRVGLGVEEPPRFREALEILAQGWCRA
AAT_PYRHO       -----------------------------------
HIS8_CHRSD      -----------------------------------
HIS8_HYDS0      -----------------------------------
AAT_PYRKO       MAFDYPNFIRIGKGLERGLRIREELECATEGW---
HIS8_THENN      -----------------------------------
HIS8_DINSH      -----------------------------------
HIS8_SILST      -----------------------------------
COBD_SALTI      -----------------------------------
AAT_SULSO       EVF--------------------------------
HIS8_MAGSA      -----------------------------------
ATTY_RAT        TCFEYPNFFRVVITVPE------------------
ATTY_HUMAN      TCFEYPNFIRVVITVPE------------------
HIS8_NITWN      -----------------------------------
HIS8_RUBXD      -----------------------------------
HIS8_RHOPT      -----------------------------------
HIS8_RHOPA      -----------------------------------
HIS82_BRAJA     -----------------------------------
COBD_THETN      -----------------------------------
HIS82_LEGPA     -----------------------------------
AAT_AQUAE       SAFGAPGFLRLSYALSEERRIKKALE---------
HIS8_RHOPS      -----------------------------------
HIS8_RHOP5      -----------------------------------
HIS8_PELUB      -----------------------------------
DAPAT_CHLAB     -----------------------------------
ATTY_MOUSE      TCFEYPNFFRVVITVPE------------------
AAT_PYRAB       -----------------------------------
HIS8_THEMA      -----------------------------------
HIS8_CYAA5      -----------------------------------
HIS82_LEGPL     -----------------------------------
HIS82_LEGPH     -----------------------------------
COBC_PSEAE      -----------------------------------
1A112_ARATH     -----------------------------------
DAPAT_CHLFF     -----------------------------------
COBD_SALTY      -----------------------------------
HIS8_RHOP2      -----------------------------------
HIS8_PYRKO      -----------------------------------
HIS8_NITHX      -----------------------------------
HIS8_MESSB      -----------------------------------
HIS82_BACC1     -----------------------------------
HIS81_OCEIH     -----------------------------------
AAT_THET8       TDFAAFGHVRLSYATSE-ENLRKALERFARVLGRA
HIS8_THESQ      -----------------------------------
HIS8_CLOBK      -----------------------------------
AAT_SULAC       -----------------------------------
HIS8_THEP1      -----------------------------------
HIS8_MARMM      -----------------------------------
HIS8_CLOB8      -----------------------------------
DAPAT_CHLCV     -----------------------------------
DAPAT_ARATH     -----------------------------------
HIS8_STRGC      -----------------------------------
HIS8_BEII9      -----------------------------------
HIS82_RHILO     -----------------------------------
HIS82_BURMA     -----------------------------------
HIS82_BACHK     -----------------------------------
HIS82_BACCR     -----------------------------------
HIS81_BURPS     -----------------------------------
HIS81_BURP1     -----------------------------------
AAT_MYCTU       -----------------------------------
AAT_MYCBO       -----------------------------------
HIS8_AZOC5      -----------------------------------
HIS82_BACCZ     -----------------------------------
HIS82_BACAN     -----------------------------------
DAPAT_LAWIP     -----------------------------------
HIS8_AQUAE      -----------------------------------
HIS82_THIDA     -----------------------------------
HIS82_BURS3     -----------------------------------
DAPAT_METTH     -----------------------------------
AAT1_METJA      -----------------------------------
HIS8_RHISN      -----------------------------------
HIS8_LISW6      AALGFPTAVRITIGKEE------------------
HIS8_CLOBH      -----------------------------------
HIS8_CLOB1      -----------------------------------
DAPAT_SYNP6     -----------------------------------
DAPAT_SYNE7     -----------------------------------
HIS8_RHOBA      -----------------------------------
HIS8_ERYLH      -----------------------------------
HIS81_METCA     -----------------------------------
DAPAT_DESHY     -----------------------------------
DAPAT_DESHD     -----------------------------------
1A19_ARATH      -----------------------------------
HIS8_PYRFU      -----------------------------------
HIS8_LISIN      AALGFPTAVRITIGKEE------------------
HIS8_CLONN      -----------------------------------
HIS8_CLOBL      -----------------------------------
DAPAT_PROMA     -----------------------------------
DAPAT_CHLPN     -----------------------------------
ATTY_BOVIN      -----------------------------------
AAT_SULTO       -----------------------------------
1A17_ARATH      -----------------------------------
Y4RO_RHISN      -----------------------------------
HIS8_STRSV      -----------------------------------
HIS8_GEOUR      -----------------------------------
HIS8_GEOSF      -----------------------------------
HIS8_CYAP8      -----------------------------------
HIS8_CLOB6      -----------------------------------
HIS81_RHIME     -----------------------------------
HIS81_ANASP     -----------------------------------
DAPAT_PROM0     -----------------------------------
DAPAT_CYAP8     -----------------------------------
PATR_RHOE4      -----------------------------------
HIS8_RHOPB      -----------------------------------
HIS8_METNO      -----------------------------------
DAPAT_SYNPX     -----------------------------------
DAPAT_PROMS     -----------------------------------
DAPAT_ACAM1     -----------------------------------
HIS8_SILPO      -----------------------------------
HIS8_RHORT      -----------------------------------
HIS8_AGRT5      -----------------------------------
DAPAT_SYNS3     -----------------------------------
DAPAT_PROM9     -----------------------------------
DAPAT_METST     -----------------------------------
DAPAT_EUBE2     -----------------------------------
ALAT_YEAST      -----------------------------------
1A15_ARATH      -----------------------------------
YDT4_SCHPO      -----------------------------------
MEGL_PSEPU      -----------------------------------
HIS8_METS4      -----------------------------------
HIS81_ANAVT     -----------------------------------
DAPAT_SYNP2     -----------------------------------
DAPAT_GEOSF     -----------------------------------
DAPAT_CLOPH     -----------------------------------
HIS8_XANP2      -----------------------------------
DAPAT_THEEB     -----------------------------------
DAPAT_SYNS9     -----------------------------------
DAPAT_MICAN     -----------------------------------
AAT_STRVG       -----------------------------------
MALY_ECOLI      -----------------------------------
HIS8_ZYMMO      -----------------------------------
HIS8_VIBFM      -----------------------------------
HIS8_THEGJ      -----------------------------------
HIS8_LISMO      AALGFPTAVRITIGKEE------------------
HIS8_BACA2      -----------------------------------
HIS82_HAEIN     -----------------------------------
HIS82_CARHZ     -----------------------------------
HIS81_THICR     -----------------------------------
DAPAT_SYNSC     -----------------------------------
DAPAT_SYNPW     -----------------------------------
DAPAT_PARUW     -----------------------------------
DAPAT_LEPBP     -----------------------------------
DAPAT_LEPBA     -----------------------------------
DAPAT_EUBR3     -----------------------------------
YFBQ_SHIFL      -----------------------------------
YFBQ_ECOLI      -----------------------------------
YFBQ_ECOL6      -----------------------------------
KAT1_RAT        -----------------------------------
KAT1_MOUSE      -----------------------------------
HIS8_RHOCS      -----------------------------------
HIS8_BACP2      KVLGFPTSLRITVGMEQNAEILSTLADLLQG----
HIS8_ACEPA      -----------------------------------
DAPAT_GEOMG     -----------------------------------
DAPAT_CYAP4     -----------------------------------
PATR_THEFY      -----------------------------------
KAT1_HUMAN      -----------------------------------
HIS8_VIBF1      -----------------------------------
HIS8_THEPX      -----------------------------------
HIS8_SYNAS      -----------------------------------
HIS8_PELLD      -----------------------------------
HIS82_RHIME     -----------------------------------
DAPAT_SYNJB     -----------------------------------
DAPAT_PROMP     -----------------------------------
DAPAT_DESDA     -----------------------------------
DAPAT_DESAH     -----------------------------------
DAPAT_CYAP7     -----------------------------------
DAPAT_CYAA5     -----------------------------------
1A12_ARATH      -----------------------------------
HIS8_THEP3      -----------------------------------
HIS8_GEOTN      -----------------------------------
HIS8_BRUSU      -----------------------------------
HIS8_BRUO2      -----------------------------------
HIS8_BRUAB      -----------------------------------
HIS8_BRUA2      -----------------------------------
HIS82_THICR     -----------------------------------
DAPAT_TRIEI     -----------------------------------
DAPAT_GEOUR     -----------------------------------
DAPAT_CLOTH     -----------------------------------
PATR_RHOSR      -----------------------------------
KAT_DICDI       -----------------------------------
HIS8_VIBHB      -----------------------------------
HIS8_SULTO      -----------------------------------
HIS8_LISMF      AALGFPTAVRITIGKEE------------------
HIS8_LISMC      AALGFPTAVRITIGKEE------------------
HIS8_GRABC      -----------------------------------
HIS8_GEOBB      -----------------------------------
HIS8_BDEBA      -----------------------------------
HIS8_BACV8      -----------------------------------
HIS8_AZOSE      -----------------------------------
HIS81_CAUCR     -----------------------------------
DAPAT_PELPD     -----------------------------------
DAPAT_HELMI     -----------------------------------
DAPAT_GEOSL     -----------------------------------
ALAM_YEAST      -----------------------------------
1A18_ARATH      -----------------------------------