[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for paer1:AAL62792.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bo4A.bssp"
#ERROR : Can't open dsspfile "2c0nA.bssp"
#ERROR : Can't open dsspfile "3ckqA.bssp"
#ERROR : Can't open dsspfile "3e25A.bssp"
#ERROR : Can't open dsspfile "3e26A.bssp"
#ERROR : Can't open dsspfile "2bo7A.bssp"
#ERROR : Can't open dsspfile "2d0jD.bssp"
#ERROR : Can't open dsspfile "2d0jA.bssp"
#ERROR : Can't open dsspfile "3ckjA.bssp"
#ERROR : Can't open dsspfile "2dm9A.bssp"
#ERROR : Can't open dsspfile "3bcvA.bssp"
#ERROR : Can't open dsspfile "2agdA.bssp"
#ERROR : Can't open dsspfile "2ae7A.bssp"
#ERROR : Can't open dsspfile "2d7iA.bssp"

## Summary of PDB Search
:394
    2e-21  20%  2bo4A  [x.x.x] MANNOSYLGLYCERATE SYNTHASE
    4e-19  12%  2c0nA  [x.x.x] A197
    1e-18  21%  3ckqA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-18  23%  3e25A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    4e-18  23%  3e26A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    6e-18  17%  2bo7A  [x.x.x] MANNOSYLGLYCERATE SYNTHASE
    5e-16  13%  2d0jD  [x.x.x] GALACTOSYLGALACTOSYLXYLOSYLPROTEIN 3-BETA-
    9e-16  15%  2d0jA  [x.x.x] GALACTOSYLGALACTOSYLXYLOSYLPROTEIN 3-BETA-
    9e-15  23%  3ckjA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-12   8%  2dm9A  [x.x.x] V-TYPE ATP SYNTHASE SUBUNIT E
    7e-12  17%  3bcvA  [x.x.x] PUTATIVE GLYCOSYLTRANSFERASE PROTEIN
    4e-10  12%  2agdA  [x.x.x] BETA-1,4-GALACTOSYLTRANSFERASE 1
    9e-10  12%  2ae7A  [x.x.x] BETA-1,4-GALACTOSYLTRANSFERASE 1
    5e-09  12%  2d7iA  [x.x.x] POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 10
:394

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MCITVVLPTLNEAQALPKVVEELRATGYRDILVVDGGSTDGTVEEAKRLGLRVIGQYGRGKGMALRTALM
2bo4A           ----VVFPFKHEHPEVLLHNVRVAAAHPRHEVLCIGYERDQTYEAVERAAPEISRATGDGMNTALRYFLE
2c0nA           ----------------------------RTLFFIPSGSVRLPLIDFLVKNDIEYRRNHVAVQREIALDFL
3ckqA           RTISVVLPALDEEDTIGSVIDSISPLVDDELIVLDSGSTDDTEIRAVAAGARVVSPIRPGKGEALWRSLA
3e25A           --ISVVLPALNEEATIESVIDSISPLVDGLLIVLDSGSTDDTEIRAIASGALPEVPVRPGKGEALWRSLA
3e26A           --ISVVLPALNEEATIESVIDSISPLVDGLLIVLDSGSTDDTEIRAIASGARPEVPVRPGKGEALWRSLA
2bo7A           ----VVFPFKHEHPEVLLHNVRVAAAHPVHEVLCIGYERDQTYEAVERAAGTLRPGKGDGMNTALRYFLE
2d0jD           --IYAITPTYSRPVQKAELTRLANTFRQVAWILVEDAAARSELVFLARAGLPATEQRNAGLAWLRQRHQH
2d0jA           --IYAITPTYSRPVQKAELTRLANTFRQVHWILVEDAAAELVSRFLARAGLPSTHQRNAGLAWLRQRHQH
3ckjA           RTISVVLPALDEEDTIGSVIDSISPLVDGLLIVLDSGSTDDTEIRAVAAGARVVSREQAGKGEALWRSLA
2dm9A           -------------------ISSVLEEVKRRTMSEDEYFESVKALLKEAIKELMSNEKTLGLIASRIEEIK
3bcvA           --VSVIVPIYNVEKYLDQCVQALLAQTLSDIILIDDESPDNCPDYAAQYPNIKVIHKKNAGLGACNSGLD
2agdA           HKVAIIIPFRNRQEHLKYWLYYLHPVLQRGIYVINQAGDTIF-------------NRAKLLNVGFQEALK
2ae7A           HKVAIIIPFRNRQEHLKYWLYYLHPVLQRQIYVINQAGDTIF-------------NRAKLLNVGFQEALK
2d7iA           PNTSIIIPFHNEGWSSLLRTVHSVLRSPPEIVLVDDFSDREHLKKPLEDYMALFPSVREGLIRTRMLGAS


                         .         .         *         .         .         .         .:140
query           YVETPYVAVLDADYTYPPAELNKLVPLLRHYDVVIGARQGKMPALYKLGNKVLAWLFRVLFGVDLRDPLT
2bo4A           ETQWERIHFYDADITSFPDWITKAEEAADGYGLVRHYFPTDAMITWMITRTGFALLWPHTELSWIEQPLG
2c0nA           EKDYDTLAFLDEDVVPIEIDFQKVEAKFNEGVVCGYYYL----KTLRGYSVYRKDWEKEIFDGEVNGCGL
3ckqA           ASRGDIVVFVDSDLINPHPMVPWLVGPLLTGVHLVKSFYRRPLGGRVVARPLLAALRPELGCI--LQPLG
3e25A           ATSGDIVVFIDSDLINPPLFVPWLVGPLLTGIQLVKSFYRRVTEL--VARPLLAALRPELGCV--LQPLS
3e26A           ATSGDIVVFIDSDLINPPLFVPWLVGPLLTGIQLVKSFYRRVTEL--VARPLLAALRPELGCV--LQPLS
2bo7A           ETQWERIHFYDADITSFGPDWITKAEEAFGYGLVRHYFPTDAMITWMITRTGFALLWPHTELSWIEQPLG
2d0jD           QRAQPGVLFFADDDNTYSLELFQEMRTTRSVWPVGLVGGRRYERPLVENGKVVGWYTGWRADRPFAIDMA
2d0jA           QRAQPGVLFFADDDNTYSLELFQEMRTTRKVGLVGGRRERPLVENGKVVGWYTGWRADRPFAIDMAGFAN
3ckjA           ASRGDIVVFVDSDLINHPMFVPWLVGPLLTGVHLVKSFYRRPGRVTELARPLLAALRPELGCI--LQPLG
2dm9A           SELGDVSIELGETVDTMGGVIVETEDGRIRIDNTFEARME--RFEGEIRSTIAKVLF-------------
3bcvA           VATGEYVAFCDSDDYVDSDYTYNVAQKYTCDAVFTFKLYKNKNEIHTLKDLIASDPYAREERAIQVSAKV
2agdA           DYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHIS-------------------------------------
2ae7A           DYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHI--------------------------------------
2d7iA           VATGDVITFLDSHCEANVNWLPPLLDRIARNRKTI-----------------------------------


                         +         .         .         .         .         *         .:210
query           GMYVARTDVLREAVTEARGFDLEVEILAKALANGARVAEVPIQYRERIGKKKLRPWHGVGIAVKALELAY
2bo4A           GELLMRREVAAERVRRRSDWGIDTLYTFVTVQQGVSIYECYIPEGKA-----------------------
2c0nA           GFTFIKREFLEKIAFLAIGEDVYFFSTHKPRTYALSSLKAYHFIDERLALSPDRKL--------------
3ckqA           GEYAATRELLTSVFAPGYGVEIGLLVDTFDRLGLDAIAQVNLGVREHRNRPLAELGAMSRQVIATLLSRC
3e25A           GEYAASRELLTSLFAPGYGVEIGLLIDTFDRLGLDAIAQVNLGVRNRLDELGAMSRQVIATLLSRCGIPD
3e26A           GEYAASRELLTSLFAPGYGVEIGLLIDTFDRLGLDAIAQVNLGVRAHRNRPLDELGAMSRQVIATLLSRC
2bo7A           GELLMRREVAAERVRRRSDWGIDTLYTFVTVQQGVSIYECYIPEGKAHRLDLRTMLVECFAAIQSLQHEV
2d0jD           GFAVSLQVVFKRRGSQPGMQESDITTVEELEPKANNCTKVLV-WHTRTEKVNLANEPKYHLDTVKIE---
2d0jA           PKAVFKRRGSQPGMQESDFLQITTVEELEPKANNCTKVLV---WHTRTEKVNLANEPKYHLDTVKIE---
3ckjA           GEYAATRELLTSVFAPGYGVEIGLLVDTFDRLGLDAIAQVNLGVREHRNRPLAELGAMSRQVIATLLSRC
2dm9A           ----------------------------------------------------------------------
3bcvA           VLY--RRNLIEK--KHLRFVSEDLIFNVDVLANSNIVCVLP-----------------------------
2agdA           ----------------------------------------------------------------------
2ae7A           ----------------------------------------------------------------------
2d7iA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RLNPALFLTLIGALMLIPAVALGGWVAYRYFYQGVPHYMLGLAALLMLVIGGISTALxxxxxxxxxxxxx
2bo4A           ----------------------------------------------------------------------
2c0nA           ----------------------------------------------------------------------
3ckqA           GIPDGPEGQSYTQHTWPVSLA-------------------------------------------------
3e25A           SGVGLTQ----FYTRHTWPVSLVDRPPMKV----------------------------------------
3e26A           GIPDSGVGLTQFYTRHTWPVSLVDRPPMKV----------------------------------------
2bo7A           VGQPAIHRQEHPHRVPVHIAERVGYDVEATLHRLMQHWTPRQVELLELFTTPVREGL-------------
2d0jD           ----------------------------------------------------------------------
2d0jA           ----------------------------------------------------------------------
3ckjA           GIPDSGV---------------------------------------------------------------
2dm9A           ----------------------------------------------------------------------
3bcvA           ----------------------------------------------------------------------
2agdA           ----------------------------------------------------------------------
2ae7A           ----------------------------------------------------------------------
2d7iA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bo4A           ----------------------------------------------------------------------
2c0nA           ----------------------------------------------------------------------
3ckqA           ----------------------------------------------------------------------
3e25A           ----------------------------------------------------------------------
3e26A           ----------------------------------------------------------------------
2bo7A           ----------------------------------------------------------------------
2d0jD           ----------------------------------------------------------------------
2d0jA           ----------------------------------------------------------------------
3ckjA           ----------------------------------------------------------------------
2dm9A           ----------------------------------------------------------------------
3bcvA           ----------------------------------------------------------------------
2agdA           ----------------------------------------------------------------------
2ae7A           ----------------------------------------------------------------------
2d7iA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bo4A           --------------------------------------------
2c0nA           --------------------------------------------
3ckqA           --------------------------------------------
3e25A           --------------------------------------------
3e26A           --------------------------------------------
2bo7A           --------------------------------------------
2d0jD           --------------------------------------------
2d0jA           --------------------------------------------
3ckjA           --------------------------------------------
2dm9A           --------------------------------------------
3bcvA           --------------------------------------------
2agdA           --------------------------------------------
2ae7A           --------------------------------------------
2d7iA           --------------------------------------------