[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for paer1:AAL62507.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1atgA.bssp"
#ERROR : Can't open dsspfile "3cvgC.bssp"
#ERROR : Can't open dsspfile "2capA.bssp"
#ERROR : Can't open dsspfile "1amfA.bssp"
#ERROR : Can't open dsspfile "3cfzA.bssp"
#ERROR : Can't open dsspfile "1d9yA.bssp"
#ERROR : Can't open dsspfile "1d9vA.bssp"
#ERROR : Can't open dsspfile "1a54A.bssp"
#ERROR : Can't open dsspfile "3d4gA.bssp"
#ERROR : Can't open dsspfile "1a40A.bssp"
#ERROR : Can't open dsspfile "3cg3A.bssp"
#ERROR : Can't open dsspfile "3ef7A.bssp"
#ERROR : Can't open dsspfile "3bm5B.bssp"
#ERROR : Can't open dsspfile "3bvpA.bssp"

## Summary of PDB Search
:313
    2e-10  16%  1atgA  [x.x.x] PERIPLASMIC MOLYBDATE-BINDING PROTEIN
    1e-08  21%  3cvgC  [x.x.x] PUTATIVE METAL BINDING PROTEIN
    1e-08  11%  2capA  [x.x.x] HUMAN PHOSPHATE BINDING PROTEIN
    2e-08   8%  1amfA  [x.x.x] MOLYBDATE TRANSPORT PROTEIN MODA
    2e-07  13%  3cfzA  [x.x.x] UPF0100 PROTEIN MJ1186
    9e-06  14%  1d9yA  [c.94.1] PROTEIN (PERIPLASMIC IRON-BINDING PROTEIN)
    2e-05   9%  1d9vA  [c.94.1] PROTEIN (IRON-UTILIZATION PERIPLASMIC PROTEIN)
    3e-05  18%  1a54A  [c.94.1] PHOSPHATE-BINDING PROTEIN
    5e-05  23%  3d4gA  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, LINKER, ZONA
    6e-05  18%  1a40A  [x.x.x] PHOSPHATE-BINDING PERIPLASMIC PROTEIN PRECURSOR
    1e-04   9%  3cg3A  [x.x.x] UPF0100 PROTEIN PH0151
    1e-04  20%  3ef7A  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, LINKER, ZONA
    5e-04  19%  3bm5B  [x.x.x] CYSTEINE SYNTHASE
    0.001  21%  3bvpA  [x.x.x] TP901-1 INTEGRASE
:313

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTTPQKIVLYMATTTSVKDTGLLDVLIPD
1atgA           ----------------------------------------------ELKVVTATNF----LGTLEQLAGQ
3cvgC           ----------------------------------------------------------------------
2capA           -------------------------------------------------IDGGGATLPEK--LYLTPDVL
1amfA           -------------------------------------------------ITVFAAASLTN--AMQDIATQ
3cfzA           ----------------------------------------------KIVLKIFHAGSLSV--PFEEYEKM
1d9yA           -----------------------------------------------------------HKEAAQAVADA
1d9vA           -----------------------------------------------------------HKEAATAVAKA
1a54A           -------------------------------------------------LTGAGATFP--APVYAKWADT
3d4gA           ------------------------------------------TEEGKLVIWINGDKGYN---GLAEVGKK
1a40A           -------------------------------------------------LTGAGATFP--APVYAKWADT
3cg3A           --------------------------------------------EARLIIFHAGSLSIPLSQVEEKFTKY
3ef7A           --------------------------------------------EGKLVIWINGDKGYN---GLAEVGKK
3bm5B           --------------------------------------------------YFNPMSSVKDRVGF-NIVYQ
3bvpA           ---------------------------------------------KKVAIYTRVSTTAEEGFSIDEQIDR


                         .         .         *         .         .         .         .:140
query           FEKWAASRGYNIEVRYTAVGTGQALAMAARGDVDVVIVHAPSLEKQYLENGTLKCRDVIAYNFFIIVGPR
1atgA           FAK-----QTGHAVVISSGSSGPVYAQIVNGPYNVFFSADEKSPEKLDNQGFALPRFTYAIGKLVLWSAK
3cvgC           ------------------------------------ITYSPVAERISIKHGISESPSYYAFRDHFLIGPP
2capA           TAGFAIGVGSGKGKIAFLENKYNQFGTDTTKNVHWAGSDSKLTATQLATYAADKEPGWGKLIQVIPFRKA
1amfA           FKK-----EKGVDVVSSFASSSTLARQIEAGAPADLFISADQKWMDYAVDKKAIDTATLLGNSLVVVAPK
3cfzA           FEK--EHPNVDVEREPAGSVACVRKIIDLGKKADILASADYSLIPQMMMPKYADWYVMFARNEIVLAYTD
1d9yA           FTR-----ATGIKVKLNCAKGDQLAGEGSRSPADVFYSEQIPALATLSAANLLEPLPASTINETRGKGVP
1d9vA           FEQ-----ETGIKVTLNSGKSEQLAEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVP
1a54A           YQKE-----TGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSD-EKLAQEGLFQFPTVIGGVVLAVNIP
3d4gA           FEK-----DTGIKVTVEHPDKLEEKQVAATGDGPDIIFWAHDRFGGYAQSGLLAEIT-------------
1a40A           YQKE-----TGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEK-LAQEGLFQFPTVIGGVVLAVNIP
3cg3A           AQEK-----LGVKVTFQDEASGVRKVTDLKKRADIVAVADYTLIPQLMIPNYTDFYVLFATNEIVIAFTN
3ef7A           FEK-----DTGIKVTVEHPDKLEEKQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFT
3bm5B           AIKDGRLKPGMEIIESTSGNTGIALCQAGAVGYRVNIAMPSTMSVERQMIMKAFGAELILT---------
3bvpA           LTKYAEAMGWQVSDTYTDAGFSRLINDIENKAFDTVLVYKLD----------------------------


                         +         .         .         .         .         *         .:210
query           DDPAGAKSLTATEAFRRIAEAKAPFVSRGDRSGTHLMELSLWRRAIGREPDPKNDTWYISAGAGMGQTLL
1atgA           PGLVDNQKVLAGNGWRHIAISNPQIAPYGLAGTQVLTHLGLLDKLT----AQERIVEANSVGQAHS---Q
3cvgC           SNPAKLSGDKHDAAEAGNTKPPVRFLSRYDKSATNIKEAELWLSIGQVPWATAYSTWYHQYITFPIQALT
2capA           GANAVDLSVDWSGITGAGRSGPIQVVYRAESSGTTELFTRFLNAK-CTTQPGTFAVTTVFANSYSLGLTP
1amfA           ASVQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAWDTLSPKLAPAEDVRG---ALAL
3cfzA           KSKYKDEINSTNWYKILQRPDVKIGFSNPNDDPCQLAELYYKDPTIYDNLVLKHSNIKVEENNGTYVPKE
1d9yA           VAALSGRSRVVVYDTRKLSEKDLEKIGYVPTSGAFLEQIVAIVKLKGEAAWLKGLKEYGKPYAKNSVALA
1d9vA           LTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKKLYAKNSVALQA
1a54A           GLKSGELVLDGKTPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKV-NEEWKNNVGTGS------------
3d4gA           ----------------------------------------------------------------------
1a40A           GLKSGELVLDGKTPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKV-------------------------
3cg3A           KSKYADEMLKNPDKWYEILSRPDVSFGFSDPN-QDPCGYRSVMVMKLAELYYGRPIFKELVEKTTNIYSN
3ef7A           WDAV------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
3bvpA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LANEKSAYTLSDTGTWLRYRDKLPQLDVIVQAAPDLINIYSFSIVKLSNATRLMAQYMKTRGLEVIGNLT
1atgA           TASGAADLGFVALAQIIQAAAKIPGSHWFPPANYYEPIVQQAVITKSTAEKANAEQFMS-----------
3cvgC           AAILLREYTITDYGTYLSIPRGLRDQVIYKKGTNDPLLNPAHLLVGARAKNAEAKEFAK-----------
2capA           LAGAVAAIGSDGVMAAL-----------------------------------------------------
1amfA           VERNEAPLGIVYGSDAV--ASKGVKVVATFPEDSHKKVEYPVAVVHNNATVKAFYDYLKG----------
3cfzA           LDVDTNKLFVRSKETDLLAPLEAGAFDYLFIYKSVANQ--------------------------------
1d9yA           VENGEIDAALINNYYWHAFAREKGVQNVHTRLNFVLVTYSGAAVLKSSQNKDEAKKFVA-----------
1d9vA           VENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVLVSYSGAAVLKASKNQAEAQKFVDEALVAARAEYP
1a54A           ----------------------------------------------------------------------
3d4gA           ----------------------------------------------------------------------
1a40A           ----------------------------------------------------------------------
3cg3A           GTRIYAPKEIIIKDKR------------------------------------------------------
3ef7A           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
3bvpA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           INGVSLFTPINKADPKAMEWIKTAIFGxxxxxx
1atgA           ---------------------------------
3cvgC           ---------------------------------
2capA           ---------------------------------
1amfA           ---------------------------------
3cfzA           ---------------------------------
1d9yA           ---------------------------------
1d9vA           LRADVVSPFNLEPYEKLEAPVVSATTA------
1a54A           ---------------------------------
3d4gA           ---------------------------------
1a40A           ---------------------------------
3cg3A           ---------------------------------
3ef7A           ---------------------------------
3bm5B           ---------------------------------
3bvpA           ---------------------------------