[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for paer1:AAL65085.1

[Show Plain Result]


## Summary of Sequence Search
    1::364
    1::331     2e-52  35%  333 aa  Y808_METJA RecName: Full=Uncharacterized protein MJ0808;
   21::176     9e-11  31%  296 aa  MOAA_ARCFU RecName: Full=Probable molybdenum cofactor biosynthesis
   20::187     1e-09  30%  317 aa  MOAA_METS5 RecName: Full=Probable molybdenum cofactor biosynthesis
   21::182     3e-08  23%  320 aa  MOAA_AQUAE RecName: Full=Molybdenum cofactor biosynthesis protein
   21::191     5e-08  27%  307 aa  MOAA_UNCMA RecName: Full=Probable molybdenum cofactor biosynthesis
   22::175     5e-08  26%  324 aa  MOAA_THEAC RecName: Full=Probable molybdenum cofactor biosynthesis
    7::172     5e-08  27%  305 aa  MOAA_METTH RecName: Full=Probable molybdenum cofactor biosynthesis
   16::189     9e-08  25%  240 aa  Y1227_METJA RecName: Full=Uncharacterized protein MJ1227;
   22::175     9e-08  28%  326 aa  MOAA_THEVO RecName: Full=Probable molybdenum cofactor biosynthesis
   21::180     9e-08  26%  323 aa  MOAA_ARCB4 RecName: Full=Molybdenum cofactor biosynthesis protein
   19::207     1e-07  24%  246 aa  PFLA_SHIFL RecName: Full=Pyruvate formate-lyase 1-activating
   19::207     1e-07  24%  246 aa  PFLA_ECOLI RecName: Full=Pyruvate formate-lyase 1-activating
   19::207     1e-07  24%  246 aa  PFLA_ECOL6 RecName: Full=Pyruvate formate-lyase 1-activating
   19::207     1e-07  24%  246 aa  PFLA_ECO57 RecName: Full=Pyruvate formate-lyase 1-activating
   40::200     1e-07  26%  334 aa  MOAA_METMA RecName: Full=Probable molybdenum cofactor biosynthesis
    9::176     2e-07  27%  307 aa  MOAA_PYRKO RecName: Full=Probable molybdenum cofactor biosynthesis
    9::168     2e-07  28%  307 aa  MOAA_PYRFU RecName: Full=Probable molybdenum cofactor biosynthesis
   21::180     2e-07  27%  310 aa  MOAA_PYRAE RecName: Full=Probable molybdenum cofactor biosynthesis
   21::168     2e-07  25%  322 aa  MOAA_CAMFF RecName: Full=Molybdenum cofactor biosynthesis protein
   21::174     3e-07  25%  322 aa  MOAA_NITSB RecName: Full=Molybdenum cofactor biosynthesis protein
   20::172     4e-07  26%  322 aa  MOAA_THEYD RecName: Full=Molybdenum cofactor biosynthesis protein
   63::204     4e-07  30%  342 aa  BIOB_RHOPS RecName: Full=Biotin synthase;       
   59::200     6e-07  30%  353 aa  BIOB_RHOP2 RecName: Full=Biotin synthase;       
   29::129     8e-07  29%  334 aa  MOAA_VIBSL RecName: Full=Molybdenum cofactor biosynthesis protein
   21::180     8e-07  24%  318 aa  MOAA_NAUPA RecName: Full=Molybdenum cofactor biosynthesis protein
   40::208     8e-07  26%  334 aa  MOAA_METAC RecName: Full=Probable molybdenum cofactor biosynthesis
   72::214     8e-07  32%  349 aa  BIOB_SORC5 RecName: Full=Biotin synthase;       
   38::207     1e-06  26%  255 aa  Y1632_METJA RecName: Full=Uncharacterized protein MJ1632;
    9::163     1e-06  28%  310 aa  MOAA_PYRHO RecName: Full=Probable molybdenum cofactor biosynthesis
   46::215     1e-06  26%  333 aa  BIOB_SYNS9 RecName: Full=Biotin synthase;       
   29::129     1e-06  29%  334 aa  MOAA_VIBCM RecName: Full=Molybdenum cofactor biosynthesis protein
   29::129     1e-06  29%  334 aa  MOAA_VIBCH RecName: Full=Molybdenum cofactor biosynthesis protein
   29::129     1e-06  29%  334 aa  MOAA_VIBC3 RecName: Full=Molybdenum cofactor biosynthesis protein
   17::115     1e-06  30%  313 aa  MOAA_SULAC RecName: Full=Probable molybdenum cofactor biosynthesis
   29::129     2e-06  26%  334 aa  MOAA_VIBVY RecName: Full=Molybdenum cofactor biosynthesis protein
   29::129     2e-06  26%  334 aa  MOAA_VIBVU RecName: Full=Molybdenum cofactor biosynthesis protein
   46::215     2e-06  26%  331 aa  BIOB_SYNSC RecName: Full=Biotin synthase;       
   63::231     2e-06  28%  360 aa  BIOB_RALSO RecName: Full=Biotin synthase;       
   63::231     2e-06  29%  359 aa  BIOB_RALPJ RecName: Full=Biotin synthase;       
   21::174     3e-06  25%  321 aa  MOAA_HELPY RecName: Full=Molybdenum cofactor biosynthesis protein
   22::181     3e-06  26%  330 aa  MOAA_DESAD RecName: Full=Molybdenum cofactor biosynthesis protein
   29::129     4e-06  28%  334 aa  MOAA_VIBPA RecName: Full=Molybdenum cofactor biosynthesis protein
    9::168     4e-06  27%  306 aa  MOAA_PYRAB RecName: Full=Probable molybdenum cofactor biosynthesis
   21::174     5e-06  23%  326 aa  MOAA_SULNB RecName: Full=Molybdenum cofactor biosynthesis protein
   20::176     5e-06  26%  298 aa  MOAA_METJA RecName: Full=Probable molybdenum cofactor biosynthesis
   34::201     5e-06  25%  342 aa  MOAA_AERHH RecName: Full=Molybdenum cofactor biosynthesis protein
  117::295     8e-06  30%  433 aa  Y103_METJA RecName: Full=Uncharacterized protein MJ0103;
   30::160     8e-06  28%  389 aa  PQQE_PSEU2 RecName: Full=Coenzyme PQQ synthesis protein E;AltName:
    3::160     8e-06  28%  389 aa  PQQE_PSESM RecName: Full=Coenzyme PQQ synthesis protein E;AltName:
   36::192     8e-06  26%  263 aa  PFLA_STRMU RecName: Full=Pyruvate formate-lyase-activating enzyme; 
   20::116     8e-06  24%  297 aa  MOAA_METMP RecName: Full=Probable molybdenum cofactor biosynthesis
   20::116     8e-06  24%  298 aa  MOAA_METM5 RecName: Full=Probable molybdenum cofactor biosynthesis
   33::181     8e-06  29%  337 aa  MOAA_MANSM RecName: Full=Molybdenum cofactor biosynthesis protein
   21::174     8e-06  27%  321 aa  MOAA_HELP2 RecName: Full=Molybdenum cofactor biosynthesis protein
   34::187     8e-06  28%  346 aa  BIOB_KLEP7 RecName: Full=Biotin synthase;       
   30::160     1e-05  28%  389 aa  PQQE_PSE14 RecName: Full=Coenzyme PQQ synthesis protein E;AltName:
   26::187     1e-05  27%  251 aa  PFLA_STAES RecName: Full=Pyruvate formate-lyase-activating enzyme; 
   26::187     1e-05  27%  251 aa  PFLA_STAEQ RecName: Full=Pyruvate formate-lyase-activating enzyme; 
   20::207     1e-05  31%  323 aa  MOAA_MOOTA RecName: Full=Molybdenum cofactor biosynthesis protein
   20::116     1e-05  24%  298 aa  MOAA_METM7 RecName: Full=Probable molybdenum cofactor biosynthesis
   23::122     1e-05  36%  332 aa  MOAA_LACPL RecName: Full=Molybdenum cofactor biosynthesis protein
   18::174     1e-05  21%  322 aa  MOAA_CAMLR RecName: Full=Molybdenum cofactor biosynthesis protein
   20::171     1e-05  25%  320 aa  MOAA_ALKMQ RecName: Full=Molybdenum cofactor biosynthesis protein
   63::204     1e-05  28%  336 aa  BIOB_OCHA4 RecName: Full=Biotin synthase;       
   84::236     1e-05  28%  600 aa  MOCS1_CAEEL RecName: Full=Molybdenum cofactor biosynthesis protein
   20::186     1e-05  23%  313 aa  MOAA_SULTO RecName: Full=Probable molybdenum cofactor biosynthesis
   18::174     1e-05  22%  322 aa  MOAA_CAMC5 RecName: Full=Molybdenum cofactor biosynthesis protein
   20::179     2e-05  19%  319 aa  MOAA_CLOBL RecName: Full=Molybdenum cofactor biosynthesis protein
   20::179     2e-05  19%  319 aa  MOAA_CLOBJ RecName: Full=Molybdenum cofactor biosynthesis protein
   20::179     2e-05  19%  319 aa  MOAA_CLOBH RecName: Full=Molybdenum cofactor biosynthesis protein
   20::179     2e-05  19%  319 aa  MOAA_CLOB1 RecName: Full=Molybdenum cofactor biosynthesis protein
   85::248     2e-05  25%  390 aa  CNX2_ARATH RecName: Full=Molybdopterin biosynthesis protein
   34::187     2e-05  28%  346 aa  BIOB_ESCF3 RecName: Full=Biotin synthase;       
   47::188     2e-05  27%  341 aa  BIOB_ERYLH RecName: Full=Biotin synthase;       
   63::207     2e-05  27%  343 aa  BIOB2_POLSJ RecName: Full=Biotin synthase 2;       
   49::149     2e-05  31%  377 aa  PQQE_RAHAQ RecName: Full=Coenzyme PQQ synthesis protein E;AltName:
   19::172     2e-05  27%  382 aa  PQQE_ERWT9 RecName: Full=Coenzyme PQQ synthesis protein E;AltName:
   20::173     2e-05  26%  323 aa  MOAA_PETMO RecName: Full=Molybdenum cofactor biosynthesis protein
   36::135     2e-05  32%  340 aa  MOAA_HAEDU RecName: Full=Molybdenum cofactor biosynthesis protein
   20::179     2e-05  19%  319 aa  MOAA_CLOB6 RecName: Full=Molybdenum cofactor biosynthesis protein
   36::135     2e-05  33%  340 aa  MOAA_ACTPJ RecName: Full=Molybdenum cofactor biosynthesis protein
   36::135     2e-05  33%  340 aa  MOAA_ACTP7 RecName: Full=Molybdenum cofactor biosynthesis protein
   36::135     2e-05  33%  340 aa  MOAA_ACTP2 RecName: Full=Molybdenum cofactor biosynthesis protein
   51::223     2e-05  27%  338 aa  BIOB_SPHWW RecName: Full=Biotin synthase;       
   34::187     2e-05  28%  346 aa  BIOB_SHIFL RecName: Full=Biotin synthase;       
   34::187     2e-05  28%  346 aa  BIOB_SHIF8 RecName: Full=Biotin synthase;       
   34::187     2e-05  27%  346 aa  BIOB_SALAR RecName: Full=Biotin synthase;       
   34::187     2e-05  28%  346 aa  BIOB_ECO5E RecName: Full=Biotin synthase;       
   34::187     2e-05  28%  346 aa  BIOB_ECO57 RecName: Full=Biotin synthase;       
   29::178     3e-05  22%  246 aa  PFLA_HAEIN RecName: Full=Pyruvate formate-lyase 1-activating
   20::116     3e-05  23%  298 aa  MOAA_METM6 RecName: Full=Probable molybdenum cofactor biosynthesis
   20::169     3e-05  27%  299 aa  MOAA_META3 RecName: Full=Probable molybdenum cofactor biosynthesis
   20::179     3e-05  19%  319 aa  MOAA_CLOBM RecName: Full=Molybdenum cofactor biosynthesis protein
   46::215     3e-05  25%  325 aa  BIOB_SYNPX RecName: Full=Biotin synthase;       
   34::187     3e-05  28%  346 aa  BIOB_SHISS RecName: Full=Biotin synthase;       
   34::187     3e-05  28%  346 aa  BIOB_SHIDS RecName: Full=Biotin synthase;       
   59::200     3e-05  28%  336 aa  BIOB_RHOPT RecName: Full=Biotin synthase;       
   59::200     3e-05  28%  336 aa  BIOB_RHOPA RecName: Full=Biotin synthase;       
   64::201     3e-05  31%  341 aa  BIOB_METPB RecName: Full=Biotin synthase;       
   34::187     3e-05  28%  346 aa  BIOB_ECOSM RecName: Full=Biotin synthase;       
   34::187     3e-05  28%  346 aa  BIOB_ECOSE RecName: Full=Biotin synthase;       
   34::187     3e-05  28%  346 aa  BIOB_ECOLU RecName: Full=Biotin synthase;       
   34::187     3e-05  28%  346 aa  BIOB_ECOLI RecName: Full=Biotin synthase;       
   34::187     3e-05  28%  346 aa  BIOB_ECOLC RecName: Full=Biotin synthase;       
   34::187     3e-05  28%  346 aa  BIOB_ECOL5 RecName: Full=Biotin synthase;       
   34::187     3e-05  28%  346 aa  BIOB_ECOHS RecName: Full=Biotin synthase;       
   34::187     3e-05  28%  346 aa  BIOB_ECODH RecName: Full=Biotin synthase;       
   34::187     3e-05  28%  346 aa  BIOB_ECO8A RecName: Full=Biotin synthase;       
   34::187     3e-05  28%  346 aa  BIOB_ECO7I RecName: Full=Biotin synthase;       
   34::187     3e-05  28%  346 aa  BIOB_ECO55 RecName: Full=Biotin synthase;       
   34::187     3e-05  28%  346 aa  BIOB_ECO27 RecName: Full=Biotin synthase;       
   34::187     3e-05  28%  346 aa  BIOB_ECO24 RecName: Full=Biotin synthase;       
   50::204     3e-05  25%  332 aa  BIOB_AQUAE RecName: Full=Biotin synthase;       
   26::157     4e-05  30%  384 aa  PQQE_PSEMY RecName: Full=Coenzyme PQQ synthesis protein E;AltName:
   32::131     4e-05  26%  336 aa  MOAA_ACTSZ RecName: Full=Molybdenum cofactor biosynthesis protein
   15::192     4e-05  26%  331 aa  MOAA_ACAM1 RecName: Full=Molybdenum cofactor biosynthesis protein
   46::216     4e-05  25%  318 aa  BIOB_SILPO RecName: Full=Biotin synthase;       
   51::190     4e-05  30%  320 aa  BIOB_HYPNA RecName: Full=Biotin synthase;       
   34::187     4e-05  28%  346 aa  BIOB_ECOUT RecName: Full=Biotin synthase;       
   34::187     4e-05  28%  346 aa  BIOB_ECOL6 RecName: Full=Biotin synthase;       
   34::187     4e-05  28%  346 aa  BIOB_ECOK1 RecName: Full=Biotin synthase;       
   34::187     4e-05  28%  346 aa  BIOB_ECO81 RecName: Full=Biotin synthase;       
   34::187     4e-05  28%  346 aa  BIOB_ECO45 RecName: Full=Biotin synthase;       
   15::172     5e-05  29%  329 aa  MOAA_MICAN RecName: Full=Molybdenum cofactor biosynthesis protein
   64::179     5e-05  25%  325 aa  MOAA_EUBAC RecName: Full=Molybdenum cofactor biosynthesis protein
   18::178     5e-05  23%  320 aa  MOAA_CAMJR RecName: Full=Molybdenum cofactor biosynthesis protein
   18::178     5e-05  23%  320 aa  MOAA_CAMJJ RecName: Full=Molybdenum cofactor biosynthesis protein
   18::178     5e-05  23%  320 aa  MOAA_CAMJE RecName: Full=Molybdenum cofactor biosynthesis protein
   18::178     5e-05  23%  320 aa  MOAA_CAMJ8 RecName: Full=Molybdenum cofactor biosynthesis protein
   18::174     5e-05  21%  322 aa  MOAA_CAMC1 RecName: Full=Molybdenum cofactor biosynthesis protein
   27::180     5e-05  24%  341 aa  MOAA_BACSU RecName: Full=Molybdenum cofactor biosynthesis protein
  143::218     5e-05  33%  367 aa  BIOB_PSYWF RecName: Full=Biotin synthase;       
   59::200     5e-05  28%  339 aa  BIOB_JANMA RecName: Full=Biotin synthase;       
   19::172     7e-05  25%  377 aa  PQQE_ESCVU RecName: Full=Coenzyme PQQ synthesis protein E;AltName:
   33::132     7e-05  29%  337 aa  MOAA_PASMU RecName: Full=Molybdenum cofactor biosynthesis protein
   47::213     7e-05  26%  320 aa  BIOB_SYNP6 RecName: Full=Biotin synthase;       
   47::213     7e-05  26%  320 aa  BIOB_SYNE7 RecName: Full=Biotin synthase;       
   34::187     7e-05  27%  346 aa  BIOB_SALSV RecName: Full=Biotin synthase;       
   34::187     7e-05  27%  346 aa  BIOB_SALPK RecName: Full=Biotin synthase;       
   34::187     7e-05  27%  346 aa  BIOB_SALPA RecName: Full=Biotin synthase;       
   34::187     7e-05  27%  346 aa  BIOB_SALHS RecName: Full=Biotin synthase;       
   34::187     7e-05  27%  346 aa  BIOB_SALG2 RecName: Full=Biotin synthase;       
   34::187     7e-05  27%  346 aa  BIOB_SALEP RecName: Full=Biotin synthase;       
   34::187     7e-05  27%  346 aa  BIOB_SALDC RecName: Full=Biotin synthase;       
   47::161     7e-05  31%  335 aa  BIOB_NOSP7 RecName: Full=Biotin synthase;       
   58::195     7e-05  30%  335 aa  BIOB_METEP RecName: Full=Biotin synthase;       
   43::196     7e-05  28%  326 aa  BIOB_METCA RecName: Full=Biotin synthase;       
   58::195     7e-05  30%  335 aa  BIOB_METC4 RecName: Full=Biotin synthase;       
   36::189     7e-05  30%  326 aa  BIOB_HALHL RecName: Full=Biotin synthase;       
   57::202     7e-05  27%  329 aa  BIOB_GEOSF RecName: Full=Biotin synthase;       
   34::187     7e-05  27%  346 aa  BIOB_CITK8 RecName: Full=Biotin synthase;       
   11::119     9e-05  34%  357 aa  MOAA_HALSA RecName: Full=Probable molybdenum cofactor biosynthesis
   11::119     9e-05  34%  357 aa  MOAA_HALS3 RecName: Full=Probable molybdenum cofactor biosynthesis
   20::179     9e-05  19%  319 aa  MOAA_CLOBK RecName: Full=Molybdenum cofactor biosynthesis protein
   47::216     9e-05  27%  326 aa  BIOB_SYNR3 RecName: Full=Biotin synthase;       
   34::187     9e-05  27%  346 aa  BIOB_SALTY RecName: Full=Biotin synthase;       
   34::187     9e-05  27%  346 aa  BIOB_SALTI RecName: Full=Biotin synthase;       
   34::187     9e-05  27%  346 aa  BIOB_SALPC RecName: Full=Biotin synthase;       
   34::187     9e-05  27%  346 aa  BIOB_SALPB RecName: Full=Biotin synthase;       
   34::187     9e-05  27%  346 aa  BIOB_SALNS RecName: Full=Biotin synthase;       
   34::187     9e-05  27%  346 aa  BIOB_SALCH RecName: Full=Biotin synthase;       
   34::187     9e-05  27%  346 aa  BIOB_SALA4 RecName: Full=Biotin synthase;       
   59::200     9e-05  26%  338 aa  BIOB_RHOP5 RecName: Full=Biotin synthase;       
   26::180     1e-04  26%  251 aa  PFLA_STAAW RecName: Full=Pyruvate formate-lyase-activating enzyme; 
   26::180     1e-04  26%  251 aa  PFLA_STAAS RecName: Full=Pyruvate formate-lyase-activating enzyme; 
   26::180     1e-04  26%  251 aa  PFLA_STAAR RecName: Full=Pyruvate formate-lyase-activating enzyme; 
   26::180     1e-04  26%  251 aa  PFLA_STAAN RecName: Full=Pyruvate formate-lyase-activating enzyme; 
   26::180     1e-04  26%  251 aa  PFLA_STAAM RecName: Full=Pyruvate formate-lyase-activating enzyme; 
   26::180     1e-04  26%  251 aa  PFLA_STAAC RecName: Full=Pyruvate formate-lyase-activating enzyme; 
   26::180     1e-04  26%  251 aa  PFLA_STAAB RecName: Full=Pyruvate formate-lyase-activating enzyme; 
   26::180     1e-04  26%  251 aa  PFLA_STAA8 RecName: Full=Pyruvate formate-lyase-activating enzyme; 
   26::180     1e-04  26%  251 aa  PFLA_STAA3 RecName: Full=Pyruvate formate-lyase-activating enzyme; 
   20::116     1e-04  26%  297 aa  MOAA_METVS RecName: Full=Probable molybdenum cofactor biosynthesis
   34::187     1e-04  27%  346 aa  BIOB_SHIBS RecName: Full=Biotin synthase;       
   34::187     1e-04  27%  346 aa  BIOB_SHIB3 RecName: Full=Biotin synthase;       
   24::182     2e-04  23%  340 aa  MOAA_STAHJ RecName: Full=Molybdenum cofactor biosynthesis protein
   18::178     2e-04  22%  320 aa  MOAA_CAMJD RecName: Full=Molybdenum cofactor biosynthesis protein
   67::211     2e-04  25%  337 aa  BIOB_NITEU RecName: Full=Biotin synthase;       
   34::187     2e-04  27%  346 aa  BIOB_KLEP3 RecName: Full=Biotin synthase;       
   47::178     2e-04  27%  286 aa  Y804_METJA RecName: Full=Uncharacterized protein MJ0804;
   31::161     2e-04  26%  389 aa  PQQE_PSEF5 RecName: Full=Coenzyme PQQ synthesis protein E;AltName:
   18::189     2e-04  28%  373 aa  PQQE_METSB RecName: Full=Coenzyme PQQ synthesis protein E;AltName:
   30::109     2e-04  34%  248 aa  PFLA_LISMO RecName: Full=Pyruvate formate-lyase-activating enzyme; 
   30::109     2e-04  34%  248 aa  PFLA_LISMF RecName: Full=Pyruvate formate-lyase-activating enzyme; 
   30::109     2e-04  34%  248 aa  PFLA_LISIN RecName: Full=Pyruvate formate-lyase-activating enzyme; 
   21::174     2e-04  24%  321 aa  MOAA_SULDN RecName: Full=Molybdenum cofactor biosynthesis protein
   25::303     2e-04  23%  332 aa  MOAA_PSESM RecName: Full=Molybdenum cofactor biosynthesis protein
   25::303     2e-04  23%  332 aa  MOAA_PSE14 RecName: Full=Molybdenum cofactor biosynthesis protein
   24::122     2e-04  27%  327 aa  MOAA_PHOLL RecName: Full=Molybdenum cofactor biosynthesis protein
   64::208     2e-04  26%  345 aa  BIOB_LEPCP RecName: Full=Biotin synthase;       
   15::169     3e-04  27%  325 aa  MOAA_SYNJB RecName: Full=Molybdenum cofactor biosynthesis protein
   20::183     3e-04  28%  325 aa  MOAA_PELTS RecName: Full=Molybdenum cofactor biosynthesis protein
   35::201     3e-04  25%  344 aa  MOAA_BRUSU RecName: Full=Molybdenum cofactor biosynthesis protein
   35::201     3e-04  25%  344 aa  MOAA_BRUSI RecName: Full=Molybdenum cofactor biosynthesis protein
   35::201     3e-04  25%  344 aa  MOAA_BRUME RecName: Full=Molybdenum cofactor biosynthesis protein
   35::201     3e-04  25%  344 aa  MOAA_BRUMB RecName: Full=Molybdenum cofactor biosynthesis protein
   35::201     3e-04  25%  344 aa  MOAA_BRUC2 RecName: Full=Molybdenum cofactor biosynthesis protein
   43::187     3e-04  27%  341 aa  BIOB_WIGBR RecName: Full=Biotin synthase;       
  105::238     3e-04  29%  362 aa  BIOB_DESVH RecName: Full=Biotin synthase;       
   67::235     3e-04  25%  360 aa  BIOB_BURXL RecName: Full=Biotin synthase;       
   68::236     3e-04  25%  361 aa  BIOB_BURPP RecName: Full=Biotin synthase;       
   28::172     4e-04  24%  238 aa  PFLA_CLOPA RecName: Full=Pyruvate formate-lyase-activating enzyme; 
   24::182     4e-04  21%  340 aa  MOAA_STACT RecName: Full=Molybdenum cofactor biosynthesis protein
   24::182     4e-04  21%  340 aa  MOAA_STAAW RecName: Full=Molybdenum cofactor biosynthesis protein
   24::182     4e-04  21%  340 aa  MOAA_STAAT RecName: Full=Molybdenum cofactor biosynthesis protein
   24::182     4e-04  21%  340 aa  MOAA_STAAS RecName: Full=Molybdenum cofactor biosynthesis protein
   24::182     4e-04  21%  340 aa  MOAA_STAAR RecName: Full=Molybdenum cofactor biosynthesis protein
   24::182     4e-04  21%  340 aa  MOAA_STAAN RecName: Full=Molybdenum cofactor biosynthesis protein
   24::182     4e-04  21%  340 aa  MOAA_STAAE RecName: Full=Molybdenum cofactor biosynthesis protein
   24::182     4e-04  21%  340 aa  MOAA_STAAC RecName: Full=Molybdenum cofactor biosynthesis protein
   24::182     4e-04  21%  340 aa  MOAA_STAA9 RecName: Full=Molybdenum cofactor biosynthesis protein
   24::182     4e-04  21%  340 aa  MOAA_STAA8 RecName: Full=Molybdenum cofactor biosynthesis protein
   24::182     4e-04  21%  340 aa  MOAA_STAA3 RecName: Full=Molybdenum cofactor biosynthesis protein
   24::182     4e-04  21%  340 aa  MOAA_STAA2 RecName: Full=Molybdenum cofactor biosynthesis protein
   21::174     4e-04  22%  321 aa  MOAA_HELPJ RecName: Full=Molybdenum cofactor biosynthesis protein
   33::186     4e-04  22%  337 aa  MOAA_HAEI8 RecName: Full=Molybdenum cofactor biosynthesis protein
   22::193     4e-04  26%  326 aa  MOAA_GEOSL RecName: Full=Molybdenum cofactor biosynthesis protein
   27::181     4e-04  27%  330 aa  MOAA_CHLTE RecName: Full=Molybdenum cofactor biosynthesis protein
   34::187     4e-04  26%  345 aa  BIOB_SODGM RecName: Full=Biotin synthase;       
   65::209     4e-04  25%  345 aa  BIOB_POLNA RecName: Full=Biotin synthase;       
   34::187     4e-04  27%  346 aa  BIOB_ESCVU RecName: Full=Biotin synthase;       
   51::195     4e-04  25%  323 aa  BIOB_BORA1 RecName: Full=Biotin synthase;       
   18::148     5e-04  25%  376 aa  PQQE_PSEPK RecName: Full=Coenzyme PQQ synthesis protein E;AltName:
   17::186     5e-04  27%  308 aa  MOAA_SULSO RecName: Full=Probable molybdenum cofactor biosynthesis
   24::124     5e-04  26%  329 aa  MOAA_SHISS RecName: Full=Molybdenum cofactor biosynthesis protein
   24::124     5e-04  26%  329 aa  MOAA_SHIFL RecName: Full=Molybdenum cofactor biosynthesis protein
   24::124     5e-04  26%  329 aa  MOAA_SHIDS RecName: Full=Molybdenum cofactor biosynthesis protein
   24::124     5e-04  26%  329 aa  MOAA_SHIBS RecName: Full=Molybdenum cofactor biosynthesis protein
   24::124     5e-04  26%  329 aa  MOAA_SHIB3 RecName: Full=Molybdenum cofactor biosynthesis protein
   24::124     5e-04  26%  329 aa  MOAA_ESCF3 RecName: Full=Molybdenum cofactor biosynthesis protein
   24::124     5e-04  26%  329 aa  MOAA_ECOSM RecName: Full=Molybdenum cofactor biosynthesis protein
   24::124     5e-04  26%  329 aa  MOAA_ECOSE RecName: Full=Molybdenum cofactor biosynthesis protein
   24::124     5e-04  26%  329 aa  MOAA_ECOLU RecName: Full=Molybdenum cofactor biosynthesis protein
   24::124     5e-04  26%  329 aa  MOAA_ECOL6 RecName: Full=Molybdenum cofactor biosynthesis protein
   24::124     5e-04  26%  329 aa  MOAA_ECOHS RecName: Full=Molybdenum cofactor biosynthesis protein
   24::124     5e-04  26%  329 aa  MOAA_ECO8A RecName: Full=Molybdenum cofactor biosynthesis protein
   24::124     5e-04  26%  329 aa  MOAA_ECO81 RecName: Full=Molybdenum cofactor biosynthesis protein
   24::124     5e-04  26%  329 aa  MOAA_ECO7I RecName: Full=Molybdenum cofactor biosynthesis protein
   24::124     5e-04  26%  329 aa  MOAA_ECO5E RecName: Full=Molybdenum cofactor biosynthesis protein
   24::124     5e-04  26%  329 aa  MOAA_ECO57 RecName: Full=Molybdenum cofactor biosynthesis protein
   24::124     5e-04  26%  329 aa  MOAA_ECO55 RecName: Full=Molybdenum cofactor biosynthesis protein
   24::124     5e-04  26%  329 aa  MOAA_ECO45 RecName: Full=Molybdenum cofactor biosynthesis protein
   24::124     5e-04  26%  329 aa  MOAA_ECO27 RecName: Full=Molybdenum cofactor biosynthesis protein
   24::124     5e-04  26%  329 aa  MOAA_ECO24 RecName: Full=Molybdenum cofactor biosynthesis protein
   15::190     5e-04  25%  329 aa  MOAA_CYAP4 RecName: Full=Molybdenum cofactor biosynthesis protein
   35::189     5e-04  26%  344 aa  MOAA_BRUO2 RecName: Full=Molybdenum cofactor biosynthesis protein
   71::215     5e-04  25%  345 aa  BIOB_RALME RecName: Full=Biotin synthase;       
  124::220     5e-04  25%  335 aa  BIOB_PROM5 RecName: Full=Biotin synthase;       
   52::220     5e-04  25%  335 aa  BIOB_PROM0 RecName: Full=Biotin synthase;       
   59::227     5e-04  25%  336 aa  BIOB_BURTA RecName: Full=Biotin synthase;       
   59::227     5e-04  25%  336 aa  BIOB_BURPS RecName: Full=Biotin synthase;       
   59::227     5e-04  25%  336 aa  BIOB_BURP6 RecName: Full=Biotin synthase;       
   59::227     5e-04  25%  336 aa  BIOB_BURP1 RecName: Full=Biotin synthase;       
   59::227     5e-04  25%  336 aa  BIOB_BURP0 RecName: Full=Biotin synthase;       
   59::227     5e-04  25%  336 aa  BIOB_BURMS RecName: Full=Biotin synthase;       
   59::227     5e-04  25%  336 aa  BIOB_BURMA RecName: Full=Biotin synthase;       
   59::227     5e-04  25%  336 aa  BIOB_BURM9 RecName: Full=Biotin synthase;       
   59::227     5e-04  25%  336 aa  BIOB_BURM7 RecName: Full=Biotin synthase;       
   19::172     6e-04  27%  380 aa  PQQE_KLEP3 RecName: Full=Coenzyme PQQ synthesis protein E;AltName:
   30::131     6e-04  27%  336 aa  MOAA_TOLAT RecName: Full=Molybdenum cofactor biosynthesis protein
   24::182     6e-04  21%  340 aa  MOAA_STAAM RecName: Full=Molybdenum cofactor biosynthesis protein
   24::182     6e-04  21%  340 aa  MOAA_STAAB RecName: Full=Molybdenum cofactor biosynthesis protein
   24::182     6e-04  21%  340 aa  MOAA_STAA1 RecName: Full=Molybdenum cofactor biosynthesis protein
   11::119     6e-04  32%  323 aa  MOAA_HALWD RecName: Full=Probable molybdenum cofactor biosynthesis
   40::190     6e-04  28%  328 aa  BIOB_SYNS3 RecName: Full=Biotin synthase;       
   44::188     6e-04  26%  322 aa  BIOB_RUTMC RecName: Full=Biotin synthase;       
   52::220     6e-04  25%  335 aa  BIOB_PROMS RecName: Full=Biotin synthase;       
   52::220     6e-04  25%  335 aa  BIOB_PROM9 RecName: Full=Biotin synthase;       
   62::197     6e-04  24%  319 aa  BIOB_CLOP1 RecName: Full=Biotin synthase;       
  128::228     6e-04  27%  361 aa  BIOB_ANASK RecName: Full=Biotin synthase;       
  128::228     6e-04  27%  361 aa  BIOB_ANAD2 RecName: Full=Biotin synthase;       
   61::202     6e-04  27%  339 aa  BIOB_AGRT5 RecName: Full=Biotin synthase;       
  204::300     8e-04  35%  351 aa  RLMN_SYNPW RecName: Full=Ribosomal RNA large subunit
   20::130     8e-04  28%  326 aa  MOAA_STRM5 RecName: Full=Molybdenum cofactor biosynthesis protein
   49::149     8e-04  26%  359 aa  MOAA_RHOBA RecName: Full=Molybdenum cofactor biosynthesis protein
   17::129     8e-04  29%  307 aa  MOAA_METKA RecName: Full=Probable molybdenum cofactor biosynthesis
   24::124     8e-04  26%  329 aa  MOAA_ECOLI RecName: Full=Molybdenum cofactor biosynthesis protein
   24::124     8e-04  26%  329 aa  MOAA_ECODH RecName: Full=Molybdenum cofactor biosynthesis protein
   24::124     8e-04  26%  329 aa  MOAA_ECOBW RecName: Full=Molybdenum cofactor biosynthesis protein
   89::172     8e-04  27%  329 aa  MOAA_CYAP8 RecName: Full=Molybdenum cofactor biosynthesis protein
  129::213     8e-04  30%  316 aa  BIOB_GLUDA RecName: Full=Biotin synthase;       
   62::197     8e-04  24%  319 aa  BIOB_CLOPE RecName: Full=Biotin synthase;       
    1::364

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxVRESPYQTREEGGSVVCTLCHRRCRLPPGKIGACGMRFNLGGRXXX
Y808_METJA      ------------------------MREAMFYEKLDDNKVRCHICPRHCIIKEGERGFCWNRENINGVLYA
MOAA_ARCFU      ----------------------------------------------------------------------
MOAA_METS5      ----------------------------------------------------------------------
MOAA_AQUAE      ----------------------------------------------------------------------
MOAA_UNCMA      ----------------------------------------------------------------------
MOAA_THEAC      ----------------------------------------------------------------------
MOAA_METTH      ----------------------------------------------------------------------
Y1227_METJA     ----------------------------------------------------------------------
MOAA_THEVO      ----------------------------------------------------------------------
MOAA_ARCB4      ----------------------------------------------------------------------
PFLA_SHIFL      ----------------------------------------------------------------------
PFLA_ECOLI      ----------------------------------------------------------------------
PFLA_ECOL6      ----------------------------------------------------------------------
PFLA_ECO57      ----------------------------------------------------------------------
MOAA_METMA      ----------------------------------------------------------------------
MOAA_PYRKO      ----------------------------------------------------------------------
MOAA_PYRFU      ----------------------------------------------------------------------
MOAA_PYRAE      ----------------------------------------------------------------------
MOAA_CAMFF      ----------------------------------------------------------------------
MOAA_NITSB      ----------------------------------------------------------------------
MOAA_THEYD      ----------------------------------------------------------------------
BIOB_RHOPS      ----------------------------------------------------------------------
BIOB_RHOP2      ----------------------------------------------------------------------
MOAA_VIBSL      ----------------------------------------------------------------------
MOAA_NAUPA      ----------------------------------------------------------------------
MOAA_METAC      ----------------------------------------------------------------------
BIOB_SORC5      ----------------------------------------------------------------------
Y1632_METJA     ----------------------------------------------------------------------
MOAA_PYRHO      ----------------------------------------------------------------------
BIOB_SYNS9      ----------------------------------------------------------------------
MOAA_VIBCM      ----------------------------------------------------------------------
MOAA_VIBCH      ----------------------------------------------------------------------
MOAA_VIBC3      ----------------------------------------------------------------------
MOAA_SULAC      ----------------------------------------------------------------------
MOAA_VIBVY      ----------------------------------------------------------------------
MOAA_VIBVU      ----------------------------------------------------------------------
BIOB_SYNSC      ----------------------------------------------------------------------
BIOB_RALSO      ----------------------------------------------------------------------
BIOB_RALPJ      ----------------------------------------------------------------------
MOAA_HELPY      ----------------------------------------------------------------------
MOAA_DESAD      ----------------------------------------------------------------------
MOAA_VIBPA      ----------------------------------------------------------------------
MOAA_PYRAB      ----------------------------------------------------------------------
MOAA_SULNB      ----------------------------------------------------------------------
MOAA_METJA      ----------------------------------------------------------------------
MOAA_AERHH      ----------------------------------------------------------------------
Y103_METJA      ----------------------------------------------------------------------
PQQE_PSEU2      ----------------------------------------------------------------------
PQQE_PSESM      ----------------------------------------------------------------------
PFLA_STRMU      ----------------------------------------------------------------------
MOAA_METMP      ----------------------------------------------------------------------
MOAA_METM5      ----------------------------------------------------------------------
MOAA_MANSM      ----------------------------------------------------------------------
MOAA_HELP2      ----------------------------------------------------------------------
BIOB_KLEP7      ----------------------------------------------------------------------
PQQE_PSE14      ----------------------------------------------------------------------
PFLA_STAES      ----------------------------------------------------------------------
PFLA_STAEQ      ----------------------------------------------------------------------
MOAA_MOOTA      ----------------------------------------------------------------------
MOAA_METM7      ----------------------------------------------------------------------
MOAA_LACPL      ----------------------------------------------------------------------
MOAA_CAMLR      ----------------------------------------------------------------------
MOAA_ALKMQ      ----------------------------------------------------------------------
BIOB_OCHA4      ----------------------------------------------------------------------
MOCS1_CAEEL     ----------------------------------------------------------------------
MOAA_SULTO      ----------------------------------------------------------------------
MOAA_CAMC5      ----------------------------------------------------------------------
MOAA_CLOBL      ----------------------------------------------------------------------
MOAA_CLOBJ      ----------------------------------------------------------------------
MOAA_CLOBH      ----------------------------------------------------------------------
MOAA_CLOB1      ----------------------------------------------------------------------
CNX2_ARATH      ----------------------------------------------------------------------
BIOB_ESCF3      ----------------------------------------------------------------------
BIOB_ERYLH      ----------------------------------------------------------------------
BIOB2_POLSJ     ----------------------------------------------------------------------
PQQE_RAHAQ      ----------------------------------------------------------------------
PQQE_ERWT9      ----------------------------------------------------------------------
MOAA_PETMO      ----------------------------------------------------------------------
MOAA_HAEDU      ----------------------------------------------------------------------
MOAA_CLOB6      ----------------------------------------------------------------------
MOAA_ACTPJ      ----------------------------------------------------------------------
MOAA_ACTP7      ----------------------------------------------------------------------
MOAA_ACTP2      ----------------------------------------------------------------------
BIOB_SPHWW      ----------------------------------------------------------------------
BIOB_SHIFL      ----------------------------------------------------------------------
BIOB_SHIF8      ----------------------------------------------------------------------
BIOB_SALAR      ----------------------------------------------------------------------
BIOB_ECO5E      ----------------------------------------------------------------------
BIOB_ECO57      ----------------------------------------------------------------------
PFLA_HAEIN      ----------------------------------------------------------------------
MOAA_METM6      ----------------------------------------------------------------------
MOAA_META3      ----------------------------------------------------------------------
MOAA_CLOBM      ----------------------------------------------------------------------
BIOB_SYNPX      ----------------------------------------------------------------------
BIOB_SHISS      ----------------------------------------------------------------------
BIOB_SHIDS      ----------------------------------------------------------------------
BIOB_RHOPT      ----------------------------------------------------------------------
BIOB_RHOPA      ----------------------------------------------------------------------
BIOB_METPB      ----------------------------------------------------------------------
BIOB_ECOSM      ----------------------------------------------------------------------
BIOB_ECOSE      ----------------------------------------------------------------------
BIOB_ECOLU      ----------------------------------------------------------------------
BIOB_ECOLI      ----------------------------------------------------------------------
BIOB_ECOLC      ----------------------------------------------------------------------
BIOB_ECOL5      ----------------------------------------------------------------------
BIOB_ECOHS      ----------------------------------------------------------------------
BIOB_ECODH      ----------------------------------------------------------------------
BIOB_ECO8A      ----------------------------------------------------------------------
BIOB_ECO7I      ----------------------------------------------------------------------
BIOB_ECO55      ----------------------------------------------------------------------
BIOB_ECO27      ----------------------------------------------------------------------
BIOB_ECO24      ----------------------------------------------------------------------
BIOB_AQUAE      ----------------------------------------------------------------------
PQQE_PSEMY      ----------------------------------------------------------------------
MOAA_ACTSZ      ----------------------------------------------------------------------
MOAA_ACAM1      ----------------------------------------------------------------------
BIOB_SILPO      ----------------------------------------------------------------------
BIOB_HYPNA      ----------------------------------------------------------------------
BIOB_ECOUT      ----------------------------------------------------------------------
BIOB_ECOL6      ----------------------------------------------------------------------
BIOB_ECOK1      ----------------------------------------------------------------------
BIOB_ECO81      ----------------------------------------------------------------------
BIOB_ECO45      ----------------------------------------------------------------------
MOAA_MICAN      ----------------------------------------------------------------------
MOAA_EUBAC      ----------------------------------------------------------------------
MOAA_CAMJR      ----------------------------------------------------------------------
MOAA_CAMJJ      ----------------------------------------------------------------------
MOAA_CAMJE      ----------------------------------------------------------------------
MOAA_CAMJ8      ----------------------------------------------------------------------
MOAA_CAMC1      ----------------------------------------------------------------------
MOAA_BACSU      ----------------------------------------------------------------------
BIOB_PSYWF      ----------------------------------------------------------------------
BIOB_JANMA      ----------------------------------------------------------------------
PQQE_ESCVU      ----------------------------------------------------------------------
MOAA_PASMU      ----------------------------------------------------------------------
BIOB_SYNP6      ----------------------------------------------------------------------
BIOB_SYNE7      ----------------------------------------------------------------------
BIOB_SALSV      ----------------------------------------------------------------------
BIOB_SALPK      ----------------------------------------------------------------------
BIOB_SALPA      ----------------------------------------------------------------------
BIOB_SALHS      ----------------------------------------------------------------------
BIOB_SALG2      ----------------------------------------------------------------------
BIOB_SALEP      ----------------------------------------------------------------------
BIOB_SALDC      ----------------------------------------------------------------------
BIOB_NOSP7      ----------------------------------------------------------------------
BIOB_METEP      ----------------------------------------------------------------------
BIOB_METCA      ----------------------------------------------------------------------
BIOB_METC4      ----------------------------------------------------------------------
BIOB_HALHL      ----------------------------------------------------------------------
BIOB_GEOSF      ----------------------------------------------------------------------
BIOB_CITK8      ----------------------------------------------------------------------
MOAA_HALSA      ----------------------------------------------------------------------
MOAA_HALS3      ----------------------------------------------------------------------
MOAA_CLOBK      ----------------------------------------------------------------------
BIOB_SYNR3      ----------------------------------------------------------------------
BIOB_SALTY      ----------------------------------------------------------------------
BIOB_SALTI      ----------------------------------------------------------------------
BIOB_SALPC      ----------------------------------------------------------------------
BIOB_SALPB      ----------------------------------------------------------------------
BIOB_SALNS      ----------------------------------------------------------------------
BIOB_SALCH      ----------------------------------------------------------------------
BIOB_SALA4      ----------------------------------------------------------------------
BIOB_RHOP5      ----------------------------------------------------------------------
PFLA_STAAW      ----------------------------------------------------------------------
PFLA_STAAS      ----------------------------------------------------------------------
PFLA_STAAR      ----------------------------------------------------------------------
PFLA_STAAN      ----------------------------------------------------------------------
PFLA_STAAM      ----------------------------------------------------------------------
PFLA_STAAC      ----------------------------------------------------------------------
PFLA_STAAB      ----------------------------------------------------------------------
PFLA_STAA8      ----------------------------------------------------------------------
PFLA_STAA3      ----------------------------------------------------------------------
MOAA_METVS      ----------------------------------------------------------------------
BIOB_SHIBS      ----------------------------------------------------------------------
BIOB_SHIB3      ----------------------------------------------------------------------
MOAA_STAHJ      ----------------------------------------------------------------------
MOAA_CAMJD      ----------------------------------------------------------------------
BIOB_NITEU      ----------------------------------------------------------------------
BIOB_KLEP3      ----------------------------------------------------------------------
Y804_METJA      ----------------------------------------------------------------------
PQQE_PSEF5      ----------------------------------------------------------------------
PQQE_METSB      ----------------------------------------------------------------------
PFLA_LISMO      ----------------------------------------------------------------------
PFLA_LISMF      ----------------------------------------------------------------------
PFLA_LISIN      ----------------------------------------------------------------------
MOAA_SULDN      ----------------------------------------------------------------------
MOAA_PSESM      ----------------------------------------------------------------------
MOAA_PSE14      ----------------------------------------------------------------------
MOAA_PHOLL      ----------------------------------------------------------------------
BIOB_LEPCP      ----------------------------------------------------------------------
MOAA_SYNJB      ----------------------------------------------------------------------
MOAA_PELTS      ----------------------------------------------------------------------
MOAA_BRUSU      ----------------------------------------------------------------------
MOAA_BRUSI      ----------------------------------------------------------------------
MOAA_BRUME      ----------------------------------------------------------------------
MOAA_BRUMB      ----------------------------------------------------------------------
MOAA_BRUC2      ----------------------------------------------------------------------
BIOB_WIGBR      ----------------------------------------------------------------------
BIOB_DESVH      ----------------------------------------------------------------------
BIOB_BURXL      ----------------------------------------------------------------------
BIOB_BURPP      ----------------------------------------------------------------------
PFLA_CLOPA      ----------------------------------------------------------------------
MOAA_STACT      ----------------------------------------------------------------------
MOAA_STAAW      ----------------------------------------------------------------------
MOAA_STAAT      ----------------------------------------------------------------------
MOAA_STAAS      ----------------------------------------------------------------------
MOAA_STAAR      ----------------------------------------------------------------------
MOAA_STAAN      ----------------------------------------------------------------------
MOAA_STAAE      ----------------------------------------------------------------------
MOAA_STAAC      ----------------------------------------------------------------------
MOAA_STAA9      ----------------------------------------------------------------------
MOAA_STAA8      ----------------------------------------------------------------------
MOAA_STAA3      ----------------------------------------------------------------------
MOAA_STAA2      ----------------------------------------------------------------------
MOAA_HELPJ      ----------------------------------------------------------------------
MOAA_HAEI8      ----------------------------------------------------------------------
MOAA_GEOSL      ----------------------------------------------------------------------
MOAA_CHLTE      ----------------------------------------------------------------------
BIOB_SODGM      ----------------------------------------------------------------------
BIOB_POLNA      ----------------------------------------------------------------------
BIOB_ESCVU      ----------------------------------------------------------------------
BIOB_BORA1      ----------------------------------------------------------------------
PQQE_PSEPK      ----------------------------------------------------------------------
MOAA_SULSO      ----------------------------------------------------------------------
MOAA_SHISS      ----------------------------------------------------------------------
MOAA_SHIFL      ----------------------------------------------------------------------
MOAA_SHIDS      ----------------------------------------------------------------------
MOAA_SHIBS      ----------------------------------------------------------------------
MOAA_SHIB3      ----------------------------------------------------------------------
MOAA_ESCF3      ----------------------------------------------------------------------
MOAA_ECOSM      ----------------------------------------------------------------------
MOAA_ECOSE      ----------------------------------------------------------------------
MOAA_ECOLU      ----------------------------------------------------------------------
MOAA_ECOL6      ----------------------------------------------------------------------
MOAA_ECOHS      ----------------------------------------------------------------------
MOAA_ECO8A      ----------------------------------------------------------------------
MOAA_ECO81      ----------------------------------------------------------------------
MOAA_ECO7I      ----------------------------------------------------------------------
MOAA_ECO5E      ----------------------------------------------------------------------
MOAA_ECO57      ----------------------------------------------------------------------
MOAA_ECO55      ----------------------------------------------------------------------
MOAA_ECO45      ----------------------------------------------------------------------
MOAA_ECO27      ----------------------------------------------------------------------
MOAA_ECO24      ----------------------------------------------------------------------
MOAA_CYAP4      ----------------------------------------------------------------------
MOAA_BRUO2      ----------------------------------------------------------------------
BIOB_RALME      ----------------------------------------------------------------------
BIOB_PROM5      ----------------------------------------------------------------------
BIOB_PROM0      ----------------------------------------------------------------------
BIOB_BURTA      ----------------------------------------------------------------------
BIOB_BURPS      ----------------------------------------------------------------------
BIOB_BURP6      ----------------------------------------------------------------------
BIOB_BURP1      ----------------------------------------------------------------------
BIOB_BURP0      ----------------------------------------------------------------------
BIOB_BURMS      ----------------------------------------------------------------------
BIOB_BURMA      ----------------------------------------------------------------------
BIOB_BURM9      ----------------------------------------------------------------------
BIOB_BURM7      ----------------------------------------------------------------------
PQQE_KLEP3      ----------------------------------------------------------------------
MOAA_TOLAT      ----------------------------------------------------------------------
MOAA_STAAM      ----------------------------------------------------------------------
MOAA_STAAB      ----------------------------------------------------------------------
MOAA_STAA1      ----------------------------------------------------------------------
MOAA_HALWD      ----------------------------------------------------------------------
BIOB_SYNS3      ----------------------------------------------------------------------
BIOB_RUTMC      ----------------------------------------------------------------------
BIOB_PROMS      ----------------------------------------------------------------------
BIOB_PROM9      ----------------------------------------------------------------------
BIOB_CLOP1      ----------------------------------------------------------------------
BIOB_ANASK      ----------------------------------------------------------------------
BIOB_ANAD2      ----------------------------------------------------------------------
BIOB_AGRT5      ----------------------------------------------------------------------
RLMN_SYNPW      ----------------------------------------------------------------------
MOAA_STRM5      ----------------------------------------------------------------------
MOAA_RHOBA      ----------------------------------------------------------------------
MOAA_METKA      ----------------------------------------------------------------------
MOAA_ECOLI      ----------------------------------------------------------------------
MOAA_ECODH      ----------------------------------------------------------------------
MOAA_ECOBW      ----------------------------------------------------------------------
MOAA_CYAP8      ----------------------------------------------------------------------
BIOB_GLUDA      ----------------------------------------------------------------------
BIOB_CLOPE      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXESRPMEIKPLYHFYPGTSAVTISTWGCNFPCAWCQNWHLSKTASPAGAYVPPERVVEWALE
Y808_METJA      VGYGKVCSLAIDPIEKKPLFHFYPTTQVVSLAIGGCNFRCLHCQNWTISQFPPDEIPYMTPEEIVEVAIR
MOAA_ARCFU      -----------------------------------CNLRCFYC---HKEGESNP-GEEISAERIVEIARA
MOAA_METS5      -----------------------------------CNFSCFFC---HMEGEDTESMQGLSPHQVSRVAVE
MOAA_AQUAE      -----------------------------------CNLRCNFCMPPGKEYNFLPKRQLLTPEEIEEYVAK
MOAA_UNCMA      -----------------------------------CNLKCIYCHN----EGEEDSGSEITVEEVAQIAAR
MOAA_THEAC      -----------------------------------CNFSCFFC---HMEGTDVNGEELTPEERVVKISHE
MOAA_METTH      --------------------HGRPVMSLRLSITGRCNVNCIYCHRDGMTSSRGELSA-ADIEKLCRVASD
Y1227_METJA     ----------------------YPKKASAVIFLYGCNMKCPYCHNLKFMLEHKRGMTVEEIFNDIDFLFA
MOAA_THEVO      -----------------------------------CNFNCFFC---HMEGTEISGEALKPEERVVKIAHK
MOAA_ARCB4      -----------------------------------CNFRCQYCM-------PEKPFSWVPRENLLSYSID
PFLA_SHIFL      -----------------------PGIRFITFFQ-GCLMRCLYCHNRDTWDTHGGKEVTVEDKEVVTYRMN
PFLA_ECOLI      -----------------------PGIRFITFFQ-GCLMRCLYCHNRDTWDTHGGKEVTVEDKEVVTYRMN
PFLA_ECOL6      -----------------------PGIRFITFFQ-GCLMRCLYCHNRDTWDTHGGKEVTVEDKEVVTYRMN
PFLA_ECO57      -----------------------PGIRFITFFQ-GCLMRCLYCHNRDTWDTHGGKEVTVEDKEVVTYRMN
MOAA_METMA      -----------------------------------CNLSCMYCHNEGAECTCGPVGNEMSPESIIREAAK
MOAA_PYRKO      -----------------------PVTNLRISLTQECNYRCFFCHREGQRFLAKNELTPEEIERLVRIASR
MOAA_PYRFU      -----------------------PVTNLRISLTKECNLNCFYC---HREGQQDGERTMTPEERIVRIASR
MOAA_PYRAE      -----------------------------------CNYNCVFC---HFEGQSRRQGRYLTAEDVTSVFKS
MOAA_CAMFF      -----------------------------------CNFRCRYCMPDEPFKDAGHSNSYEEMFEFIKICLD
MOAA_NITSB      -----------------------------------CNFRCQYCM-------PEKPFSWVPKENLLNFAID
MOAA_THEYD      -----------------------------------CNLRCIYCMPEEGITNLLPHHEILSYEKIVEIGVD
BIOB_RHOPS      ----------------------------LNVKTGGCAEDCGYCSQSSHHDTALPASKLMDPAKVIEGAKA
BIOB_RHOP2      ----------------------------LNVKTGGCAEDCGYCSQSAHHDTALPASKLMDPKKVIEGAKA
MOAA_VIBSL      -----------------------------------CNFKCTYCDGYKPSGQKNSSFLSVPEKRVVKAFAD
MOAA_NAUPA      -----------------------------------CNFRCLYCM-------PNTPFEWEPHENILRYAID
MOAA_METAC      -----------------------------------CNLSCMYCHNEGADCSCGSLGHEMSPELIVREAAK
BIOB_SORC5      ----------------------------LSVKTGGCPEDCAYCPQ------SSHYETEVGPERMLDVAAE
Y1632_METJA     ----------------------------ITLLTYGCNFKCKYCFFKPLSCKKYSVDEIL--NKILEVNEN
MOAA_PYRHO      -----------------------PVTNLRISLTKECNLSCFYCHR----EGQLDGERFMTPERIVRVASR
BIOB_SYNS9      --------------------------SLLSVKTGGCEEDCSYCQSIHNSSDVSGFEAQMRVEPVLERARA
MOAA_VIBCM      -----------------------------------CNFKCTYCPDGYKPSAGRPASFLTVNERVVSAFAH
MOAA_VIBCH      -----------------------------------CNFKCTYCPDGYKPSAGRPASFLTVNERVVSAFAH
MOAA_VIBC3      -----------------------------------CNFKCTYCPDGYKPSAGRPASFLTVNERVVSAFAH
MOAA_SULAC      --------------------------------THACNFTCFFCHMEGENDGDSLLSAD-QISLVAQIGME
MOAA_VIBVY      -----------------------------------CNFKCTYCLPDGYQPSGQKNSSFLEIRRVVKAFAD
MOAA_VIBVU      -----------------------------------CNFKCTYCLPDGYQPSGQKNSSFLEIRRVVKAFAD
BIOB_SYNSC      --------------------------SLLSVKTGGCEEDCAYCQSIHNSSDVTAFEAQMQVEPVLQRARA
BIOB_RALSO      -------------------------STLLSIKTGGCPEDCSYCPQSARYDTGVEAEKLMPIDTVLEAAAQ
BIOB_RALPJ      -------------------------STLLSIKTGGCPEDCSYCPQSARYDTGVEAEKLMPIDAVLERAKQ
MOAA_HELPY      -----------------------------------CNFRCQYCM------PATPLNFFLPLDNVLEFAID
MOAA_DESAD      -----------------------------------CNLRCMYCVTKDFKHIPHPILRYEEMLRLVDLAAS
MOAA_VIBPA      -----------------------------------CNFKCTYCLPDGYKPSGNKNSSFLSPERVVKAFAD
MOAA_PYRAB      -----------------------PVTNLRISLTKECNLNCFYCHREGQERTMKPEEI----ERIVRIASR
MOAA_SULNB      -----------------------------------CNFRCQYCMSWVPKXXXXXXXXXXXXMKV---AMD
MOAA_METJA      -----------------------------------CNLQCFYC---HREGHDSNNDRYMTPEEIAKTSTK
MOAA_AERHH      -----------------------------------CNFRCTYCLP---DGYRPPAGGKVGRQRVVSGFAA
Y103_METJA      ----------------------------------GCNLNCIFCSEGEFSKTRKN-DYYVD----LEYLIE
PQQE_PSEU2      --------------------------------TYRCPLQCPYCSN---PLDFAKQGQELSTEKVMQEARE
PQQE_PSESM      --------------DIAPAAHYIPPTPEVGLPLWRCPLQCPYCSN---PLDFARQGQELTTEKVMQEARE
PFLA_STRMU      ----------------------------------GCQMRCQYCHNWAMKNTERTAGVFKEALRFKDFWGD
MOAA_METMP      -----------------------------------CNLKCFYCHKEGRNEEHGKLMSADEIGKIVNSSLE
MOAA_METM5      -----------------------------------CNLKCFYCHKEGRNEEHGKLMSADEIGKIVKSSLE
MOAA_MANSM      -----------------------------------CNFKCTYCL---------PSG-YQPPRRIVGAFAA
MOAA_HELP2      -----------------------------------CNFRCQYCM------PATPLDFFLPLDNVLEFAID
BIOB_KLEP7      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSARYKTGLEAERLMEVEQVLESARQ
PQQE_PSE14      --------------------------------TYRCPLQCPYCSN---PLDFAKQGQELTTEKVMQEARE
PFLA_STAES      --------------------------------TQGCLLRCLYCHNPDTWKINEPSREVTVDEMVNEILFE
PFLA_STAEQ      --------------------------------TQGCLLRCLYCHNPDTWKINEPSREVTVDEMVNEILFE
MOAA_MOOTA      -----------------------------------CNLRCRYC----MPATGVPLKGHEDILRLEEIATG
MOAA_METM7      -----------------------------------CNLKCFYCHKEGRNEEHGKLMSADEIGKIVKSSLE
MOAA_LACPL      -----------------------------------CNLRCVYC----MPKEGLP---FFPTDRVLSQLIE
MOAA_CAMLR      --------------------------------TQRCNFRCLYCMEWSAKENLL---SFEELFMFVKVCID
MOAA_ALKMQ      -----------------------------------CNLRCQYCEKGIYKKTHQDILTLEEIEQIVRIGAE
BIOB_OCHA4      ----------------------------LNIKTGGCPEDCGYCSQSAHHASGLKASKLMSLDTVLEEAQK
MOCS1_CAEEL     -----------------------------------CNFRCLYCM---------PAGVPLKPKRLVKLFAA
MOAA_SULTO      -----------------------------------CNFSCFFC---HMEGEDNSQSLLSPEELVAKVGIE
MOAA_CAMC5      --------------------------------TQRCNFRCRYCMSWTPKXXXXXXXXXXXXVKV---AID
MOAA_CLOBL      -----------------------------------CNLRCVYCMEGIVKKEHDNIMRYEEIFKVVKSASL
MOAA_CLOBJ      -----------------------------------CNLRCVYCMEGIVKKEHDNIMRYEEIFKVVKSASL
MOAA_CLOBH      -----------------------------------CNLRCVYCMEGIVKKEHDNIMRYEEIFKVVKSASL
MOAA_CLOB1      -----------------------------------CNLRCVYCMEGIVKKEHDNIMRYEEIFKVVKSASL
CNX2_ARATH      -----------------------------------CNLRCQYCMPSE-GVELTPKPQLLSQSEIVRLAGL
BIOB_ESCF3      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_ERYLH      ----------------------------LSIKTGGCPEDCGYCSQSVKADSGVEATKLMDVQRVLQSAAQ
BIOB2_POLSJ     -------------------------STLLSIKTGGCAEDCGYCPQSTHFETEVKASKLMPLAEVIEAARA
PQQE_RAHAQ      --------------------------------------------------------------KVFEEARE
PQQE_ERWT9      --------------------------------TYRCPLQCPYCSNPLDFAQQEKELSTAQWIEVFKQARA
MOAA_PETMO      -----------------------------------CNLRCIYCMQGVTFKTHSSILRYEEIIKIVEVGTE
MOAA_HAEDU      -----------------------------------CNFRCNYCL---------PDG-YRPPKRLARTFAN
MOAA_CLOB6      -----------------------------------CNLRCVYCMEGIIKKEHDNIMRYEEIFKVVKSASL
MOAA_ACTPJ      -----------------------------------CNFRCNYCL---------PDG-YKPPQRVVRAFAD
MOAA_ACTP7      -----------------------------------CNFRCNYCL---------PDG-YKPPQRVVRAFAD
MOAA_ACTP2      -----------------------------------CNFRCNYCL---------PDG-YKPPQRVVRAFAD
BIOB_SPHWW      -------------------------STLLSIKTGGCPEDCGYCNQSVHAETGLKATKLMDVRAVLQSAAQ
BIOB_SHIFL      --------------------HFEPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_SHIF8      --------------------HFEPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_SALAR      --------------------HFDPKSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_ECO5E      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_ECO57      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
PFLA_HAEIN      ----------------------------------GCLMRCKYCHNWDLEGGKEISVEDLMKEVVTYRHFM
MOAA_METM6      -----------------------------------CNLKCFYCHKEGRNEEHGKLMSADEIVKIVKSSLE
MOAA_META3      -----------------------------------CNLNCFYCHNIDNNKLMTPTEI----GEMVKYSLK
MOAA_CLOBM      -----------------------------------CNLRCVYCMEGIVKKEHDNIMRYEEIFKVVKSASL
BIOB_SYNPX      --------------------------SLLSVKTGGCEEDCAYCQSIHNSSDVTAFEAQMQVEPVLQRARA
BIOB_SHISS      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_SHIDS      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_RHOPT      ----------------------------LNVKTGGCAEDCGYCSQSAHHDTALPASKLMEPAKVIEXXXX
BIOB_RHOPA      ----------------------------LNVKTGGCAEDCGYCSQSAHHDTALPASKLMEPAKVIEXXXX
BIOB_METPB      ----------------------------LSIKTGGCPEDCAYCP-----QSAHHKGANLPRERLMPVDXX
BIOB_ECOSM      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_ECOSE      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_ECOLU      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_ECOLI      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_ECOLC      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_ECOL5      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_ECOHS      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_ECODH      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_ECO8A      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_ECO7I      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_ECO55      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_ECO27      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_ECO24      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_AQUAE      --------------------HYFPENSIINAKSGACSEDCKFCAQSKYYKTPINVYNLVPVDEMVEGAIR
PQQE_PSEMY      --------------------------------TYRCPLQCPYCSN---PLDFAKQGAELSTAEWIEQARE
MOAA_ACTSZ      -----------------------------------CNFRCNYCDGYHPSHERDKFLTVDEIRRAVSAFAA
MOAA_ACAM1      -----------------------------------CNFRCQYCQDLQFLQPXXXXXXXXXXXXIRDVFIP
BIOB_SILPO      --------------------------SLLSIKTGGCPEDCAYCQSAHHREVELTREKLMNPDHVVSLARR
BIOB_HYPNA      ----------------------------LSIKTGGCAENCGYCSQSASFKTGLKAEKLLPVEEVVDAARR
BIOB_ECOUT      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_ECOL6      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_ECOK1      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_ECO81      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_ECO45      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
MOAA_MICAN      -----------------------------------CNFRCQYC----LPEDAELA--YVRPQDLLTREIP
MOAA_EUBAC      ----------------------------------------------------------------------
MOAA_CAMJR      --------------------------------TQRCNFRCLYCMP-KIPFDYQPKXXXXXXXXXVKAAMD
MOAA_CAMJJ      --------------------------------TQRCNFRCLYCMP-KIPFDYQPKXXXXXXXXXVKAAID
MOAA_CAMJE      --------------------------------TQRCNFRCLYCMP-KIPFDYQPKXXXXXXXXXVKAAID
MOAA_CAMJ8      --------------------------------TQRCNFRCLYCMP-KIPFDYQPKXXXXXXXXXVKAAID
MOAA_CAMC1      --------------------------------TQRCNFRCRYCMSWTPKXXXXXXXXXXXXVKV---AID
MOAA_BACSU      -----------------------------------CNFRCTYCMPAELFGPDYPXXXXXXXXXXXXFVTR
BIOB_PSYWF      ----------------------------------------------------------------------
BIOB_JANMA      ----------------------------LSIKTGGCPEDCGYCPQAARYDTGVTAQKILPLEEVLTAARE
PQQE_ESCVU      --------------------------------TYRCPLQCPYCSNPLDFAAQEKELSTEQWIEVFRQARA
MOAA_PASMU      -----------------------------------CNFRCNYCPNGYQPESNKPSFLTLNEIRLVVKSFA
BIOB_SYNP6      ----------------------------LSVKTGGCSENCAYCQSAHYNTEVDPQST-LPIETVLEQAER
BIOB_SYNE7      ----------------------------LSVKTGGCSENCAYCQSAHYNTEVDPQST-LPIETVLEQAER
BIOB_SALSV      --------------------HFDPQSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLDSARK
BIOB_SALPK      --------------------HFDPQSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLDSARK
BIOB_SALPA      --------------------HFDPQSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLDSARK
BIOB_SALHS      --------------------HFDPQSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLDSARK
BIOB_SALG2      --------------------HFDPQSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMAVEQVLDSARK
BIOB_SALEP      --------------------HFDPQSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLDSARK
BIOB_SALDC      --------------------HFDPQSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLDSARK
BIOB_NOSP7      ----------------------------ISIKTGGCPEDCSYCAQSSRYKTEVKAEALLEKETVVNIAQK
BIOB_METEP      ----------------------------LSIKTGGCPEDCAYCP-----QSAHHKGANLPRERLMPVDXX
BIOB_METCA      --------------------HFDPNSSLLSIKTGACSEDCAYCPQSAHYETGVKRESLMSLEDVLEAAQR
BIOB_METC4      ----------------------------LSIKTGGCPEDCAYCP-----QSAHHKGANLPRERLMPVDXX
BIOB_HALHL      --------------------HFNPGQTLVSIKTGACAEDCTYCSQSARYDTGLEREALIDVETVREAAQR
BIOB_GEOSF      --------------------------SIVNAKSGRCPENCSFCAQSAHHKTDAPVYSLIDEERMVACARE
BIOB_CITK8      --------------------HFDPQSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLDSARK
MOAA_HALSA      --------------------------SGVRVSTDRCNFDCVYCHNEGLGDTRGPIDPELSTDRVVRFAHE
MOAA_HALS3      --------------------------SGVRVSTDRCNFDCVYCHNEGLGDTRGPIDPELSTDRVVRFAHE
MOAA_CLOBK      -----------------------------------CNLRCVYCMEGIVKKEHDNIMRYEEIFKVVKSASL
BIOB_SYNR3      --------------------------SLLSVKTGGCEEDCAYCQSMHHSSTAQPE-LQLQVDGVLQQARS
BIOB_SALTY      --------------------HFDPQSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLDSARK
BIOB_SALTI      --------------------HFDPQSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLDSARK
BIOB_SALPC      --------------------HFDPQSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLDSARK
BIOB_SALPB      --------------------HFDPQSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLDSARK
BIOB_SALNS      --------------------HFDPQSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLDSARK
BIOB_SALCH      --------------------HFDPQSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLDSARK
BIOB_SALA4      --------------------HFDPQSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLDSARK
BIOB_RHOP5      ----------------------------LNVKTGGCAEDCGYCSQSAHHDTALPASKLMDPKKVIEXXXX
PFLA_STAAW      --------------------------------TQGCLLRCLYCHNPDTWKISEPSREVTVDEMVNEILFD
PFLA_STAAS      --------------------------------TQGCLLRCLYCHNPDTWKISEPSREVTVDEMVNEILFD
PFLA_STAAR      --------------------------------TQGCLLRCLYCHNPDTWKISEPSREVTVDEMVNEILFD
PFLA_STAAN      --------------------------------TQGCLLRCLYCHNPDTWKISEPSREVTVDEMVNEILFD
PFLA_STAAM      --------------------------------TQGCLLRCLYCHNPDTWKISEPSREVTVDEMVNEILFD
PFLA_STAAC      --------------------------------TQGCLLRCLYCHNPDTWKISEPSREVTVDEMVNEILFD
PFLA_STAAB      --------------------------------TQGCLLRCLYCHNPDTWKISEPSREVTVDEMVNEILFD
PFLA_STAA8      --------------------------------TQGCLLRCLYCHNPDTWKISEPSREVTVDEMVNEILFD
PFLA_STAA3      --------------------------------TQGCLLRCLYCHNPDTWKISEPSREVTVDEMVNEILFD
MOAA_METVS      -----------------------------------CNLKCFYC---HREGRTEENGKLMSPDKIVSASLE
BIOB_SHIBS      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
BIOB_SHIB3      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
MOAA_STAHJ      -----------------------------------CNFRCDYCMPKEIDYVFLPKDELLTFEEMVRIAKV
MOAA_CAMJD      --------------------------------TQRCNFRCLYCMP-KIPFDYQPKXXXXXXXXXVKATID
BIOB_NITEU      -------------------------STLISVKTGGCSEDCAYCPQAARYHTGVENQAILSREEVVAAATQ
BIOB_KLEP3      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSARYKTGLETERLMEVEQVLESARQ
Y804_METJA      --------------------------------TQKCNLNCIYC--YSRLKTV---------KRGIYGNLE
PQQE_PSEF5      --------------------------------TYRCPLQCPYCSN---PLDFAEQGKELSTEKVFREARE
PQQE_METSB      --------------------------------THRCPLACPYCSNLELDSRAAETAAWI---KVFTEAAE
PFLA_LISMO      ----------------------------------GCLLRCQFCHNWKIGTGTERSAQDVFDEAIKYWDAS
PFLA_LISMF      ----------------------------------GCLLRCQFCHNWKIGTGTERSAQDVFDEAIKYWDAS
PFLA_LISIN      ----------------------------------GCLLRCQFCHNWKIGTGTERSAQDVFDEAIKYWDAS
MOAA_SULDN      -----------------------------------CNFRCQYCM-------PEKPFSWVPKXXXVKVAID
MOAA_PSESM      -----------------------------------CDFRCVYCMAEEM--TFLPRQQILSLEQVAERFVA
MOAA_PSE14      -----------------------------------CDFRCVYCMAEEM--TFLPRQQILSLEEILQVAVA
MOAA_PHOLL      -----------------------------------CNFRCTYC----LPDGYKPRGHHLPEIRLVGRAFA
BIOB_LEPCP      -------------------------STLLSIKTGGCAEDCGYCPQSAHFDTAVEASKLMPIDEVLDAANA
MOAA_SYNJB      -----------------------------------CNFRCQYCMPDEAELTWLQAPERLTDEEILEVFLP
MOAA_PELTS      -----------------------------------CNLRCVYCMPEEGVRSL-PHGEILRLEEVVRAAAL
MOAA_BRUSU      -----------------------------------CDFRCTYCMAEHM--TFLPKKDLLTLERLCSVFIE
MOAA_BRUSI      -----------------------------------CDFRCTYCMAEHM--TFLPKKDLLTLERLCSVFIE
MOAA_BRUME      -----------------------------------CDFRCTYCMAEHM--TFLPKKDLLTLERLCSVFIE
MOAA_BRUMB      -----------------------------------CDFRCTYCMAEHM--TFLPKKDLLTLERLCSVFIE
MOAA_BRUC2      -----------------------------------CDFRCTYCMAEHM--TFLPKKDLLTLERLCSVFIE
BIOB_WIGBR      -------------------------STLLSIKTGLCPEDCKYCSQSSRYKTGLVSEKLIKIEKVINAAKK
BIOB_DESVH      -----------------------------------CPEDCAFCAQSSHHATGSPVHALLDAETLLRRAEE
BIOB_BURXL      -------------------------STLLSIKTGGCEEDCAYCPQSVHHDTGLQADKLMPVDEVLKVAKE
BIOB_BURPP      -------------------------STLLSIKTGGCEEDCAYCPQSVHHDTGLQADKLMPVDEVLKVAKE
PFLA_CLOPA      ----------------------------------GCGLRCSYCHN---PDTWNMAGGXXXXXXXXXXXFD
MOAA_STACT      -----------------------------------CNFRCDYCMPKEIFGDKDELLSFSEMERIARVYTH
MOAA_STAAW      -----------------------------------CNFRCDYCMP---KEVFGDDFVFLPKNRIAKVYAE
MOAA_STAAT      -----------------------------------CNFRCDYCMP---KEVFGDDFVFLPKNRIAKVYAE
MOAA_STAAS      -----------------------------------CNFRCDYCMP---KEVFGDDFVFLPKNRIAKVYAE
MOAA_STAAR      -----------------------------------CNFRCDYCMP---KEVFGDDFVFLPKNRIAKVYAE
MOAA_STAAN      -----------------------------------CNFRCDYCMP---KEVFGDDFVFLPKNRIAKVYAE
MOAA_STAAE      -----------------------------------CNFRCDYCMP---KEVFGDDFVFLPKNRIAKVYAE
MOAA_STAAC      -----------------------------------CNFRCDYCMP---KEVFGDDFVFLPKNRIAKVYAE
MOAA_STAA9      -----------------------------------CNFRCDYCMP---KEVFGDDFVFLPKNRIAKVYAE
MOAA_STAA8      -----------------------------------CNFRCDYCMP---KEVFGDDFVFLPKNRIAKVYAE
MOAA_STAA3      -----------------------------------CNFRCDYCMP---KEVFGDDFVFLPKNRIAKVYAE
MOAA_STAA2      -----------------------------------CNFRCDYCMP---KEVFGDDFVFLPKNRIAKVYAE
MOAA_HELPJ      -----------------------------------CNFRCQYCMPT-TXXXXXXXXXXXXXXNVLEFAID
MOAA_HAEI8      -----------------------------------CNFRCTYCLPDGYQPEANKP-SFLTLKEIIHLAAE
MOAA_GEOSL      -----------------------------------CNLRCSYCMPAEVEKLAGDILSYEDLFRIARAAVA
MOAA_CHLTE      --------------------------------TSACNLRCTYCLKED-APTQTQQLDVVETSKLIALLAG
BIOB_SODGM      --------------------HFTPGSTLLSIKTGACPEDCKYCPQSARYSTGLESERLMQVQQVLDAARK
BIOB_POLNA      -------------------------STLLSIKTGGCAEDCGYCPQSSHFETEVKASKLMALDEVMXXXXX
BIOB_ESCVU      --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLETERLMEVEQVLDSARK
BIOB_BORA1      -------------------------SSLLSIKTGGCPEDCGYCSQSARHDSGLAAEKLMPLDEVLAEARA
PQQE_PSEPK      --------------------------------TYRCPLQCPYCSN---PLDFAAQGQELSTEKVMAEARE
MOAA_SULSO      --------------------------------THACNFECFFCHNYLLSKEDILLVAKV--------ARK
MOAA_SHISS      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_SHIFL      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_SHIDS      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_SHIBS      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_SHIB3      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_ESCF3      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_ECOSM      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_ECOSE      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_ECOLU      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_ECOL6      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_ECOHS      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_ECO8A      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_ECO81      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_ECO7I      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_ECO5E      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_ECO57      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_ECO55      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_ECO45      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_ECO27      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_ECO24      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_CYAP4      -----------------------------------CNFRCQYCMPEQAKLEFLAQSEVLTGDEILTLVLP
MOAA_BRUO2      -----------------------------------CDFRCTYCMAEHM--TFLPKKDLLTLERLCSVFIE
BIOB_RALME      -------------------------STLLSIKTGGCEEDCGYCPQSAHHDAGVKAEKLMDLEAVLDXXXX
BIOB_PROM5      ----------------------------------------------------------------------
BIOB_PROM0      --------------------------SLFSVKTGGCEENCSYCSQSIYSASEIKSHPQFQVEEVLARAKV
BIOB_BURTA      -------------------------STLLSIKTGGCEEDCGYCSQSAHHDTGLKAEKLMEVDAVLRTAKE
BIOB_BURPS      -------------------------STLLSIKTGGCEEDCGYCSQSAHHDTGLKAEKLMEVDAVLRTAKE
BIOB_BURP6      -------------------------STLLSIKTGGCEEDCGYCSQSAHHDTGLKAEKLMEVDAVLRTAKE
BIOB_BURP1      -------------------------STLLSIKTGGCEEDCGYCSQSAHHDTGLKAEKLMEVDAVLRTAKE
BIOB_BURP0      -------------------------STLLSIKTGGCEEDCGYCSQSAHHDTGLKAEKLMEVDAVLRTAKE
BIOB_BURMS      -------------------------STLLSIKTGGCEEDCGYCSQSAHHDTGLKAEKLMEVDAVLRTAKE
BIOB_BURMA      -------------------------STLLSIKTGGCEEDCGYCSQSAHHDTGLKAEKLMEVDAVLRTAKE
BIOB_BURM9      -------------------------STLLSIKTGGCEEDCGYCSQSAHHDTGLKAEKLMEVDAVLRTAKE
BIOB_BURM7      -------------------------STLLSIKTGGCEEDCGYCSQSAHHDTGLKAEKLMEVDAVLRTAKE
PQQE_KLEP3      --------------------------------TYRCPLQCPYCSNFARQEKELTTEQWI---EVFRQARA
MOAA_TOLAT      --------------------------------TEACNFRCTYC----LPDGYRPDGSFLTVDRVVYGFAE
MOAA_STAAM      -----------------------------------CNFRCDYCMP---KEVFGDDFVFLPKNRIAKVYAE
MOAA_STAAB      -----------------------------------CNFRCDYCMP---KEVFGDDFVFLPKNRIAKVYAE
MOAA_STAA1      -----------------------------------CNFRCDYCMP---KEVFGDDFVFLPKNRIAKVYAE
MOAA_HALWD      --------------------------SGVRVSTDRCNFDCVYCHNEGLGDTRGPMDPQMSTDDVVRFVVS
BIOB_SYNS3      -----------------PGYHVQLA-SLLSVKTGGCEEDCAYCQSMHHSSDVTGQ-----PELQVAPVLE
BIOB_RUTMC      -------------------------SSLLNIKTGACPEDCSYCSQSSKYDTGLEREKLMEIDLVLQQAKE
BIOB_PROMS      --------------------------SLFSVKTGGCEENCSYCSQSIYSASEIKSHPQFQVEEVLARAKI
BIOB_PROM9      --------------------------SLFSVKTGGCEENCSYCSQSIYSASEIKSHPQFQVEEVMARAKI
BIOB_CLOP1      -----------------------------------CGEDCAFCAQSKYHKTNISEYPLLDYEKIKKVAKE
BIOB_ANASK      ----------------------------------------------------------------------
BIOB_ANAD2      ----------------------------------------------------------------------
BIOB_AGRT5      ----------------------------LSIKTGGCPEDCSYCSQSARNPTGLKASKLMEVERVLAEARK
RLMN_SYNPW      ----------------------------------------------------------------------
MOAA_STRM5      --------------------------------TEACNFRCSYCLPDGYQVDGRPRFLQVDEARLVRAFAA
MOAA_RHOBA      -----------------------------------CNIRCFYCMPEHDAEFLPRSGVFEEIERLAGLLVK
MOAA_METKA      --------------------------------TMRCNMACVYCHREGERPGRSELSA-AEWGRLLRACAE
MOAA_ECOLI      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_ECODH      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_ECOBW      -----------------------------------CNFRCTYCDGYKPSGVTNKGFLTVDEIRRVTRAFA
MOAA_CYAP8      ----------------------------------------------------------------------
BIOB_GLUDA      ----------------------------------------------------------------------
BIOB_CLOPE      -----------------------------------CGEDCAFCAQSKYHKTNISEYPLLDYEKIKKVAKE


                         +         .         .         .         .         *         .:210
query           NGDSGVNVSFNEPTLLAEYAEEVFRLARARGLHASINTNGYLTEEAVRRLAEAGMEGMNIDIKGGRETYR
Y808_METJA      YNCPGISYTYTEPTVYYEFMYDTSVIARENGMFNVMITNGYIEKEPLKALP---VDAMNIDIKGNADFYK
MOAA_ARCFU      FKELGVRITGGEPLLRKDLPDIILNLPEFEEI--SMTTNGILLEKYAEELRECGLSRVNVSLDTLDAEKY
MOAA_METS5      FGVKSVKLTGGEPTLRRDLPE-IIREIRTSGVRISMTTNGFLLANIAGKLKDAGLDRINISLHATREKFK
MOAA_AQUAE      LGVEKVRLTGGEPLLREDLEEIIQRISKVEGIKIALTTNGVFLKERLKALKEAGLKRITVSVHSLNPEKN
MOAA_UNCMA      YGVDKIKFSGGEPLLRRDFDEILRALPPMRDV--SVTTNGTLLAARAESLKESGLDRVNVSLDSDRFTFI
MOAA_THEAC      FGVNKVKITGGEPTLRAXXXXXXXXXXKHITGNISMTTNGTMLPKIAKDLKKAGLDRVNISLHSPDDERF
MOAA_METTH      LGVGKIRLSGGEPLIRDDIVEIVERINNIGFRDISITTNGTLLEGYSAALSEAGLDRVNVSFDTNPETYR
Y1227_METJA     DA---IVISGGEPTLQKDAVIEIARYAKEKGFPVKIDTNGTHPEVIEELIKNKLIDYVAIDVKCRFDKYK
MOAA_THEVO      FGVNKIKLTGGEPTLRRDLIDIVKRIRKYITGNISMTTNGVMLPILAYELKKAGLDRVNISMHADEDTFQ
MOAA_ARCB4      EGIKKVRITGGEPLLREDFIKMVFDYKK--DIDLALTTNGYLLSKMAKKLKDAGLKRVNISLDTNKETAQ
PFLA_SHIFL      ASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRDPVIDELLEV-TDLVMLDLKQNDEIHQ
PFLA_ECOLI      ASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRDPVIDELLEV-TDLVMLDLKQNDEIHQ
PFLA_ECOL6      ASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRDPVIDELLEV-TDLVMLDLKQNDEIHQ
PFLA_ECO57      ASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRDPVIDELLEV-TDLVMLDLKQNDEIHQ
MOAA_METMA      FGVRKVKFSGGEPLFRKDFEDILACLPPLKEVSAT--TNGILLEKRAKTLKAAGLDRINVSLDSDPEKYR
MOAA_PYRKO      LGIRKVKLTGGEPTVREDILEIVKRI-KPYVIDLSMTTNGSRLKELAKPLAKAGLDRVNVSLHSLKEVYK
MOAA_PYRFU      LGIRNVKLTGGEPTVRPDIYEIIQRI-RPYVVDLSMTTNGTTLYASAEKLKEAGLDRVNISLDTDRKKYK
MOAA_PYRAE      LGVADFKITGGEPLLRGDIDLIVANIAKT-GAYVTLTTNGYLLRKWVRKLQAAGLKRANVSITTDPEKYS
MOAA_CAMFF      NGVKKIRLTGGEP-LVRKGVENFVAMINGSGLDLAMTTNGYFLAKKAQALKDAGLKRINISLDTLDKTKA
MOAA_NITSB      EGITKIRLTGGEPTLRADLDKFIKMIYDYKDIDLAMTTNGYLLKDIAQDLKKAGLKRLNISLDSLKPEVA
MOAA_THEYD      LGITKIRITGGEPLLRKGIVSFIERLARIEGIRIGMTTNGVLLKKFAKDLYNAGLKRVNVSLDSLDENKF
BIOB_RHOPS      ARDAGMGAAWRSPRDMAPVIEMV-KGVKALGMEACM-TLGMLTDDQAKQLADAGLDYYNHNIDTSEEFYS
BIOB_RHOP2      ARDAGMGAAWRSPRDMAPVIEMV-KGVKALGMEACM-TLGMLTDDQAQQLADAGLDYYNHNIDTSEEFYS
MOAA_VIBSL      CGTSKIRITGGEPSLRKDFPEIIHTVASTPGIEVATTTNGYRMEKQVGQWRDAGLTHINVSV--------
MOAA_NAUPA      EGINKIRLTGGEPLLRKDLDVFVKMLHDYRDLDLALTTNGYYLKEYAKKLKDAGLKRVNMSLDSLKPEVA
MOAA_METAC      FGVRKVKFSGGEPLFRKDFEEILACLPPLKEVSAT--TNGILLEKRAKTLKAAGLDRVNVSLDSNPEKYG
BIOB_SORC5      RAREGGSTRFCMGAAWREVKDDMVRGVKALGLEACC-TLGMLTDDQARRLKEAGLDAYNHNLDTSRKAYK
Y1632_METJA     YKLDKILIAGGEPTLQNDLS-ELTKLLKDEGFYLMLSTNGYYLKDMLDKLE---VDEIHIDLKAYDENKH
MOAA_PYRHO      LGIKKVKLTGGEPTIRKDILEIIRRL-KPYVVDLSLTTNGTTMYVLAEKLKEAGLDRVNISLDTDRKKYK
BIOB_SYNS9      AKEAGADRAWREIRDGAQFEAEMVRGVRGMGMEACV-TAGMLTDDQAGRLAEAGLTAYNHNLDTSPEHYE
MOAA_VIBCM      CGTSKVRITGGEPSLRKDFGEIIHTIAQTPGIQVATTTNGYRLAKHIGEWREAGLTQLNVSV--------
MOAA_VIBCH      CGTSKVRITGGEPSLRKDFGEIIHTIAQTPGIQVATTTNGYRLAKHIGEWREAGLTQLNVSV--------
MOAA_VIBC3      CGTSKVRITGGEPSLRKDFGEIIHTIAQTPGIQVATTTNGYRLAKHIGEWREAGLTQLNVSV--------
MOAA_SULAC      FGIRTVKLTGGEPTLRRDLPEIISKLKEVGIKEVSMTTNGYLLKELAGKLKDAGLDRVNISL--------
MOAA_VIBVY      CGTSKVRITGGEPSLRKDFTDIIHTVASTQGIRVATTTNGYRMEKHIGEWKEAGLNQINVSV--------
MOAA_VIBVU      CGTSKVRITGGEPSLRKDFTDIIHTVASTQGIRVATTTNGYRMEKHIGEWKEAGLNQINVSV--------
BIOB_SYNSC      AKEAGADRAWREIRDGAPFEAEMVRGVRGMGMEACV-TAGMLTDQQAERLAEAGLTAYNHNLDTSPEHYD
BIOB_RALSO      NGASGAAWRNPKPHQLDAVADMV-RGVKAMGLETCV-TLGMLKQEQAQQLKDAGLDYYNHNLDTAPEFYG
BIOB_RALPJ      NGASGAAWRNPKPHQLDAVADMV-RGVKAMGLETCV-TLGMLKQEQAAQLKEAGLDYYNHNLDTAPEFYG
MOAA_HELPY      EGVKKIRITGGEPLLRKGLDEFIAKLAYNKEVELVLSTNGFLLKKMAKDLKNAGLAQVNVSLDSLKSDRV
MOAA_DESAD      MNISKLRLTGGEPFARKGFMDFISQVMDSHPIDLRITTNGTLIEPLVPELKKIGVSRLNISLDTDRETFK
MOAA_VIBPA      CGTSKVRITGGEPSLRKDFTDIIHSVATTPGIKVATTTNGYRMAKQVADWREAGLTNINVSV--------
MOAA_PYRAB      LGIKKVKLTGGEPTIRKDIVE-IIRRIRPYVVDLSLTTNGTTLYTLAEELKEAGLDRVNISLDTDRKKYK
MOAA_SULNB      EGVNKIRITGGEP-LLREDLDSFIKMIHKPDIDLALTTNAYLLPQTAQKLKDAGLKRLNISLDSLKPEVA
MOAA_METJA      FGVKKIKISGGEPLLRKDVCEIIENIKDERIKDISLTTNGILLENLAEKLKDAGLNRVNVSL----DTLN
MOAA_AERHH      MGTRKVRLTGGEPSLRRDFTAIIETVANTPGIEVAMTTNGYRLKERAREWFDAGLTALNVSVDSPRQFHQ
Y103_METJA      NYKKIVDFKENEPSLLVDLVQELAEINKKGNGIVSMQTNGVLNYKLIDELEEAGLHRINLSINALDEKMA
PQQE_PSEU2      MGAAQIGFSGGEPLVRQDLAELIAE-ARRLGFYTNLITSGILTEEKIIAFKEAGLDHIQISFQASDEQVN
PQQE_PSESM      MGAAQIGFSGGEPLVRQDLAELIAE-ARRLGFYTNLITSGILTEEKIIAFKKAGLDHIQISFQASDEQVN
PFLA_STRMU      TG--GITVSGGEATLQMDFLIALFSLAKEKGIHTTLDTCALTFRNTPKYLEKAVTDLVLLDIKEINPDQH
MOAA_METMP      FGVRKIKISGGEPLLRTDLPEIISYIKNEQIKDISLTTNGILLEKYAQKLKDAGLDRVNVSL--------
MOAA_METM5      FGVRKIKISGGEPLLRTDLPEIIENIKDEQIKDISLTTNGILLEKYAQKLKDAGLDRVNVSL--------
MOAA_MANSM      MGTEKVRLTGGEPTLRKDFLAIVETISALEGIKVALTTNGYRMEKDVERWKKAGVSSINVSVDSPRQFYS
MOAA_HELP2      EGVKKIRITGGEPLLRKGLDEFIAKLAYNKEVALVLSTNGFLLKKMAKDLKNAGLSRVNVSLDSLKSD--
BIOB_KLEP7      AKNAGMGAAWKNPNDRMPYLEQMVKGVKALGLESCM-TLGTLTDSQAQRLAEAGLDYYNHNLDTSPEFYG
PQQE_PSE14      MGAAQIGFSGGEPLVRQDLAELIAE-ARRLGFYTNLITSGILTKEKIIAFKEAGLDHIQISFQASDEQVN
PFLA_STAES      ASGGGVTVSGGEPLLQMPFLEQLFKELKANGVHTCIDTSAGCVNDAFNRHFDELQKHTDLDIKHDNDKHI
PFLA_STAEQ      ASGGGVTVSGGEPLLQMPFLEQLFKELKANGVHTCIDTSAGCVNDAFNRHFDELQKHTDLDIKHDNDKHI
MOAA_MOOTA      TGISRIRLTGGEPLVRKNVVTLVRELAAIPGLEESLTTNGIFLGALAFSLKEAGLKRVNISLDTLKKDRY
MOAA_METM7      FGVRKIKISGGEPLLRTDLPEIIENIKDDQIKDISLTTNGILLEKYAQKLKDAGLDRVNVSL--------
MOAA_LACPL      NGVSKVRITGGEPLLRTDVVEIVRRIKAVDGINVSITTNGLFLAKLAKPLKEAGLDRLNISL--------
MOAA_CAMLR      EGVKKIRITGGEPLVRKDLYKFIAMISEYKDIDLALTTNASLLKQQAKDLRQAGLKRINISLDTLKEDVA
MOAA_ALKMQ      NGINKVRITGGEPLVRKGVIGLIKNISNIPGIQIALTTNGLLIKKYGEALKDAGLKRINISIDSLRPDRY
BIOB_OCHA4      AKDSGMGAAWRSPKPRDEPAAEMVKQVKALGLETCM-TLGMLSPDQAQTFAEAGLDYYNHNIDTSERFYP
MOCS1_CAEEL     HGVDKVRLTGGEPTIRKDIVHIVEGISSTPGIEVGITTNGLVLQRFLPQLRDAGLTKINISIDSDREKFA
MOAA_SULTO      YGIRSVKLTGGEPTLRRDLLQIIRELKDVGIKEVSMTTNGVLLSTLAWKLKEVGLDRVNVSLHSDKQLFK
MOAA_CAMC5      EGVTKIRLTGGEPLVRKDLDVFVKMISDYKDIDLALTTNGFMLRHYAKRLRDAGLKRINMSLDTLNEQKA
MOAA_CLOBL      LGVNKIRFTGGEPLILKDIDKLIYNTSKINSIKIAMTTNAILLEDMVEELKKAGLKRVNISLDSLKEDRF
MOAA_CLOBJ      LGVNKIRFTGGEPLILKDIDKLIYNTSKINSIKIAMTTNAILLEDMVEELKKAGLKRVNISLDSLKEDRF
MOAA_CLOBH      LGVNKIRFTGGEPLILKDIDKLIYNTSKINSIKIAMTTNAILLEDMVEELKKAGLKRVNISLDSLKEDRF
MOAA_CLOB1      LGVNKIRFTGGEPLILKDIDKLIYNTSKINSIKIAMTTNAILLEDMVEELKKAGLKRVNISLDSLKEDRF
CNX2_ARATH      FVSAGVNLTGGEPTVRKDIEEICLQLSSLKGLNLAITTNGITLAKKLPRLKECGLDSLNISLDTLVPAKF
BIOB_ESCF3      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLADAGLDYYNHNLDTSPEFYG
BIOB_ERYLH      AKDAGMGAAWRNPKDRDMPAVEIVKGVRDMGLETCM-TLGMLTPKQADMLKDAGLDYYNHNVDTGPEYYE
BIOB2_POLSJ     AKDQGMGAAWRSPKERMERVTEIVREVRSLGLETCM-TLGMLQAEQAQALKDAGLDYYNHNLDSAPEFYG
PQQE_RAHAQ      MGAVQIGFSGGEP-LVRKDLPELIRGARDLGFYTNLITSGILTEKKIDAFAQAGLDHIQISFQASDEELN
PQQE_ERWT9      MGAVQIGFSGGEP-LVRKDLPELIRSARELGFYTNLITSGILTQKKIDAFAEAGLDHIQISFQASDETLN
MOAA_PETMO      LGIKKVRITGGEPLVRQGVVNLIKELRKIPELEITMTTNGVLLPKYAFALKRAGLSRVNISLDSNPDTYK
MOAA_HAEDU      LGTEKIRITGGEPTLRKDFLEIVETISQTEGIHIALTTNGYRMERDIHLWQQVGITDLNISV--------
MOAA_CLOB6      LGVNKIRFTGGEPLILKNIDKLIYNTSKISSIKIAMTTNAILLEDMVEELKKAGLKRVNISLDSLKEDRF
MOAA_ACTPJ      LGTEKVRITGGEPTLRKDFLEIAHTVSQTNGIKVALTTNGYRMERDIDLWQQAGITDINVSV--------
MOAA_ACTP7      LGTEKVRITGGEPTLRKDFLEIAHTVSQTNGIKVALTTNGYRMERDIDLWQQAGITDINVSV--------
MOAA_ACTP2      LGTEKVRITGGEPTLRKDFLEIAHTVSQTNGIKVALTTNGYRMERDIDLWQQAGITDINVSV--------
BIOB_SPHWW      ARDAGMGAAWRNPKDRDMPAVEMVKGVRQMGMETCM-TLGMLTGDQARTLADAGLDYYNHNIDTAPERYD
BIOB_SHIFL      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_SHIF8      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_SALAR      AKNAGMGAAWKNPRERMPYLEQIVQGVKAMGLETCM-TLGMLNESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_ECO5E      AKAAGMGAAWKNPHERMSYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_ECO57      AKAAGMGAAWKNPHERMSYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
PFLA_HAEIN      NATGGVTASGGEAVLQAEFVRDWFRACKEEGINTCLDTNGFVRDHIIXXXXXXXXXXXXXXXXXXXQVHQ
MOAA_METM6      FGVRKIKISGGEPLLRTDLPKIIENIKDDQIKDISLTTNGILLEKYAQKLKDAGLDRVNVSL--------
MOAA_META3      YGINKIKISGGEPLLLPEIIRNIKNLKNNQIKDISLTTNGILLEKYAQKLKDAGLDRVNVSLDTDPELYK
MOAA_CLOBM      LGVNKIRFTGGEPLILKNIDKLIYNTSKISSIKIAMTTNAILLEDRVEELKKAGLKRVNISLDSLKEDRF
BIOB_SYNPX      AKEAGADRAWREIRDGAPFEASMVRGVRDLGMEACV-TAGMLSDQQAERLAEAGLTAYNHNLDTSPEHYD
BIOB_SHISS      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_SHIDS      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_RHOPT      XXXXXMGAAWRSPKEMAPVIEMV-KGVKALGMEACM-TLGMLTDDQAKQLADAGLDYYNHNIDTSEEFYA
BIOB_RHOPA      XXXXXMGAAWRSPKEMAPVIEMV-KGVKALGMEACM-TLGMLTDDQAKQLADAGLDYYNHNIDTSEEFYA
BIOB_METPB      XXXXXMGAAWRKPKDGPEFDAEMVRGVRGLGMEACV-TLGMLTQSQAQRLAEAGLTSYNHNLDTGPEFYG
BIOB_ECOSM      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_ECOSE      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_ECOLU      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_ECOLI      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_ECOLC      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_ECOL5      AKAAGMGAAWKNPRERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_ECOHS      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_ECODH      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_ECO8A      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_ECO7I      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_ECO55      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_ECO27      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_ECO24      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_AQUAE      GVEFGANRYCIVLSGKSATKEEVERITEAEGLPINVCVSGTLDEESLKKLKEAGVKRINHNLETSRNFFK
PQQE_PSEMY      LGAAQLGFSGGEPLVRQDLAE-LIAAARGLGYYTNLITSGILTEARIAEFADAGLDHIQISFQAADEEVN
MOAA_ACTSZ      MGAQKVRITGGEPTLRKDFLQITENITALDGIHVALTTNGYRMAQDVGAWKQAGISSINVSV--------
MOAA_ACAM1      LGFARFRLTGGEPLLILDIVRGVIALPQVKDL--AMTTNAFLLEPLAQDLFEAGLRRINISLDSGRDSHK
BIOB_SILPO      AQRAGMGAAWRQVRDGAEFDNAMVRGVRALGMEACV-TLGMLRPHQAQRLAEAGLTAYNHNLDTSPEFYG
BIOB_HYPNA      AKANGADRSLKDRDL--PKVAEMISAVKAEGLETCV-TLGMLEEGQAEALKEAGLDYYNHNLDTSREYYS
BIOB_ECOUT      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_ECOL6      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_ECOK1      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_ECO81      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_ECO45      AKAAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
MOAA_MICAN      LGFRKFRLTGGEPLLHPEVVEIVRDIASLSATSLALTTNGYLLDNLAEMLYEAGLRRINISLDSDPDTFD
MOAA_EUBAC      -GIDKIRITGGEPLVRKGIVGLVRELSKCEGLNETLTTNGLLLSEYARELKAAGLKRVNISLDTLNPQKF
MOAA_CAMJR      EGIEKIRITGGEPLLRKDLSIFIKMISDYKSIDLAITTNGFLLKDFAKDLKNAGLKRLNISLDTLDHKKA
MOAA_CAMJJ      EGIEKIRITGGEPLLRKDLSIFIKMISDYKSIDLAITTNGFLLKDFAKDLKNAGLKRLNISLDTLDHKKA
MOAA_CAMJE      EGIEKIRITGGEPLLRKDLSIFIKMISDYKSIDLAITTNGFLLKDFAKDLKNAGLKRLNISLDTLDHKKA
MOAA_CAMJ8      EGIEKIRITGGEPLLRKDLSIFIKMISDYKSIDLAITTNGFLLKDFAKDLKNAGLKRLNISLDTLDHKKA
MOAA_CAMC1      EGVKKIRITGGEPLVRKDLDVFIKMISDYKDIDLALTTNGFMLPHFAKRLKDAGLKRINMSLDTLNEQKA
MOAA_BACSU      FGVEKIRLTGGEPLMRKDMPELIKKLARIPGIRIAMTTNGSLLPVYAKRLKEAGLKRVTISLDSLEDERF
BIOB_PSYWF      ------------------YVAELIKEVKALGLETCM-TLGMLTAEQSEQLAEAGLDYYNHNLDTSRRYYD
BIOB_JANMA      AKAHGMGAAWREPDRDLEKVEEMVREVKAMGLE-TCATLGMLGEGQAEKLKNAGLDYYNHNLDTAPEFYS
PQQE_ESCVU      MGSVQLGFSAGEP-LVRKDLPELIAAARDLGFYTNLITSGILTEKKLQTFADAGLDHIQISFQASDETLN
MOAA_PASMU      NGTEKVRITGGEPTLRKDFLPIVETIAQNPTIQIALTTNGYRMAKDVAAWKEAGITSINVSI--------
BIOB_SYNP6      AKAAGASRAWREIRDGAQFDAEMVQGVRQLGLEACV-TAGMLSDRQAERLAEAGLTAYNHNLDTSPEFYG
BIOB_SYNE7      AKAAGASRAWREIRDGAQFDAEMVQGVRQLGLEACV-TAGMLSDRQAERLAEAGLTAYNHNLDTSPEFYG
BIOB_SALSV      AKNAGMGAAWKNPHERMPYLEQIVQGVKAMGLETCM-TLGMLNESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_SALPK      AKNAGMGAAWKNPHERMPYLEQIVQGVKAMGLETCM-TLGMLNESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_SALPA      AKNAGMGAAWKNPHERMPYLEQIVQGVKAMGLETCM-TLGMLNESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_SALHS      AKNAGMGAAWKNPHERMPYLEQIVQGVKAMGLETCM-TLGMLNESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_SALG2      AKNAGMGAAWKNPHERMPYLEQIVQGVKAMGLETCM-TLGMLNESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_SALEP      AKNAGMGAAWKNPHERMPYLEQIVQGVKAMGLETCM-TLGMLNESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_SALDC      AKNAGMGAAWKNPHERMPYLEQIVQGVKAMGLETCM-TLGMLNESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_NOSP7      AKETGVSAAWREVRDNSQFEEEMVKDITAMGLEVCC-TLGMLTANQARKLEEAGLYAYNHNLDTSQE---
BIOB_METEP      XXXXXMGAAWRKPKDGPDFDAEMVRGVRGLGMEACV-TLGMLTQSQAQRLAEAGLTSYNHNLDTGPEFYG
BIOB_METCA      AREEGMGAAWRSPRAIAAMVEGV----KALGMETCV-TAGMLSDEQARRLKEAGLDYYNHNLDTSESYYG
BIOB_METC4      XXXXXMGAAWRKPKDGPDFDAEMVRGVRGLGMEACV-TLGMLTQSQAQRLAEAGLTSYNHNLDTGPEFYG
BIOB_HALHL      ARASGMGAAWRGPTLVA-----MVRAVKAEGLEACLSA-GLLAEGQAERLAEAGLDYFNHNLDTSPSYYD
BIOB_GEOSF      NGSSCYGISIKKGEELERICNAVRRIRRETGITPSCSL-GIINHETASALVEAGVETYHHNLETSRSFFP
BIOB_CITK8      AKNAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLNESQAQRLANAGLDYYNHNLDTSPEFYG
MOAA_HALSA      FGVDAVKLTGGEPMLRSD-LEAIIR-RTPDDMAVSMTTNGTFLPGRAADLVDAGLERVNI----------
MOAA_HALS3      FGVDAVKLTGGEPMLRSD-LEAIIR-RTPDDMAVSMTTNGTFLPGRAADLVDAGLERVNI----------
MOAA_CLOBK      LGVNKIRFTGGEPLILKDIDKLIYNTSKINSIKIAMTTNAILLEDMVEELKKDGLKRVNISLDSLKEDRF
BIOB_SYNR3      ARDAGAH-RFCMGWAWREIREAMVRGVRELGMEACV-TAGMLTDSQAERLAQAGLTSYNHNLDTSPEHYD
BIOB_SALTY      AKNAGMGAAWRNPHERMPYLEKIVQGVKAMGLETCM-TLGMLNESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_SALTI      AKNAGMGAAWKNPHERMPYLEKIVQGVKAMGLETCM-TLGMLNESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_SALPC      AKNAGMGAAWRNPHERMPYLEKIVQGVKAMGLETCM-TLGMLNESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_SALPB      AKNAGMGAAWRNPHERMPYLEKIVQGVKAMGLETCM-TLGMLNESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_SALNS      AKNAGMGAAWRNPHERMPYLEKIVQGVKAMGLETCM-TLGMLNESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_SALCH      AKNAGMGAAWRNPHERMPYLEKIVQGVKAMGLETCM-TLGMLNESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_SALA4      AKNAGMGAAWKNPHERMPYLEKIVQGVKAMGLETCM-TLGMLNESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_RHOP5      XXXXXMGAAWREPRDMAPVIEMV-KGVKALGMEACV-TLGMLSDAQAKQLADAGLDYYNHNVDTSEEFYS
PFLA_STAAW      ASGGGVTVSGGEPLLQMPFLEKLFAELKENGVHTCLDTSAGCANDAFQRHFEELQKHTDLDIKHDNDKHI
PFLA_STAAS      ASGGGVTVSGGEPLLQMPFLEKLFAELKENGVHTCLDTSAGCANDAFQRHFEELQKHTDLDIKHDNDKHI
PFLA_STAAR      ASGGGVTVSGGEPLLQMPFLEKLFAELKENGVHTCLDTSAGCANDAFQRHFEELQKHTDLDIKHDNDKHI
PFLA_STAAN      ASGGGVTVSGGEPLLQMPFLEKLFAELKENGVHTCLDTSAGCANDAFQRHFEELQKHTDLDIKHDNDKHI
PFLA_STAAM      ASGGGVTVSGGEPLLQMPFLEKLFAELKENGVHTCLDTSAGCANDAFQRHFEELQKHTDLDIKHDNDKHI
PFLA_STAAC      ASGGGVTVSGGEPLLQMPFLEKLFAELKENGVHTCLDTSAGCANDAFQRHFEELQKHTDLDIKHDNDKHI
PFLA_STAAB      ASGGGVTVSGGEPLLQMPFLEKLFAELKENGVHTCLDTSAGCANDAFQRHFEELQKHTDLDIKHDNDKHI
PFLA_STAA8      ASGGGVTVSGGEPLLQMPFLEKLFAELKENGVHTCLDTSAGCANDAFQRHFEELQKHTDLDIKHDNDKHI
PFLA_STAA3      ASGGGVTVSGGEPLLQMPFLEKLFAELKENGVHTCLDTSAGCANDAFQRHFEELQKHTDLDIKHDNDKHI
MOAA_METVS      FGVRKIKISGGEPLVRKDLPXXXXXXXXXXXXXXSLTTNGILLEKCAEDLKKAGLNRVNVSL--------
BIOB_SHIBS      AKAAGMGAAWKNPNERMPYLEQMVQGVKDLGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
BIOB_SHIB3      AKAAGMGAAWKNPNERMPYLEQMVQGVKDLGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
MOAA_STAHJ      YAELGVKITGGEPLLRRNLYQLIAELNQIDGIEIGMTTNGLLLKKHGQKLYDAGLRRINVSLDADNEVFQ
MOAA_CAMJD      EGIEKIRITGGEPLLRKDLSIFIKMISDYKSIDLAITTNGFLLKDFAKDLKNAGLKRLNISLDTLDHKKA
BIOB_NITEU      AKESGMGAAWRGPKQRIEYMTEVISAVKALGME-TCATLGILKPGQATQLKQAGLDYYNHNLDTAPEFYG
BIOB_KLEP3      AKNAGMGAAWKNPNDRMPYLEQMVKGVKALGLESCM-TLGTLTDSQAQRLAGAGLDYYNHNLDTSPEFYG
Y804_METJA      EAETVTISQYGEPLLDLEGVKKAIEFCKDLGLRVDLQTNGLLNEEIIKELKDLGLDLIMISLSSSREKYK
PQQE_PSEF5      MGAAQLGFSGGEPLVRQDLAELIGE-ARKLGFYTNLITSGILTEQKISDFKKAGLDHIQISFQASDEQVN
PQQE_METSB      LGVLHAHLSGGEPAARRDLVEIVAHCASV-GLYTNLITSGILTQERIKALADAGLDHVQLSIQDAEAKSA
PFLA_LISMO      GG--GVTVSGGEPLLQVDFLIEFFTLCKAAGVHTTIDSCG------------------------------
PFLA_LISMF      GG--GVTVSGGEPLLQVDFLIEFFTLCKAAGVHTTIDSCG------------------------------
PFLA_LISIN      GG--GVTVSGGEPLLQVDFLIEFFTLCKAAGVHTTIDSCG------------------------------
MOAA_SULDN      EGIRKIRITGGEPLLLDKFIKMIFDYAP--DIDLAMTTNAYLLKSTAQKLRDAGLKRLNVSIDTLKPEVA
MOAA_PSESM      LGTRKIRLTGGEPLVRAGVVGLCEKIAALPGLRECMTTNGSQLDKLAAPLFKAGVTRLNISLDSLDPQRF
MOAA_PSE14      LGTRKIRLTGGEPLVRSGVVGLCEKIAALPGLRECMTTNGSQLDKLAAPLFKAGVTRLNISLDSLDPQRF
MOAA_PHOLL      DGTEKIRLTGGEPTMRRDFTDIISVIRENKLIKTAVTTNGYRMERDIAKWKEAGLTAVNVSM--------
BIOB_LEPCP      AKAQGMGAAWRSPKERMERVTEMVREVRALGLETCM-TLGMLDGEQARELKDAGLDYYNHNLDSAPDFYG
MOAA_SYNJB      LGIDCFRLTGGEPLLRPGLEHLIRALCSLPGVRVALTTNGFNLSQKAQLLYEAGLRRINISFDSNPETFR
MOAA_PELTS      TGVKKIRLTGGEPLVRKGLEELVRRVSGIPGIDIALTTNGLLLPSRAKALKEAGVKRVNVSL----DTLR
MOAA_BRUSU      KGVRKLRLTGGEPLVRKNIMHLIGNLSRHLKSGATLTTNGSQLARFAGELADCGVRRINVSLDTLNRTIT
MOAA_BRUSI      KGVRKLRLTGGEPLVRKNIMHLIGNLSRHLKSGATLTTNGSQLARFAGELADCGVRRINVSLDTLNRTIT
MOAA_BRUME      KGVRKLRLTGGEPLVRKNIMHLIGNLSRHLKSGATLTTNGSQLARFAGELADCGVRRINVSLDTLNRTIT
MOAA_BRUMB      KGVRKLRLTGGEPLVRKNIMHLIGNLSRHLKSGATLTTNGSQLARFAGELADCGVRRINVSLDTLNRTIT
MOAA_BRUC2      KGVRKLRLTGGEPLVRKNIMHLIGNLSRHLKSGATLTTNGSQLARFAGELADCGVRRINVSLDTLNRTIT
BIOB_WIGBR      AKKSGVNPKDKDIPLLEEMIKSVKKL----GLETCM-TLGMLNDYQANRLHNAGLDYYNHNLDTSKEFYK
BIOB_DESVH      LRQSGIVTSGTRLTVLATLCEAAVRIRRETGI-ALCGSLGQLTPDAAACLKEAGFSSYHHNLETSRSFFP
BIOB_BURXL      NGATRFCMGANPKDRHLEPIKDMIRGVKAMGLETCV-TLGMLETHQAQGLREAGLDYYNHNLDTSPEFYG
BIOB_BURPP      NGATRFCMGANPKDRHLEPIKDMIRGVKAMGLETCV-TLGMLETHQAQGLREAGLDYYNHNLDTSPEFYG
PFLA_CLOPA      RSGGGVTFSGGEVLLQPEFLIDILKLCKEQGIHTAIDTAGYNYEEILKHTDLVLLDIKHVDDDGYKCITG
MOAA_STACT      LGVKKIRITGGEPLMRRDLYKLIAALNEIEGVEIGLTTNGLLLKKHGQKLYDAGLRRINVSLDADNELFQ
MOAA_STAAW      LGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLF
MOAA_STAAT      LGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLF
MOAA_STAAS      LGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLF
MOAA_STAAR      LGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLF
MOAA_STAAN      LGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLF
MOAA_STAAE      LGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLF
MOAA_STAAC      LGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLF
MOAA_STAA9      LGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLF
MOAA_STAA8      LGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLF
MOAA_STAA3      LGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLF
MOAA_STAA2      LGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLF
MOAA_HELPJ      EGVKKIRITGGEPLLRKGLDEFIAKLAYNKEVALVLSTNGFSLKKMAKGLKDAGLSRVNVSLDSLKSDRV
MOAA_HAEI8      MGTEKIRLTGGEPTLRKDFISIAESIANIDGIRQAVTTNGYRMAKDVADWKQAGITSINVSVDSDPKMFH
MOAA_GEOSL      IGIEKIRITGGEPLVRKGIVPFLARIAAIEGLRQLVTTNGLLLPEMAADLRSAGVQRLNISLDSLRDTFR
MOAA_CHLTE      MGVRKIRFTGGEP-LLHPSIPELVRIAKATGIDTCITTNGVLLDRQLDALVEAGLDGVNLSLDTDREKFT
BIOB_SODGM      ARDAGMGAAWKNPDRDMPLLEQMVQGVKAMGLETCM-TLGMLNDRQVQRLAEAGLDFYNHNLDTSPEFYG
BIOB_POLNA      XKDQGMGAAWSRPKERMERVTEMVREVRGLGLETCM-TLGMLEAEQAQALKDAGLDYYNHNLDSSPEFYG
BIOB_ESCVU      AKNAGMGAAWKNPHERMPYLEQMVQGVKAMGLEACM-TLGTLDETQAQRLASAGLDYYNHNLDTSPEFYG
BIOB_BORA1      AKNAGMGAAWRSPPHHLEAVAEMVREVKALGLETCV-TLGMLQDGQAEQLKEAGLDYYNHNLDTSPEFYG
PQQE_PSEPK      MGAAQIGFSGGEPLVRQDLAQLIAE-ARRLGYYTNLITSGILTEARIADFKKAGLDHIQISFQASDEQVN
MOAA_SULSO      FGINSVKLTGGEPTLRRDLVEIVRGLKQLGYEDVSMTTNGFXXXXXXXXXXXXXXXRINISLHASRDTFK
MOAA_SHISS      SGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVANWRDAGLTGINVSV--------
MOAA_SHIFL      SGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVANWRDAGLTGINVSV--------
MOAA_SHIDS      SGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVANWRDAGLTGINVSV--------
MOAA_SHIBS      SGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVANWRDAGLTGINVSV--------
MOAA_SHIB3      SGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVANWRDAGLTGINVSV--------
MOAA_ESCF3      SGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVANWRDAGLTGINVSV--------
MOAA_ECOSM      SGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVANWRDAGLTGINVSV--------
MOAA_ECOSE      SGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVANWRDAGLTGINVSV--------
MOAA_ECOLU      SGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVANWRDAGLTGINVSV--------
MOAA_ECOL6      SGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVANWRDAGLTGINVSV--------
MOAA_ECOHS      SGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVANWRDAGLTGINVSV--------
MOAA_ECO8A      SGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVANWRDAGLTGINVSV--------
MOAA_ECO81      SGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVANWRDAGLTGINVSV--------
MOAA_ECO7I      SGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVANWRDAGLTGINVSV--------
MOAA_ECO5E      SGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVANWRDAGLTGINVSV--------
MOAA_ECO57      SGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVANWRDAGLTGINVSV--------
MOAA_ECO55      SGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVANWRDAGLTGINVSV--------
MOAA_ECO45      SGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVANWRDAGLTGINVSV--------
MOAA_ECO27      SGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVANWRDAGLTGINVSV--------
MOAA_ECO24      SGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVANWRDAGLTGINVSV--------
MOAA_CYAP4      LGFTRFRLTGGEPLVRPDVVEIVGKIAALPQVQLSMTTNAYLLTELAEDLYAAGLRRINISLDS------
MOAA_BRUO2      KGVRKLRLTGGEPLVRKNIMHLIGNLSRHLKSGATLTTNGSQLARFAGELADCGVRRINVSLDTLNRTIT
BIOB_RALME      XXXNGMGAAWREPERHLEPVIDMVREVKAMGLETCV-TLGMLKAEQAQRLKDAGLDYYNHNLDTSPEFYG
BIOB_PROM5      ---------------------EMVKGVKELGMEACV-TAGMLTDEQALRLADAGLTAYNHNLDTSPEYYK
BIOB_PROM0      AKNEGADKSFNAML-------EMVSGVRDLGMEACV-TAGMLTEEQASRLADAGLTAYNHNLDTSPEHYK
BIOB_BURTA      NGATRFCMGANPKDRHIEPIKEMIRGVKDMGLETCV-TLGMLEEHQAKALAEAGLDYYNHNLDTSPEFYG
BIOB_BURPS      NGATRFCMGANPKDRHIEPIKEMIRGVKDMGLETCV-TLGMLEEHQAKALAEAGLDYYNHNLDTSPEFYG
BIOB_BURP6      NGATRFCMGANPKDRHIEPIKEMIRGVKDMGLETCV-TLGMLEEHQAKALAEAGLDYYNHNLDTSPEFYG
BIOB_BURP1      NGATRFCMGANPKDRHIEPIKEMIRGVKDMGLETCV-TLGMLEEHQAKALAEAGLDYYNHNLDTSPEFYG
BIOB_BURP0      NGATRFCMGANPKDRHIEPIKEMIRGVKDMGLETCV-TLGMLEEHQAKALAEAGLDYYNHNLDTSPEFYG
BIOB_BURMS      NGATRFCMGANPKDRHIEPIKEMIRGVKDMGLETCV-TLGMLEEHQAKALAEAGLDYYNHNLDTSPEFYG
BIOB_BURMA      NGATRFCMGANPKDRHIEPIKEMIRGVKDMGLETCV-TLGMLEEHQAKALAEAGLDYYNHNLDTSPEFYG
BIOB_BURM9      NGATRFCMGANPKDRHIEPIKEMIRGVKDMGLETCV-TLGMLEEHQAKALAEAGLDYYNHNLDTSPEFYG
BIOB_BURM7      NGATRFCMGANPKDRHIEPIKEMIRGVKDMGLETCV-TLGMLEEHQAKALAEAGLDYYNHNLDTSPEFYG
PQQE_KLEP3      MGSVQLGFSGGEP-LTRKDLPELIRAARDLGFYTNLITSGILTESKLDAFSEAGLDHIQISFQASDEVLN
MOAA_TOLAT      LGVKKIRLTGGEPSMRRDLPAIIETVANTAGIEVAMTTNGYRLKDRAQQWFDAGLRSLNVSI--------
MOAA_STAAM      LGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEIGLTTNGLLLKKHGQELYDAGLRRINVSLDAIDDTLF
MOAA_STAAB      LGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLF
MOAA_STAA1      LGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEIGLTTNGLLLKKHGQELYDAGLRRINVSLDAIDDTLF
MOAA_HALWD      QFDIGVKFTGGEPMLRDDLTEIIRRTPSS--MEVSMTTNGTFLPGRAGALREAGLERVNV----------
BIOB_SYNS3      RAKAAKQAGADRFCMGWAWREQMVSGVRALGMEACV-TAGMLTDGQAQRLAKAGLTAYNHNLDTSPEHYD
BIOB_RUTMC      AQDIGMGAAWRNPTDKS-LAKVILMIVKTMGMETCV-TLGMLTQEQAFILKEAGLDYYNHNIDTSKEHYS
BIOB_PROMS      AKNEGADKSFNAML-------EMVSGVRDLGMEACV-TAGMLTEEQASRLADAGLTAYNHNLDTSPEHYK
BIOB_PROM9      AKNEGADKSFNAML-------EMVSGVRDLGMEACV-TAGMLTEEQASRLADAGLTAYNHNLDTSPEHYK
BIOB_CLOP1      NEDEGVSIVTSGRGLYGEEFERVITYYSNLNKELKINSHGIINKESLIKLKKAGVKRYHHNLETSRNCYD
BIOB_ANASK      --------------------EEALRRLRAETAVEPCASLGLMREPELRRLKDAGLMHYHHNLETARSHFE
BIOB_ANAD2      --------------------EEALRRLRAETAVEPCASLGLMREPELRRLKDAGLMHYHHNLETARSHFE
BIOB_AGRT5      AKEGGMGAAWRNP----KERDMEAVVAMVEGVKATCMTLGMLTPEQSERLADAGLDYYNHNVDTSERFYS
RLMN_SYNPW      ------------------------------------------------RLAELAMERLGVSLHAPNQSLR
MOAA_STRM5      LGMSKIRLTGGEPSLRKDLDEIIATVAAAPGIRVAITTNGTLLPRRLPGWHRAGLTALNVSMDSQRERFR
MOAA_RHOBA      RGVRDIRITGGEPLVRRDCVDLIRMLARIDGLELSMTTNGMLLRDHAADLRSAGLKRLNVSL--------
MOAA_METKA      IGVRKVKITGGEPLLRRDLIEII---ENAEGFEVSLVTNGVLLADYAGDLAEAGLDRVNVSLDTDRKLYR
MOAA_ECOLI      RGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVASWRDAGLTGINVSV--------
MOAA_ECODH      RGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVASWRDAGLTGINVSV--------
MOAA_ECOBW      RGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQAVTTNGYRLERDVASWRDAGLTGINVSV--------
MOAA_CYAP8      ----------------------------------SMTTNGFLLSRMAKELYQAGLKRINISLDSNQETFD
BIOB_GLUDA      -------------------------------------TLGMLDDRQAHRLREAGLDYYNHNLDTSPEHYG
BIOB_CLOPE      NEDEGVSIVTSGRGLYGEEFERVITYYSNLNKELKINSHGIINKESLIKLKKAGVKRYHHNLETSRNYYD


                         .         .         .         +         .         .         .:280
query           RWLAANFDKFLSTARHAKGMGIHVEFTYLVIPGVNDHEAEEVIEAVASFGRETPLHITAYYPAHKLFNXX
Y808_METJA      KVCKATLEPVLETCKLAKKLGIWVEVTNLIVPNYNDNDLLFIIHFVRELGRETPLHFSRFHPDYKLTDPT
MOAA_ARCFU      RWITGGGEKVVNGIEKACEVGLTVKINMLVLGGVNDNEVDELLEFTNSFNR-------------------
MOAA_METS5      DVTGVDMDRVIAGIREAKNQGFKPIKLNFVLTKRNSEEAKRVIEFSEEIGID-ELHLIELHP--------
MOAA_AQUAE      QKLSVNLGEVFEVIIRAKELGFKVKVNSVIIKGFNDDEILDLARFFKNLG--------------------
MOAA_UNCMA      TQCKGQFDKVLDGIDAALSVGLPVKINMVYLKGINEDEVDRMIDYVR--GKPLVLQIIELMNFHGAF---
MOAA_THEAC      HFITGTIDRVLEAVRSANDAGLPVKINFVVLKDLNVNDIPRMLEIAA-----------------------
MOAA_METTH      FITRKDYERVKSGITSAVDVGLDVKINMVILRGVNHHEVWDMFE--------------------------
Y1227_METJA     EFVKCREDKILKIIDLCKKNNVFVECRTTFVPKVMD---EEDIEDIAKTVKDCDLY--------------
MOAA_THEVO      AITGVNSDRIIKAIDAANEAGLPVKINFVVLRDLNVDQIPDMIELAA-----------------------
MOAA_ARCB4      KIAQKDLEKVLEGIEEASKVGLKIKINCVPLKGVSEKDVLEVLEFCKSRG--------------------
PFLA_SHIFL      NLVGVSNHRTLEFAKYLANKNVKVWIRYVVVPGWSDDDAHRLGEFTRDMGNVEKIELLPYHELGK-----
PFLA_ECOLI      NLVGVSNHRTLEFAKYLANKNVKVWIRYVVVPGWSDDDAHRLGEFTRDMGNVEKIELLPYHELGK-----
PFLA_ECOL6      NLVGVSNHRTLEFAKYLANKNVKVWIRYVVVPGWSDDDAHRLGEFTRDMGNVEKIELLPYHELGK-----
PFLA_ECO57      NLVGVSNHRTLEFAKYLANKNVKVWIRYVVVPGWSDDDAHRLGEFTRDMGNVEKIELLPYHELGK-----
MOAA_METMA      KITGATLEKVIRGINSAVEAGLPVKLNMVLLKGINENEIDEMMDFIRPY---------------------
MOAA_PYRKO      RITGVDLEAVLEGIEEAVKYLSPVKLNMTVMKGLNDGEIWDMVEFAAKTG--------------------
MOAA_PYRFU      MITGYDLDQVLKGIRRATNLFYPVKLNMVVMRGINDDEIWDMI---------------------------
MOAA_PYRAE      KITGSAFREVLRGLTEARDVGISLKLNAVVLRGINTDSVKNLVKLAASLG--------------------
MOAA_CAMFF      HFIARKLDNVIEGIETACNLGFGVKINTVALKSVNDNE--------------------------------
MOAA_NITSB      AKIASKLKNVLEGIDAALEAGLKVKINMVPLKGVNEDEIVDVME--------------------------
MOAA_THEYD      RAIVGLIDDVFEGIDEAKNAGLQVKVNVVVMKGINDDEIEK-----------------------------
BIOB_RHOPS      SVVTRSFGDRLETLEKVQDAGIKV----------------------------------------------
BIOB_RHOP2      SVVSRSFGDRLDTLATVQDAGIKV----------------------------------------------
MOAA_VIBSL      ----------------------------------------------------------------------
MOAA_NAUPA      AKIAQKLNRVIQGLDEALKVGLKVKLNTVVMQGINDTEILDLLEFAKNKG--------------------
MOAA_METAC      KITGATLEKVIKGIDSAVEAGLPVKLNMVLLKGVNDNEIDAMMEFIRPYGGKVILQL-------------
BIOB_SORC5      SIISTTYDERLVTLRNVRRAGITV----------------------------------------------
Y1632_METJA     IYLTSCSNKISYIGKYRDEFNFKVEIDTVLIPNIVDLDE---IEKIAKFNWDLPYRITGY----------
MOAA_PYRHO      MITGFNLDEVIKGIKKATKLFYPVKLNMVVMKGVNDDE--------------------------------
BIOB_SYNS9      KIISTTYEDRLETLQRVRKAGVTLCSGGIIGMGETLRDRASMLQVLAS----------------------
MOAA_VIBCM      ----------------------------------------------------------------------
MOAA_VIBCH      ----------------------------------------------------------------------
MOAA_VIBC3      ----------------------------------------------------------------------
MOAA_SULAC      ----------------------------------------------------------------------
MOAA_VIBVY      ----------------------------------------------------------------------
MOAA_VIBVU      ----------------------------------------------------------------------
BIOB_SYNSC      RIISTTYQERLETLERVRKAGVTLCCGGIIGMGETLRDRASMLQVLAS----------------------
BIOB_RALSO      EIITTTYQDRLDTLEHVRDAGINVCCGGIVGLGESRHERAGLVAELAN----------------------
BIOB_RALPJ      EIITTTYQDRLDTLEHVRDAGINVCCGGIVGLGESVHERAGLIAELAN----------------------
MOAA_HELPY      LKISQKLKNTLEGIEESLKVGLKLKLNTVVIKSVNDDEILELLE--------------------------
MOAA_DESAD      EVTGRHLTDVLATISACLSAGIRVKVNAVAMKGINDRELNSFID----FARENPI---------------
MOAA_VIBPA      ----------------------------------------------------------------------
MOAA_PYRAB      MITGFDLDQVIKGIEKATKLFYPVKLNMVVMRGINDDEIWDLI---------------------------
MOAA_SULNB      HQIAQKLGQVLKGIDKALEVGLGVKINMVPLKGINDNEILDVME--------------------------
MOAA_METJA      PELYKKITKFGDVERVINGIAIDVSLTPLKVMSINIKDLPDIMEFCRDIG--------------------
MOAA_AERHH      ITGENKLAEVMDGIEAALAAGFSVKINAVLLKGLNDHQ----LDAFLAWIRHKPIEL-------------
Y103_METJA      KMLSGNIKKILDIAEYIKNSKIHXXXXXXXXXXXXDEEFKRVIEYAVDLEQKNPQNI-------------
PQQE_PSEU2      NMLAGSKKAFAQKLEMARAVKRH-----------------------------------------------
PQQE_PSESM      NMLAGSKKAFAQKLEMAKAVKKH-----------------------------------------------
PFLA_STRMU      KIVTGHSNKILACARYLSDIGKPVWIRHVLVPGLTDRDED------------------------------
MOAA_METMP      ----------------------------------------------------------------------
MOAA_METM5      ----------------------------------------------------------------------
MOAA_MANSM      ITGENKFHQVMKGIERAFEIGYEIKVNSVLMKNLNDQE--------------------------------
MOAA_HELP2      RVLKISQKDALKNAEESLKVGLKLKLNTVVMKSVNDDEILELLE--------------------------
BIOB_KLEP7      NIITTTYQERLDTLDKVRDAGIKV----------------------------------------------
PQQE_PSE14      NMLAGSKKAFAQKLEMAKAVKKH-----------------------------------------------
PFLA_STAES      KLTGKPNTHILKFARKLSDMKQPVWIRHVLVPGISD-DKEDLIK--------------------------
PFLA_STAEQ      KLTGKPNTHILKFARKLSDMKQPVWIRHVLVPGISD-DKEDLIK--------------------------
MOAA_MOOTA      RYITGNITSVWQGIRAALAAGLPVKLNVVITRGFNDDE----ILDFARLAREEPLHITAYVPAEEI----
MOAA_METM7      ----------------------------------------------------------------------
MOAA_LACPL      ----------------------------------------------------------------------
MOAA_CAMLR      FKLAQKLKDVLNGIDEALNLGFNVKFNTVALKGINDSEFIDLLE--------------------------
MOAA_ALKMQ      KEITRGGDQVLEGIQEALRLGMPVKLNVVVIGGYNEDEIED-----------------------------
BIOB_OCHA4      QVITTSFDDRLETLAHVREAGIKV----------------------------------------------
MOCS1_CAEEL     KMTRRDFDKVWKAIELARGYYPKVKLNVVVLKHQNENEVVDFV---------------------------
MOAA_SULTO      EITGVDLDKVIEGIKEAIKAGLRPLKLNFVLTKKNISQLDNIINFAIETGVD-ELHLIELHP--------
MOAA_CAMC5      KFIAQKLHEVLTGFEAALDAGLKVKINTVALKGVNDDELINLLE--------------------------
MOAA_CLOBL      KSIGGDINKVFKSIEKSLSIGMKIKINTVIMKGINDDEIDDFMNLTKKY---------------------
MOAA_CLOBJ      KSIGGDINKVFKSIEKSLSIGMKIKINTVIMKGINDDEIDDFMNLTKKY---------------------
MOAA_CLOBH      KSIGGDINKVFKSIEKSLSIGMKIKINTVIMKGINDDEIDDFMNLTKKY---------------------
MOAA_CLOB1      KSIGGDINKVFKSIEKSLSIGMKIKINTVIMKGINDDEIDDFMNLTKKY---------------------
CNX2_ARATH      EFLTKGHDRVMKSIDTAIELGYNVKVNCVIMRGLNDDEICDFVELT----RDKPINV-------------
BIOB_ESCF3      NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
BIOB_ERYLH      RVISTNYQDRLDTLQNVRDAGINV----------------------------------------------
BIOB2_POLSJ     DIISTTYQDRLDTLGHVRQAGINV----------------------------------------------
PQQE_RAHAQ      AALAGNAKAFQQKLAMAKAVKAH-----------------------------------------------
PQQE_ERWT9      AALAGSFQQKLEMARAVKAHGYPMVLNF-VLHRHNIDQLDRIIE--------------------------
MOAA_PETMO      TTRRGEFSQAIEGIKAALEVGLNVKINTVVMKGINDNELENFV---------------------------
MOAA_HAEDU      ----------------------------------------------------------------------
MOAA_CLOB6      KSIGGDINKVFKSIEKSLSIGMRIKINTVIMKGINDDEIDDFMNLTKEY---------------------
MOAA_ACTPJ      ----------------------------------------------------------------------
MOAA_ACTP7      ----------------------------------------------------------------------
MOAA_ACTP2      ----------------------------------------------------------------------
BIOB_SPHWW      QVITTTFEDRIETLEHVREAGINVCCGGIV--GMGETRADRVIHALATL----PVH--------------
BIOB_SHIFL      NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
BIOB_SHIF8      NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
BIOB_SALAR      NIITTTYQERLDTLEKVREAGIKV----------------------------------------------
BIOB_ECO5E      NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
BIOB_ECO57      NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
PFLA_HAEIN      NLIGVPNKRTLEFAKYLQKRNQHTWIRYVVVPGYTDSD--------------------------------
MOAA_METM6      ----------------------------------------------------------------------
MOAA_META3      KITGGNVERGIEKAVEAGLKPIKINFVVMTVGGLND----------------------------------
MOAA_CLOBM      KSIGGDINKVFKSIEKSLSIGMRIKINTVIMKGINDDEIDDFMNLTKEY---------------------
BIOB_SYNPX      RIISTTYQERLETLQRVRKAGVTLCCGGIIGMGETLRDRASMLQVLAS----------------------
BIOB_SHISS      NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
BIOB_SHIDS      NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
BIOB_RHOPT      SVVSRSFGDRLDTLEKVQDAGIKV----------------------------------------------
BIOB_RHOPA      SVVSRSFGDRLDTLEKVQDAGIKV----------------------------------------------
BIOB_METPB      DIISTTYDDRLQTLEHVR----------------------------------------------------
BIOB_ECOSM      NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
BIOB_ECOSE      NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
BIOB_ECOLU      NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
BIOB_ECOLI      NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
BIOB_ECOLC      NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
BIOB_ECOL5      NIITTTYQERLDTLEKVREAGIKV----------------------------------------------
BIOB_ECOHS      NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
BIOB_ECODH      NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
BIOB_ECO8A      NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
BIOB_ECO7I      NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
BIOB_ECO55      NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
BIOB_ECO27      NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
BIOB_ECO24      NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
BIOB_AQUAE      NIVTTHWEDRYETIKRIKKVGL------------------------------------------------
PQQE_PSEMY      NLLAGSFAQKLAMARAVKAHG-------------------------------------------------
MOAA_ACTSZ      ----------------------------------------------------------------------
MOAA_ACAM1      RW-----NKVWAGIQKAYQVGFNLKLNVVIIPGVNDHEVLDL--AALTIDRQWHVRFIEFMP--------
BIOB_SILPO      QIIGTTYQDRLDTLAYCRDAGIELCCGGIIGMGESLRDRAAMLQVLANF---------------------
BIOB_HYPNA      TVVTTTFDDRIETLGRARQAGI------------------------------------------------
BIOB_ECOUT      NIITTTYQERLDTLEKVREAGIKV----------------------------------------------
BIOB_ECOL6      NIITTTYQERLDTLEKVREAGIKV----------------------------------------------
BIOB_ECOK1      NIITTTYQERLDTLEKVREAGIKV----------------------------------------------
BIOB_ECO81      NIITTTYQERLDTLEKVREAGIKV----------------------------------------------
BIOB_ECO45      NIITTTYQERLDTLEKVREAGIKV----------------------------------------------
MOAA_MICAN      KIIGSRWQKTWAGIQAAQRVGFDLKLNVVVIPGINEAEVEDL----------------------------
MOAA_EUBAC      EYIGGSLEKVLEGIKEAQSVGLPIKLNTVLIGGFNDDEIEDFV---------------------------
MOAA_CAMJR      KTLAQKLDSVLSGIDEALNLDLKVKLNTVALKNLNDDELISLLEFAKS----------------------
MOAA_CAMJJ      KTLAQKLDSVLSGIDEALNLDLKVKLNTVALKNLNDDELISLLEFAKS----------------------
MOAA_CAMJE      KTLAQKLDSVLSGIDEALNLDLKVKLNTVALKNLNDDELISLLEFAKS----------------------
MOAA_CAMJ8      KTLAQKLDSVLSGIDEALNLDLKVKLNTVALKNLNDDELISLLEFAKS----------------------
MOAA_CAMC1      KFIAQKLHEVLAGFEAALDAGLKVKINTVALKGFNDDELVNLLE--------------------------
MOAA_BACSU      KKIGVSVSKVLEGIEAAKQAGLGVKINMVVQKGVNEKD--------------------------------
BIOB_PSYWF      EVVSTSYDERLQTINHVRKSGINV----------------------------------------------
BIOB_JANMA      NVISTDYQNRIDTLGRVRGAGIKV----------------------------------------------
PQQE_ESCVU      AALAGSFQQKLTMAKAVKALGYPMVLNF-VLHRHNIDQIDRIIE--------------------------
MOAA_PASMU      ----------------------------------------------------------------------
BIOB_SYNP6      EIISTTYADRLATLERVRQAGISVCCGGIIGMGEGQRDRAGLLQVLAT----------------------
BIOB_SYNE7      EIISTTYADRLATLERVRQAGISVCCGGIIGMGEGQRDRAGLLQVLAT----------------------
BIOB_SALSV      NIITTTYQERLDTLEKVREAGIKV----------------------------------------------
BIOB_SALPK      NIITTTYQERLDTLEKVREAGIKV----------------------------------------------
BIOB_SALPA      NIITTTYQERLDTLEKVREAGIKV----------------------------------------------
BIOB_SALHS      NIITTTYQERLDTLEKVREAGIKV----------------------------------------------
BIOB_SALG2      NIITTTYQERLDTLEKVREAGIKV----------------------------------------------
BIOB_SALEP      NIITTTYQERLDTLEKVREAGIKV----------------------------------------------
BIOB_SALDC      NIITTTYQERLDTLEKVREAGIKV----------------------------------------------
BIOB_NOSP7      ----------------------------------------------------------------------
BIOB_METEP      DIISTTYDDRLQTLEHVR----------------------------------------------------
BIOB_METCA      EIITTTYQDRLDTLQRVRDAGMHV----------------------------------------------
BIOB_METC4      DIISTTYDDRLQTLEHVR----------------------------------------------------
BIOB_HALHL      QVVTTSYEQRLQTLERIRDAGMRV----------------------------------------------
BIOB_GEOSF      NVCTTDYEEDVNTVRVAKKAGLKV----------------------------------------------
BIOB_CITK8      NIITTSYQERLDTLDKVREAGIKV----------------------------------------------
MOAA_HALSA      ----------------------------------------------------------------------
MOAA_HALS3      ----------------------------------------------------------------------
MOAA_CLOBK      KSIGGDINKVFKSIEKSLSIGMKIKINTVIMKGINDDEIDDFMNLTKKY---------------------
BIOB_SYNR3      QIISTTYQERLDTLQRARDAGLSLCCGGIIGMGESRRDRASLLQVLA-----------------------
BIOB_SALTY      NIITTTYQERLDTLEKVREAGIKV----------------------------------------------
BIOB_SALTI      NIITTTYQERLDTLEKVREAGIKV----------------------------------------------
BIOB_SALPC      NIITTTYQERLDTLEKVREAGIKV----------------------------------------------
BIOB_SALPB      NIITTTYQERLDTLEKVREAGIKV----------------------------------------------
BIOB_SALNS      NIITTTYQERLDTLEKVREAGIKV----------------------------------------------
BIOB_SALCH      NIITTTYQERLDTLEKVREAGIKV----------------------------------------------
BIOB_SALA4      NIITTTYQERLDTLEKVREAGIKV----------------------------------------------
BIOB_RHOP5      QVVTTSYGDRLDTLAKVHDAGIKV----------------------------------------------
PFLA_STAAW      RLTGKPNTHILNFARKLSDMKQPVWIRHVLVPGYSD----------------------------------
PFLA_STAAS      RLTGKPNTHILNFARKLSDMKQPVWIRHVLVPGYSD----------------------------------
PFLA_STAAR      RLTGKPNTHILNFARKLSDMKQPVWIRHVLVPGYSD----------------------------------
PFLA_STAAN      RLTGKPNTHILNFARKLSDMKQPVWIRHVLVPGYSD----------------------------------
PFLA_STAAM      RLTGKPNTHILNFARKLSDMKQPVWIRHVLVPGYSD----------------------------------
PFLA_STAAC      RLTGKPNTHILNFARKLSDMKQPVWIRHVLVPGYSD----------------------------------
PFLA_STAAB      RLTGKPNTHILNFARKLSDMKQPVWIRHVLVPGYSD----------------------------------
PFLA_STAA8      RLTGKPNTHILNFARKLSDMKQPVWIRHVLVPGYSD----------------------------------
PFLA_STAA3      RLTGKPNTHILNFARKLSDMKQPVWIRHVLVPGYSD----------------------------------
MOAA_METVS      ----------------------------------------------------------------------
BIOB_SHIBS      NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
BIOB_SHIB3      NIITTTYQERLDTLEKVRDAGIKV----------------------------------------------
MOAA_STAHJ      AINNRNITTILDQIDYAVSIGFHVKVNVVIQKGINDDQIIPMVD--------------------------
MOAA_CAMJD      KTLAQKLDSVLSGIDEALNLDLKVKLNTVALKNLNDDELISLLEFAKS----------------------
BIOB_NITEU      EIITTEYQDRLDTLEEVRGANINV----------------------------------------------
BIOB_KLEP3      NIITTTYQERLDTLDKVRDAGIKV----------------------------------------------
Y804_METJA      LLTGKDFNRVLNNIKIASKY-LHTIVRSIYIPG-------------------------------------
PQQE_PSEF5      NLLAGSKKAFAQKLEMARAVKAH-----------------------------------------------
PQQE_METSB      DHIAGAFARKQSVAAWVTAAGLPLTVN-AVIHRANAERAGQMVKAVALGARRVEIAHTQYY---------
PFLA_LISMO      ----------------------------------------------------------------------
PFLA_LISMF      ----------------------------------------------------------------------
PFLA_LISIN      ----------------------------------------------------------------------
MOAA_SULDN      FAIAGKLKNVLDGVNEALAVGLKVKVNMVPMKNMNAQEIVDVLE--------------------------
MOAA_PSESM      RELTRTGDKVIAGIDAANAAGVHTKLNCVVMHGRNDHEINDLLAFAVSFIEEMPLGIESFYSSDQVRERI
MOAA_PSE14      RELTRTGDKVIAGIDAANAAGVHTKLNCVVMHGRNDHEINDLLAFAVSFIEEMPLGIESFYSSDQVRERI
MOAA_PHOLL      ----------------------------------------------------------------------
BIOB_LEPCP      QVISTTYQDRLDTLGNVRDAGINV----------------------------------------------
MOAA_SYNJB      --LITGRDRWRQVVAHQVGFD-PLKLNVVVIPGLNESEVEDL----------------------------
MOAA_PELTS      ADRYAEITRGGNLAGAWEGIGLHVKLNTVIIRGFNEDE----VVAMAMLTINRPLHV-------------
MOAA_BRUSU      RW--GDLSRVLEGIDAAQKAGIHVKINAVALKDFNDAEIPELIRWAHGRGMDVTL---------------
MOAA_BRUSI      RW--GDLSRVLEGIDAAQKAGIHVKINAVALKDFNDAEIPELIRWAHGRGMDVTL---------------
MOAA_BRUME      RW--GDLSRVLEGIDAAQKAGIHVKINAVALKDFNDAEIPELIRWAHGRGMDVTL---------------
MOAA_BRUMB      RW--GDLSRVLEGIDAAQKAGIHVKINAVALKDFNDAEIPELIRWAHGRGMDVTL---------------
MOAA_BRUC2      RW--GDLSRVLEGIDAAQKAGIHVKINAVALKDFNDAEIPELIRWAHGRGMDVTL---------------
BIOB_WIGBR      KIITTKYEDRISTIQNVRNAGIKV----------------------------------------------
BIOB_DESVH      AICSTHYDDDIATVRAARAAGL------------------------------------------------
BIOB_BURXL      QIISTTYQDRLDTLERVRDAGINVCCGGIVGLGESRRERAGLIAQLAN----------------------
BIOB_BURPP      QIISTTYQDRLDTLERVRDAGINVCCGGIVGLGESRRERAGLIAQLAN----------------------
PFLA_CLOPA      KG-KRGFDDFL---KAVENIGVKVWIRHVIVPTLTD----------------------------------
MOAA_STACT      SINNRNIDTILEQIDYAVSIGFKVKINVVVQKGVNDDQIIPMVQ--------------------------
MOAA_STAAW      QSINNRNIKILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLE--------------------------
MOAA_STAAT      QSINNRNIKILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLE--------------------------
MOAA_STAAS      QSINNRNIKILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLE--------------------------
MOAA_STAAR      QSINNRNIKILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLE--------------------------
MOAA_STAAN      QSINNRNIKILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLE--------------------------
MOAA_STAAE      QSINNRNIKILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLE--------------------------
MOAA_STAAC      QSINNRNIKILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLE--------------------------
MOAA_STAA9      QSINNRNIKILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLE--------------------------
MOAA_STAA8      QSINNRNIKILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLE--------------------------
MOAA_STAA3      QSINNRNIKILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLE--------------------------
MOAA_STAA2      QSINNRNIKILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLE--------------------------
MOAA_HELPJ      LKISQKLKNTLEGIEESLKVGLKLKLNTVVMKGVNDDEILELLE--------------------------
MOAA_HAEI8      QITGINFDDVMRGIDRAFEVGYNVKVNSVLMKNLNDKEFEQFL---------------------------
MOAA_GEOSL      ATRIGELQRVLDGIAAADAAGFPPKINMVVMRGVNDGEVADF--ARLTIDRPCTVRFIEYMPA-------
MOAA_CHLTE      EQVSKALDRLLATP------SLTVKLNTLMLRGINNDEIPAFVE--------------------------
BIOB_SODGM      SIVTTSYQDRLDTLSKVRQAGIKV----------------------------------------------
BIOB_POLNA      SIISTTYQDRLDTLENVRGAGINV----------------------------------------------
BIOB_ESCVU      NIITTTYQERLDTLDKVRDAGIKV----------------------------------------------
BIOB_BORA1      NVVTTGYQDRLDTLARVRNAGIHV----------------------------------------------
PQQE_PSEPK      NLLAGSKKAFAQKLEMARAVKAH-----------------------------------------------
MOAA_SULSO      KITGVDFDRVIEGIKSAIDVGLVPVKLNFVVNRRNREEAFKFIELSQNLG-VNEIHLIELHP--------
MOAA_SHISS      ----------------------------------------------------------------------
MOAA_SHIFL      ----------------------------------------------------------------------
MOAA_SHIDS      ----------------------------------------------------------------------
MOAA_SHIBS      ----------------------------------------------------------------------
MOAA_SHIB3      ----------------------------------------------------------------------
MOAA_ESCF3      ----------------------------------------------------------------------
MOAA_ECOSM      ----------------------------------------------------------------------
MOAA_ECOSE      ----------------------------------------------------------------------
MOAA_ECOLU      ----------------------------------------------------------------------
MOAA_ECOL6      ----------------------------------------------------------------------
MOAA_ECOHS      ----------------------------------------------------------------------
MOAA_ECO8A      ----------------------------------------------------------------------
MOAA_ECO81      ----------------------------------------------------------------------
MOAA_ECO7I      ----------------------------------------------------------------------
MOAA_ECO5E      ----------------------------------------------------------------------
MOAA_ECO57      ----------------------------------------------------------------------
MOAA_ECO55      ----------------------------------------------------------------------
MOAA_ECO45      ----------------------------------------------------------------------
MOAA_ECO27      ----------------------------------------------------------------------
MOAA_ECO24      ----------------------------------------------------------------------
MOAA_CYAP4      -LIPAVFDQIVGTQGRTRWQQVPLKLNVVVIPGVNDQEVPDL--AALSLDRHWHIRFIEFMP--------
MOAA_BRUO2      RW--GDLSRVLEGIDAAQKAGIHVKINAVALKDFNDAEIPELI---------------------------
BIOB_RALME      KIITTTYQDRLDTIGHVREAGINV----------------------------------------------
BIOB_PROM5      NIITTTYQDRLETIKRVRNAGINVCCGGIIGLGENNGDRASLLEVLSN----------------------
BIOB_PROM0      NIITTTYQDRLDTIKRVRNAGINVCCGGIIGLGETNGDRASLLEVLSN----------------------
BIOB_BURTA      QIISTTYQDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLIAQLAN----------------------
BIOB_BURPS      QIISTTYQDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLIAQLAN----------------------
BIOB_BURP6      QIISTTYQDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLIAQLAN----------------------
BIOB_BURP1      QIISTTYQDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLIAQLAN----------------------
BIOB_BURP0      QIISTTYQDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLIAQLAN----------------------
BIOB_BURMS      QIISTTYQDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLIAQLAN----------------------
BIOB_BURMA      QIISTTYQDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLIAQLAN----------------------
BIOB_BURM9      QIISTTYQDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLIAQLAN----------------------
BIOB_BURM7      QIISTTYQDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLIAQLAN----------------------
PQQE_KLEP3      AALAGNFQQKLAMARAVKARDYPMVLNF-VLHRHNIDQLDKIIE--------------------------
MOAA_TOLAT      ----------------------------------------------------------------------
MOAA_STAAM      QSINNRNIKILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLE--------------------------
MOAA_STAAB      QSINIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLE--------------------------
MOAA_STAA1      QSINNRNIKILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLE--------------------------
MOAA_HALWD      ----------------------------------------------------------------------
BIOB_SYNS3      KIITTTFQERLETLERVRQAGV------------------------------------------------
BIOB_RUTMC      NVVTTNFQDRLNTLESVQNANIHV----------------------------------------------
BIOB_PROMS      NIITTTYQDRLDTIKRVRNAGINVCCGGIIGLGETNGDRASLLEVLSN----------------------
BIOB_PROM9      NIITTTYQDRLDTIKRVRNAGINVCCGGIIGLGETNGDRASLLEVLSN----------------------
BIOB_CLOP1      KICKTSYEERVKTIKNAKEAGLEV----------------------------------------------
BIOB_ANASK      NVCTTHFDEQLETIRAAKGLGLKLCSGGILGMGETPEQRVEFAEEVRDLG--------------------
BIOB_ANAD2      NVCTTHFDEQLETIRAAKGLGLKLCSGGILGMGETPEQRVEFAEEVRDLG--------------------
BIOB_AGRT5      EIITTTFEDRLETLANVRDAGIKV----------------------------------------------
RLMN_SYNPW      EELAYPYDALLDDCRHYLAIGRRVSFEYILLGGLNDHHAEELADRVGGF--QSHVNLIAYNP--------
MOAA_STRM5      ----------------------------------------------------------------------
MOAA_RHOBA      ----------------------------------------------------------------------
MOAA_METKA      KLTRSRF---------------------------------------------------------------
MOAA_ECOLI      ----------------------------------------------------------------------
MOAA_ECODH      ----------------------------------------------------------------------
MOAA_ECOBW      ----------------------------------------------------------------------
MOAA_CYAP8      KIIASKWQQTWEGIQTAYEVGFNLKLNVVIIPGINEGEIEDL----------------------------
BIOB_GLUDA      SIISTRYQERLDTLAHVRDAGINVCCGGIVGMGENDDDRAGLIASLASLPR-------------------
BIOB_CLOPE      KICKTSYEERVKTIKNAKEAGLEV----------------------------------------------


                         .         *         .         .         .         .         +:350
query           XXXXXXXXXXXXXXXXXDYVYVGNVPGHPGQHTYCPRCGYAVIKRAGDRAVKIELAQGRCPKCGWEIPIR
Y808_METJA      PIETLEMARNLAIEEGLKYVYIGNVPGHEGENTYCPNCGALLIERFNAKIINLDVETKRCKICGEKIDI-
MOAA_ARCFU      ----------------------------------------------------------------------
MOAA_METS5      ----------------------------------------------------------------------
MOAA_AQUAE      ----------------------------------------------------------------------
MOAA_UNCMA      ----------------------------------------------------------------------
MOAA_THEAC      ----------------------------------------------------------------------
MOAA_METTH      ----------------------------------------------------------------------
Y1227_METJA     ----------------------------------------------------------------------
MOAA_THEVO      ----------------------------------------------------------------------
MOAA_ARCB4      ----------------------------------------------------------------------
PFLA_SHIFL      ----------------------------------------------------------------------
PFLA_ECOLI      ----------------------------------------------------------------------
PFLA_ECOL6      ----------------------------------------------------------------------
PFLA_ECO57      ----------------------------------------------------------------------
MOAA_METMA      ----------------------------------------------------------------------
MOAA_PYRKO      ----------------------------------------------------------------------
MOAA_PYRFU      ----------------------------------------------------------------------
MOAA_PYRAE      ----------------------------------------------------------------------
MOAA_CAMFF      ----------------------------------------------------------------------
MOAA_NITSB      ----------------------------------------------------------------------
MOAA_THEYD      ----------------------------------------------------------------------
BIOB_RHOPS      ----------------------------------------------------------------------
BIOB_RHOP2      ----------------------------------------------------------------------
MOAA_VIBSL      ----------------------------------------------------------------------
MOAA_NAUPA      ----------------------------------------------------------------------
MOAA_METAC      ----------------------------------------------------------------------
BIOB_SORC5      ----------------------------------------------------------------------
Y1632_METJA     ----------------------------------------------------------------------
MOAA_PYRHO      ----------------------------------------------------------------------
BIOB_SYNS9      ----------------------------------------------------------------------
MOAA_VIBCM      ----------------------------------------------------------------------
MOAA_VIBCH      ----------------------------------------------------------------------
MOAA_VIBC3      ----------------------------------------------------------------------
MOAA_SULAC      ----------------------------------------------------------------------
MOAA_VIBVY      ----------------------------------------------------------------------
MOAA_VIBVU      ----------------------------------------------------------------------
BIOB_SYNSC      ----------------------------------------------------------------------
BIOB_RALSO      ----------------------------------------------------------------------
BIOB_RALPJ      ----------------------------------------------------------------------
MOAA_HELPY      ----------------------------------------------------------------------
MOAA_DESAD      ----------------------------------------------------------------------
MOAA_VIBPA      ----------------------------------------------------------------------
MOAA_PYRAB      ----------------------------------------------------------------------
MOAA_SULNB      ----------------------------------------------------------------------
MOAA_METJA      ----------------------------------------------------------------------
MOAA_AERHH      ----------------------------------------------------------------------
Y103_METJA      ----------------------------------------------------------------------
PQQE_PSEU2      ----------------------------------------------------------------------
PQQE_PSESM      ----------------------------------------------------------------------
PFLA_STRMU      ----------------------------------------------------------------------
MOAA_METMP      ----------------------------------------------------------------------
MOAA_METM5      ----------------------------------------------------------------------
MOAA_MANSM      ----------------------------------------------------------------------
MOAA_HELP2      ----------------------------------------------------------------------
BIOB_KLEP7      ----------------------------------------------------------------------
PQQE_PSE14      ----------------------------------------------------------------------
PFLA_STAES      ----------------------------------------------------------------------
PFLA_STAEQ      ----------------------------------------------------------------------
MOAA_MOOTA      ----------------------------------------------------------------------
MOAA_METM7      ----------------------------------------------------------------------
MOAA_LACPL      ----------------------------------------------------------------------
MOAA_CAMLR      ----------------------------------------------------------------------
MOAA_ALKMQ      ----------------------------------------------------------------------
BIOB_OCHA4      ----------------------------------------------------------------------
MOCS1_CAEEL     ----------------------------------------------------------------------
MOAA_SULTO      ----------------------------------------------------------------------
MOAA_CAMC5      ----------------------------------------------------------------------
MOAA_CLOBL      ----------------------------------------------------------------------
MOAA_CLOBJ      ----------------------------------------------------------------------
MOAA_CLOBH      ----------------------------------------------------------------------
MOAA_CLOB1      ----------------------------------------------------------------------
CNX2_ARATH      ----------------------------------------------------------------------
BIOB_ESCF3      ----------------------------------------------------------------------
BIOB_ERYLH      ----------------------------------------------------------------------
BIOB2_POLSJ     ----------------------------------------------------------------------
PQQE_RAHAQ      ----------------------------------------------------------------------
PQQE_ERWT9      ----------------------------------------------------------------------
MOAA_PETMO      ----------------------------------------------------------------------
MOAA_HAEDU      ----------------------------------------------------------------------
MOAA_CLOB6      ----------------------------------------------------------------------
MOAA_ACTPJ      ----------------------------------------------------------------------
MOAA_ACTP7      ----------------------------------------------------------------------
MOAA_ACTP2      ----------------------------------------------------------------------
BIOB_SPHWW      ----------------------------------------------------------------------
BIOB_SHIFL      ----------------------------------------------------------------------
BIOB_SHIF8      ----------------------------------------------------------------------
BIOB_SALAR      ----------------------------------------------------------------------
BIOB_ECO5E      ----------------------------------------------------------------------
BIOB_ECO57      ----------------------------------------------------------------------
PFLA_HAEIN      ----------------------------------------------------------------------
MOAA_METM6      ----------------------------------------------------------------------
MOAA_META3      ----------------------------------------------------------------------
MOAA_CLOBM      ----------------------------------------------------------------------
BIOB_SYNPX      ----------------------------------------------------------------------
BIOB_SHISS      ----------------------------------------------------------------------
BIOB_SHIDS      ----------------------------------------------------------------------
BIOB_RHOPT      ----------------------------------------------------------------------
BIOB_RHOPA      ----------------------------------------------------------------------
BIOB_METPB      ----------------------------------------------------------------------
BIOB_ECOSM      ----------------------------------------------------------------------
BIOB_ECOSE      ----------------------------------------------------------------------
BIOB_ECOLU      ----------------------------------------------------------------------
BIOB_ECOLI      ----------------------------------------------------------------------
BIOB_ECOLC      ----------------------------------------------------------------------
BIOB_ECOL5      ----------------------------------------------------------------------
BIOB_ECOHS      ----------------------------------------------------------------------
BIOB_ECODH      ----------------------------------------------------------------------
BIOB_ECO8A      ----------------------------------------------------------------------
BIOB_ECO7I      ----------------------------------------------------------------------
BIOB_ECO55      ----------------------------------------------------------------------
BIOB_ECO27      ----------------------------------------------------------------------
BIOB_ECO24      ----------------------------------------------------------------------
BIOB_AQUAE      ----------------------------------------------------------------------
PQQE_PSEMY      ----------------------------------------------------------------------
MOAA_ACTSZ      ----------------------------------------------------------------------
MOAA_ACAM1      ----------------------------------------------------------------------
BIOB_SILPO      ----------------------------------------------------------------------
BIOB_HYPNA      ----------------------------------------------------------------------
BIOB_ECOUT      ----------------------------------------------------------------------
BIOB_ECOL6      ----------------------------------------------------------------------
BIOB_ECOK1      ----------------------------------------------------------------------
BIOB_ECO81      ----------------------------------------------------------------------
BIOB_ECO45      ----------------------------------------------------------------------
MOAA_MICAN      ----------------------------------------------------------------------
MOAA_EUBAC      ----------------------------------------------------------------------
MOAA_CAMJR      ----------------------------------------------------------------------
MOAA_CAMJJ      ----------------------------------------------------------------------
MOAA_CAMJE      ----------------------------------------------------------------------
MOAA_CAMJ8      ----------------------------------------------------------------------
MOAA_CAMC1      ----------------------------------------------------------------------
MOAA_BACSU      ----------------------------------------------------------------------
BIOB_PSYWF      ----------------------------------------------------------------------
BIOB_JANMA      ----------------------------------------------------------------------
PQQE_ESCVU      ----------------------------------------------------------------------
MOAA_PASMU      ----------------------------------------------------------------------
BIOB_SYNP6      ----------------------------------------------------------------------
BIOB_SYNE7      ----------------------------------------------------------------------
BIOB_SALSV      ----------------------------------------------------------------------
BIOB_SALPK      ----------------------------------------------------------------------
BIOB_SALPA      ----------------------------------------------------------------------
BIOB_SALHS      ----------------------------------------------------------------------
BIOB_SALG2      ----------------------------------------------------------------------
BIOB_SALEP      ----------------------------------------------------------------------
BIOB_SALDC      ----------------------------------------------------------------------
BIOB_NOSP7      ----------------------------------------------------------------------
BIOB_METEP      ----------------------------------------------------------------------
BIOB_METCA      ----------------------------------------------------------------------
BIOB_METC4      ----------------------------------------------------------------------
BIOB_HALHL      ----------------------------------------------------------------------
BIOB_GEOSF      ----------------------------------------------------------------------
BIOB_CITK8      ----------------------------------------------------------------------
MOAA_HALSA      ----------------------------------------------------------------------
MOAA_HALS3      ----------------------------------------------------------------------
MOAA_CLOBK      ----------------------------------------------------------------------
BIOB_SYNR3      ----------------------------------------------------------------------
BIOB_SALTY      ----------------------------------------------------------------------
BIOB_SALTI      ----------------------------------------------------------------------
BIOB_SALPC      ----------------------------------------------------------------------
BIOB_SALPB      ----------------------------------------------------------------------
BIOB_SALNS      ----------------------------------------------------------------------
BIOB_SALCH      ----------------------------------------------------------------------
BIOB_SALA4      ----------------------------------------------------------------------
BIOB_RHOP5      ----------------------------------------------------------------------
PFLA_STAAW      ----------------------------------------------------------------------
PFLA_STAAS      ----------------------------------------------------------------------
PFLA_STAAR      ----------------------------------------------------------------------
PFLA_STAAN      ----------------------------------------------------------------------
PFLA_STAAM      ----------------------------------------------------------------------
PFLA_STAAC      ----------------------------------------------------------------------
PFLA_STAAB      ----------------------------------------------------------------------
PFLA_STAA8      ----------------------------------------------------------------------
PFLA_STAA3      ----------------------------------------------------------------------
MOAA_METVS      ----------------------------------------------------------------------
BIOB_SHIBS      ----------------------------------------------------------------------
BIOB_SHIB3      ----------------------------------------------------------------------
MOAA_STAHJ      ----------------------------------------------------------------------
MOAA_CAMJD      ----------------------------------------------------------------------
BIOB_NITEU      ----------------------------------------------------------------------
BIOB_KLEP3      ----------------------------------------------------------------------
Y804_METJA      ----------------------------------------------------------------------
PQQE_PSEF5      ----------------------------------------------------------------------
PQQE_METSB      ----------------------------------------------------------------------
PFLA_LISMO      ----------------------------------------------------------------------
PFLA_LISMF      ----------------------------------------------------------------------
PFLA_LISIN      ----------------------------------------------------------------------
MOAA_SULDN      ----------------------------------------------------------------------
MOAA_PSESM      AERYTLIPSTDSTQGPSRYWRLAQAPGSPHSHNFCGTCNRVRLTVEG----RLLLCLGNEHSVDLKAVLR
MOAA_PSE14      AERYTLVPSTDSTQGPSRYWRLAEAPGSPHSHNFCGTCNRVRLTVEG----RLLLCLGNEHSVDLKAVLR
MOAA_PHOLL      ----------------------------------------------------------------------
BIOB_LEPCP      ----------------------------------------------------------------------
MOAA_SYNJB      ----------------------------------------------------------------------
MOAA_PELTS      ----------------------------------------------------------------------
MOAA_BRUSU      ----------------------------------------------------------------------
MOAA_BRUSI      ----------------------------------------------------------------------
MOAA_BRUME      ----------------------------------------------------------------------
MOAA_BRUMB      ----------------------------------------------------------------------
MOAA_BRUC2      ----------------------------------------------------------------------
BIOB_WIGBR      ----------------------------------------------------------------------
BIOB_DESVH      ----------------------------------------------------------------------
BIOB_BURXL      ----------------------------------------------------------------------
BIOB_BURPP      ----------------------------------------------------------------------
PFLA_CLOPA      ----------------------------------------------------------------------
MOAA_STACT      ----------------------------------------------------------------------
MOAA_STAAW      ----------------------------------------------------------------------
MOAA_STAAT      ----------------------------------------------------------------------
MOAA_STAAS      ----------------------------------------------------------------------
MOAA_STAAR      ----------------------------------------------------------------------
MOAA_STAAN      ----------------------------------------------------------------------
MOAA_STAAE      ----------------------------------------------------------------------
MOAA_STAAC      ----------------------------------------------------------------------
MOAA_STAA9      ----------------------------------------------------------------------
MOAA_STAA8      ----------------------------------------------------------------------
MOAA_STAA3      ----------------------------------------------------------------------
MOAA_STAA2      ----------------------------------------------------------------------
MOAA_HELPJ      ----------------------------------------------------------------------
MOAA_HAEI8      ----------------------------------------------------------------------
MOAA_GEOSL      ----------------------------------------------------------------------
MOAA_CHLTE      ----------------------------------------------------------------------
BIOB_SODGM      ----------------------------------------------------------------------
BIOB_POLNA      ----------------------------------------------------------------------
BIOB_ESCVU      ----------------------------------------------------------------------
BIOB_BORA1      ----------------------------------------------------------------------
PQQE_PSEPK      ----------------------------------------------------------------------
MOAA_SULSO      ----------------------------------------------------------------------
MOAA_SHISS      ----------------------------------------------------------------------
MOAA_SHIFL      ----------------------------------------------------------------------
MOAA_SHIDS      ----------------------------------------------------------------------
MOAA_SHIBS      ----------------------------------------------------------------------
MOAA_SHIB3      ----------------------------------------------------------------------
MOAA_ESCF3      ----------------------------------------------------------------------
MOAA_ECOSM      ----------------------------------------------------------------------
MOAA_ECOSE      ----------------------------------------------------------------------
MOAA_ECOLU      ----------------------------------------------------------------------
MOAA_ECOL6      ----------------------------------------------------------------------
MOAA_ECOHS      ----------------------------------------------------------------------
MOAA_ECO8A      ----------------------------------------------------------------------
MOAA_ECO81      ----------------------------------------------------------------------
MOAA_ECO7I      ----------------------------------------------------------------------
MOAA_ECO5E      ----------------------------------------------------------------------
MOAA_ECO57      ----------------------------------------------------------------------
MOAA_ECO55      ----------------------------------------------------------------------
MOAA_ECO45      ----------------------------------------------------------------------
MOAA_ECO27      ----------------------------------------------------------------------
MOAA_ECO24      ----------------------------------------------------------------------
MOAA_CYAP4      ----------------------------------------------------------------------
MOAA_BRUO2      ----------------------------------------------------------------------
BIOB_RALME      ----------------------------------------------------------------------
BIOB_PROM5      ----------------------------------------------------------------------
BIOB_PROM0      ----------------------------------------------------------------------
BIOB_BURTA      ----------------------------------------------------------------------
BIOB_BURPS      ----------------------------------------------------------------------
BIOB_BURP6      ----------------------------------------------------------------------
BIOB_BURP1      ----------------------------------------------------------------------
BIOB_BURP0      ----------------------------------------------------------------------
BIOB_BURMS      ----------------------------------------------------------------------
BIOB_BURMA      ----------------------------------------------------------------------
BIOB_BURM9      ----------------------------------------------------------------------
BIOB_BURM7      ----------------------------------------------------------------------
PQQE_KLEP3      ----------------------------------------------------------------------
MOAA_TOLAT      ----------------------------------------------------------------------
MOAA_STAAM      ----------------------------------------------------------------------
MOAA_STAAB      ----------------------------------------------------------------------
MOAA_STAA1      ----------------------------------------------------------------------
MOAA_HALWD      ----------------------------------------------------------------------
BIOB_SYNS3      ----------------------------------------------------------------------
BIOB_RUTMC      ----------------------------------------------------------------------
BIOB_PROMS      ----------------------------------------------------------------------
BIOB_PROM9      ----------------------------------------------------------------------
BIOB_CLOP1      ----------------------------------------------------------------------
BIOB_ANASK      ----------------------------------------------------------------------
BIOB_ANAD2      ----------------------------------------------------------------------
BIOB_AGRT5      ----------------------------------------------------------------------
RLMN_SYNPW      ----------------------------------------------------------------------
MOAA_STRM5      ----------------------------------------------------------------------
MOAA_RHOBA      ----------------------------------------------------------------------
MOAA_METKA      ----------------------------------------------------------------------
MOAA_ECOLI      ----------------------------------------------------------------------
MOAA_ECODH      ----------------------------------------------------------------------
MOAA_ECOBW      ----------------------------------------------------------------------
MOAA_CYAP8      ----------------------------------------------------------------------
BIOB_GLUDA      ----------------------------------------------------------------------
BIOB_CLOPE      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GKPGKYGRLYRSFI
Y808_METJA      --------------
MOAA_ARCFU      --------------
MOAA_METS5      --------------
MOAA_AQUAE      --------------
MOAA_UNCMA      --------------
MOAA_THEAC      --------------
MOAA_METTH      --------------
Y1227_METJA     --------------
MOAA_THEVO      --------------
MOAA_ARCB4      --------------
PFLA_SHIFL      --------------
PFLA_ECOLI      --------------
PFLA_ECOL6      --------------
PFLA_ECO57      --------------
MOAA_METMA      --------------
MOAA_PYRKO      --------------
MOAA_PYRFU      --------------
MOAA_PYRAE      --------------
MOAA_CAMFF      --------------
MOAA_NITSB      --------------
MOAA_THEYD      --------------
BIOB_RHOPS      --------------
BIOB_RHOP2      --------------
MOAA_VIBSL      --------------
MOAA_NAUPA      --------------
MOAA_METAC      --------------
BIOB_SORC5      --------------
Y1632_METJA     --------------
MOAA_PYRHO      --------------
BIOB_SYNS9      --------------
MOAA_VIBCM      --------------
MOAA_VIBCH      --------------
MOAA_VIBC3      --------------
MOAA_SULAC      --------------
MOAA_VIBVY      --------------
MOAA_VIBVU      --------------
BIOB_SYNSC      --------------
BIOB_RALSO      --------------
BIOB_RALPJ      --------------
MOAA_HELPY      --------------
MOAA_DESAD      --------------
MOAA_VIBPA      --------------
MOAA_PYRAB      --------------
MOAA_SULNB      --------------
MOAA_METJA      --------------
MOAA_AERHH      --------------
Y103_METJA      --------------
PQQE_PSEU2      --------------
PQQE_PSESM      --------------
PFLA_STRMU      --------------
MOAA_METMP      --------------
MOAA_METM5      --------------
MOAA_MANSM      --------------
MOAA_HELP2      --------------
BIOB_KLEP7      --------------
PQQE_PSE14      --------------
PFLA_STAES      --------------
PFLA_STAEQ      --------------
MOAA_MOOTA      --------------
MOAA_METM7      --------------
MOAA_LACPL      --------------
MOAA_CAMLR      --------------
MOAA_ALKMQ      --------------
BIOB_OCHA4      --------------
MOCS1_CAEEL     --------------
MOAA_SULTO      --------------
MOAA_CAMC5      --------------
MOAA_CLOBL      --------------
MOAA_CLOBJ      --------------
MOAA_CLOBH      --------------
MOAA_CLOB1      --------------
CNX2_ARATH      --------------
BIOB_ESCF3      --------------
BIOB_ERYLH      --------------
BIOB2_POLSJ     --------------
PQQE_RAHAQ      --------------
PQQE_ERWT9      --------------
MOAA_PETMO      --------------
MOAA_HAEDU      --------------
MOAA_CLOB6      --------------
MOAA_ACTPJ      --------------
MOAA_ACTP7      --------------
MOAA_ACTP2      --------------
BIOB_SPHWW      --------------
BIOB_SHIFL      --------------
BIOB_SHIF8      --------------
BIOB_SALAR      --------------
BIOB_ECO5E      --------------
BIOB_ECO57      --------------
PFLA_HAEIN      --------------
MOAA_METM6      --------------
MOAA_META3      --------------
MOAA_CLOBM      --------------
BIOB_SYNPX      --------------
BIOB_SHISS      --------------
BIOB_SHIDS      --------------
BIOB_RHOPT      --------------
BIOB_RHOPA      --------------
BIOB_METPB      --------------
BIOB_ECOSM      --------------
BIOB_ECOSE      --------------
BIOB_ECOLU      --------------
BIOB_ECOLI      --------------
BIOB_ECOLC      --------------
BIOB_ECOL5      --------------
BIOB_ECOHS      --------------
BIOB_ECODH      --------------
BIOB_ECO8A      --------------
BIOB_ECO7I      --------------
BIOB_ECO55      --------------
BIOB_ECO27      --------------
BIOB_ECO24      --------------
BIOB_AQUAE      --------------
PQQE_PSEMY      --------------
MOAA_ACTSZ      --------------
MOAA_ACAM1      --------------
BIOB_SILPO      --------------
BIOB_HYPNA      --------------
BIOB_ECOUT      --------------
BIOB_ECOL6      --------------
BIOB_ECOK1      --------------
BIOB_ECO81      --------------
BIOB_ECO45      --------------
MOAA_MICAN      --------------
MOAA_EUBAC      --------------
MOAA_CAMJR      --------------
MOAA_CAMJJ      --------------
MOAA_CAMJE      --------------
MOAA_CAMJ8      --------------
MOAA_CAMC1      --------------
MOAA_BACSU      --------------
BIOB_PSYWF      --------------
BIOB_JANMA      --------------
PQQE_ESCVU      --------------
MOAA_PASMU      --------------
BIOB_SYNP6      --------------
BIOB_SYNE7      --------------
BIOB_SALSV      --------------
BIOB_SALPK      --------------
BIOB_SALPA      --------------
BIOB_SALHS      --------------
BIOB_SALG2      --------------
BIOB_SALEP      --------------
BIOB_SALDC      --------------
BIOB_NOSP7      --------------
BIOB_METEP      --------------
BIOB_METCA      --------------
BIOB_METC4      --------------
BIOB_HALHL      --------------
BIOB_GEOSF      --------------
BIOB_CITK8      --------------
MOAA_HALSA      --------------
MOAA_HALS3      --------------
MOAA_CLOBK      --------------
BIOB_SYNR3      --------------
BIOB_SALTY      --------------
BIOB_SALTI      --------------
BIOB_SALPC      --------------
BIOB_SALPB      --------------
BIOB_SALNS      --------------
BIOB_SALCH      --------------
BIOB_SALA4      --------------
BIOB_RHOP5      --------------
PFLA_STAAW      --------------
PFLA_STAAS      --------------
PFLA_STAAR      --------------
PFLA_STAAN      --------------
PFLA_STAAM      --------------
PFLA_STAAC      --------------
PFLA_STAAB      --------------
PFLA_STAA8      --------------
PFLA_STAA3      --------------
MOAA_METVS      --------------
BIOB_SHIBS      --------------
BIOB_SHIB3      --------------
MOAA_STAHJ      --------------
MOAA_CAMJD      --------------
BIOB_NITEU      --------------
BIOB_KLEP3      --------------
Y804_METJA      --------------
PQQE_PSEF5      --------------
PQQE_METSB      --------------
PFLA_LISMO      --------------
PFLA_LISMF      --------------
PFLA_LISIN      --------------
MOAA_SULDN      --------------
MOAA_PSESM      ATPGQPEKLEKAII
MOAA_PSE14      ANPGQPEKLEKAII
MOAA_PHOLL      --------------
BIOB_LEPCP      --------------
MOAA_SYNJB      --------------
MOAA_PELTS      --------------
MOAA_BRUSU      --------------
MOAA_BRUSI      --------------
MOAA_BRUME      --------------
MOAA_BRUMB      --------------
MOAA_BRUC2      --------------
BIOB_WIGBR      --------------
BIOB_DESVH      --------------
BIOB_BURXL      --------------
BIOB_BURPP      --------------
PFLA_CLOPA      --------------
MOAA_STACT      --------------
MOAA_STAAW      --------------
MOAA_STAAT      --------------
MOAA_STAAS      --------------
MOAA_STAAR      --------------
MOAA_STAAN      --------------
MOAA_STAAE      --------------
MOAA_STAAC      --------------
MOAA_STAA9      --------------
MOAA_STAA8      --------------
MOAA_STAA3      --------------
MOAA_STAA2      --------------
MOAA_HELPJ      --------------
MOAA_HAEI8      --------------
MOAA_GEOSL      --------------
MOAA_CHLTE      --------------
BIOB_SODGM      --------------
BIOB_POLNA      --------------
BIOB_ESCVU      --------------
BIOB_BORA1      --------------
PQQE_PSEPK      --------------
MOAA_SULSO      --------------
MOAA_SHISS      --------------
MOAA_SHIFL      --------------
MOAA_SHIDS      --------------
MOAA_SHIBS      --------------
MOAA_SHIB3      --------------
MOAA_ESCF3      --------------
MOAA_ECOSM      --------------
MOAA_ECOSE      --------------
MOAA_ECOLU      --------------
MOAA_ECOL6      --------------
MOAA_ECOHS      --------------
MOAA_ECO8A      --------------
MOAA_ECO81      --------------
MOAA_ECO7I      --------------
MOAA_ECO5E      --------------
MOAA_ECO57      --------------
MOAA_ECO55      --------------
MOAA_ECO45      --------------
MOAA_ECO27      --------------
MOAA_ECO24      --------------
MOAA_CYAP4      --------------
MOAA_BRUO2      --------------
BIOB_RALME      --------------
BIOB_PROM5      --------------
BIOB_PROM0      --------------
BIOB_BURTA      --------------
BIOB_BURPS      --------------
BIOB_BURP6      --------------
BIOB_BURP1      --------------
BIOB_BURP0      --------------
BIOB_BURMS      --------------
BIOB_BURMA      --------------
BIOB_BURM9      --------------
BIOB_BURM7      --------------
PQQE_KLEP3      --------------
MOAA_TOLAT      --------------
MOAA_STAAM      --------------
MOAA_STAAB      --------------
MOAA_STAA1      --------------
MOAA_HALWD      --------------
BIOB_SYNS3      --------------
BIOB_RUTMC      --------------
BIOB_PROMS      --------------
BIOB_PROM9      --------------
BIOB_CLOP1      --------------
BIOB_ANASK      --------------
BIOB_ANAD2      --------------
BIOB_AGRT5      --------------
RLMN_SYNPW      --------------
MOAA_STRM5      --------------
MOAA_RHOBA      --------------
MOAA_METKA      --------------
MOAA_ECOLI      --------------
MOAA_ECODH      --------------
MOAA_ECOBW      --------------
MOAA_CYAP8      --------------
BIOB_GLUDA      --------------
BIOB_CLOPE      --------------