[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for paer1:AAL62997.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2as0A.bssp"
#ERROR : Can't open dsspfile "3c6kA.bssp"
#ERROR : Can't open dsspfile "3cc2M.bssp"
#ERROR : Can't open dsspfile "2c7oA.bssp"
#ERROR : Can't open dsspfile "2b9eA.bssp"
#ERROR : Can't open dsspfile "3c6kB.bssp"
#ERROR : Can't open dsspfile "2ar0B.bssp"
#ERROR : Can't open dsspfile "2cwwB.bssp"
#ERROR : Can't open dsspfile "2cwwA.bssp"
#ERROR : Can't open dsspfile "3e05C.bssp"
#ERROR : Can't open dsspfile "2b25A.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "3c6mC.bssp"
#ERROR : Can't open dsspfile "3d79A.bssp"
#ERROR : Can't open dsspfile "3duwA.bssp"
#ERROR : Can't open dsspfile "3c3yA.bssp"
#ERROR : Can't open dsspfile "2ausA.bssp"
#ERROR : Can't open dsspfile "2b3tA.bssp"
#ERROR : Can't open dsspfile "2apoA.bssp"
#ERROR : Can't open dsspfile "1eg2A.bssp"
#ERROR : Can't open dsspfile "2ar0A.bssp"
#ERROR : Can't open dsspfile "3a25A.bssp"
#ERROR : Can't open dsspfile "2cx0A.bssp"
#ERROR : Can't open dsspfile "3eeyA.bssp"
#ERROR : Can't open dsspfile "2an3A.bssp"
#ERROR : Can't open dsspfile "2an3B.bssp"
#ERROR : Can't open dsspfile "3e05D.bssp"
#ERROR : Can't open dsspfile "3e05H.bssp"
#ERROR : Can't open dsspfile "3c6mB.bssp"
#ERROR : Can't open dsspfile "3bgvB.bssp"
#ERROR : Can't open dsspfile "3e05B.bssp"
#ERROR : Can't open dsspfile "3dxxA.bssp"
#ERROR : Can't open dsspfile "3eeyB.bssp"
#ERROR : Can't open dsspfile "3dzbA.bssp"
#ERROR : Can't open dsspfile "3cbgA.bssp"
#ERROR : Can't open dsspfile "3c6mA.bssp"
#ERROR : Can't open dsspfile "3dzbB.bssp"
#ERROR : Can't open dsspfile "1d2hA.bssp"
#ERROR : Can't open dsspfile "2dpmA.bssp"
#ERROR : Can't open dsspfile "3e05A.bssp"
#ERROR : Can't open dsspfile "3c0kA.bssp"
#ERROR : Can't open dsspfile "3diiA.bssp"
#ERROR : Can't open dsspfile "3b3gA.bssp"
#ERROR : Can't open dsspfile "1eizA.bssp"
#ERROR : Can't open dsspfile "3c3pC.bssp"
#ERROR : Can't open dsspfile "2aowA.bssp"
#ERROR : Can't open dsspfile "2cmgA.bssp"
#ERROR : Can't open dsspfile "2b25A.bssp"
#ERROR : Can't open dsspfile "3c6mC.bssp"

## Summary of PDB Search
:379
    4e-15  18%  2as0A  [x.x.x] HYPOTHETICAL PROTEIN PH1915
    8e-13  10%  3c6kA  [x.x.x] SPERMINE SYNTHASE
    8e-12  13%  3cc2M  [x.x.x] 50S RIBOSOMAL PROTEIN L15E
    2e-11  13%  2c7oA  [c.66.1 (10mhA)] MODIFICATION METHYLASE HHAI
    5e-10  21%  2b9eA  [x.x.x] NOL1/NOP2/SUN DOMAIN FAMILY, MEMBER 5 ISOFORM 2
    1e-09  10%  3c6kB  [x.x.x] SPERMINE SYNTHASE
    2e-09   9%  2ar0B  [x.x.x] TYPE I RESTRICTION ENZYME ECOKI M PROTEIN
    4e-09  18%  2cwwB  [x.x.x] PUTATIVE SAM-DEPENDENT RNA METHYLTRANSFERASE
    4e-09  19%  2cwwA  [x.x.x] PUTATIVE SAM-DEPENDENT RNA METHYLTRANSFERASE
    1e-08   8%  3e05C  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    2e-08  12%  2b25A  [x.x.x] HYPOTHETICAL PROTEIN
    5e-08  30%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    6e-08  10%  3c6mC  [x.x.x] SPERMINE SYNTHASE
    1e-07  30%  3d79A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN PH0734
    4e-07  12%  3duwA  [x.x.x] O-METHYLTRANSFERASE, PUTATIVE
    6e-07  11%  3c3yA  [x.x.x] O-METHYLTRANSFERASE
    1e-06  37%  2ausA  [x.x.x] PSEUDOURIDINE SYNTHASE
    1e-06  14%  2b3tA  [x.x.x] PROTEIN METHYLTRANSFERASE HEMK
    1e-06  34%  2apoA  [x.x.x] PROBABLE TRNA PSEUDOURIDINE SYNTHASE B
    2e-06  17%  1eg2A  [c.66.1] MODIFICATION METHYLASE RSRI
    3e-06  10%  2ar0A  [x.x.x] TYPE I RESTRICTION ENZYME ECOKI M PROTEIN
    8e-06  19%  3a25A  [x.x.x] UNCHARACTERIZED PROTEIN PH0793
    1e-05  28%  2cx0A  [x.x.x] HYPOTHETICAL PROTEIN APE0525
    1e-05  15%  3eeyA  [x.x.x] PUTATIVE RRNA METHYLASE
    1e-05   8%  2an3A  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    3e-05   8%  2an3B  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    3e-05   7%  3e05D  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    4e-05   8%  3e05H  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    5e-05   9%  3c6mB  [x.x.x] SPERMINE SYNTHASE
    7e-05   8%  3bgvB  [x.x.x] MRNA CAP GUANINE-N7 METHYLTRANSFERASE
    8e-05   9%  3e05B  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    8e-05  13%  3dxxA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
    9e-05  17%  3eeyB  [x.x.x] PUTATIVE RRNA METHYLASE
    1e-04  11%  3dzbA  [x.x.x] PREPHENATE DEHYDROGENASE
    1e-04  10%  3cbgA  [x.x.x] O-METHYLTRANSFERASE
    2e-04  11%  3c6mA  [x.x.x] SPERMINE SYNTHASE
    2e-04   8%  3dzbB  [x.x.x] PREPHENATE DEHYDROGENASE
    2e-04  13%  1d2hA  [c.66.1] GLYCINE N-METHYLTRANSFERASE
    2e-04   9%  2dpmA  [c.66.1] PROTEIN (ADENINE-SPECIFIC METHYLTRANSFERASE
    2e-04   8%  3e05A  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    3e-04  14%  3c0kA  [x.x.x] UPF0064 PROTEIN YCCW
    4e-04  11%  3diiA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    4e-04  15%  3b3gA  [x.x.x] HISTONE-ARGININE METHYLTRANSFERASE CARM1
    6e-04  12%  1eizA  [c.66.1] FTSJ
    6e-04  10%  3c3pC  [x.x.x] METHYLTRANSFERASE
    7e-04   8%  2aowA  [x.x.x] HISTAMINE N-METHYLTRANSFERASE
    8e-04  10%  2cmgA  [x.x.x] SPERMIDINE SYNTHASE
    8e-05  10%  2b25A  [x.x.x] HYPOTHETICAL PROTEIN(query 36->76)
    1e-05  21%  3c6mC  [x.x.x] SPERMINE SYNTHASE(query 12->75)
:379

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxLYKHFLEFLSDAEIDSLFRSITTPPPRYYIRVNTLKISPRELVKRLNSRGLAVYRDEYI
2as0A           ----------------------------------------------------------------------
3c6kA           ----------------------------------------------------------------------
3cc2M           ----------------------------------------------------------------------
2c7oA           ----------------------------------------------------------------------
2b9eA           ----------------------------------------------------------------------
3c6kB           ----------------------------------------------------------------------
2ar0B           ----------------------------------------------------------------------
2cwwB           ----------------------------------------------------------------------
2cwwA           ----------------------------------------------------------------------
3e05C           ----------------------------------------------------------------------
2b25A           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
3c6mC           ----------------------------------------------------------------------
3d79A           ----------------------------------------------------------------------
3duwA           ----------------------------------------------------------------------
3c3yA           ----------------------------------------------------------------------
2ausA           ----------------------------------------------------------------------
2b3tA           ----------------------------------------------------------------------
2apoA           ----------------------------------------------------------------------
1eg2A           ----------------------------------------------------------------------
2ar0A           ----------------------------------------------------------------------
3a25A           ----------------------------------------------------------------------
2cx0A           ----------------------------------------------------------------------
3eeyA           ----------------------------------------------------------------------
2an3A           ----------------------------------------------------------------------
2an3B           ----------------------------------------------------------------------
3e05D           ----------------------------------------------------------------------
3e05H           ----------------------------------------------------------------------
3c6mB           ----------------------------------------------------------------------
3bgvB           ----------------------------------------------------------------------
3e05B           ----------------------------------------------------------------------
3dxxA           ----------------------------------------------------------------------
3eeyB           ----------------------------------------------------------------------
3dzbA           ----------------------------------------------------------------------
3cbgA           ----------------------------------------------------------------------
3c6mA           ----------------------------------------------------------------------
3dzbB           ----------------------------------------------------------------------
1d2hA           ----------------------------------------------------------------------
2dpmA           ----------------------------------------------------------------------
3e05A           ----------------------------------------------------------------------
3c0kA           ----------------------------------------------------------------------
3diiA           ----------------------------------------------------------------------
3b3gA           ----------------------------------------------------------------------
1eizA           ----------------------------------------------------------------------
3c3pC           ----------------------------------------------------------------------
2aowA           ----------------------------------------------------------------------
2cmgA           ----------------------------------------------------------------------
2b25A           -----------------------------------KFKKLFRLNNFGLLNVPFGKIVGKFPGQILRSSFG
3c6mC           -----------LVLLDLQSQGKEEIDSILNKVEERMKRV-KRLPPIVRGGAIDRYWPTADGRLVEYD--I


                         .         .         *         .         .         .         .:140
query           DDALWVxxxxxxxxxxxxxxxxxxxxxxESVMLGADLYAPAVIKTDRVNIGDEVNIVSDNGRVVALGVAV
2as0A           ----------------------------------------------------------------------
3c6kA           ----------------------------------------------------------------------
3cc2M           ----------------------------------------------------------------------
2c7oA           ----------------------------------------------------------------------
2b9eA           ----------------------------------------------------------------------
3c6kB           ----------------------------------------------------------------------
2ar0B           ---------------------------------------------------------------------L
2cwwB           ----------------------------------------------------------------------
2cwwA           ----------------------------------------------------------------------
3e05C           ----------------------------------------------------------------------
2b25A           -------------------------------------------------------------RLNNFGLLN
2ausC           -------------------------------------VPGIVKLNAGIKKGDLVAIMTLKDELVALGKAM
3c6mC           ----------------------------------------------------------------------
3d79A           ----------------------------PHILNGADVMAPGIVDDEGIKEGDFVFVVEKYGRPLAIGIAL
3duwA           ----------------------------------------------------------------------
3c3yA           ---------------------------------------------------------------------L
2ausA           --------------------------------------------------GDLVAIMTLKDELVALGKAM
2b3tA           ----------------------------------------------------------------------
2apoA           --------------------------------------------------GETVLVETLKGEAVAVGKAL
1eg2A           ----------------------------------------------------------------------
2ar0A           ----------------------------------------------------------------------
3a25A           ----------------------------------------------------------------------
2cx0A           ----------------------------IALAKGAHLIPGVVGVEGSFTRGDVVAALYHETRTPVVGVAE
3eeyA           ----------------------------------------------------------------------
2an3A           ----------------------------------------------------------------------
2an3B           ----------------------------------------------------------------------
3e05D           ----------------------------------------------------------------------
3e05H           ----------------------------------------------------------------------
3c6mB           ----------------------------------------------------------------------
3bgvB           ----------------------------------------------------------------------
3e05B           ----------------------------------------------------------------------
3dxxA           ----------------------------------------------------------------------
3eeyB           ----------------------------------------------------------------------
3dzbA           ----------------------------------------------------------------------
3cbgA           ----------------------------------------------------------------------
3c6mA           ----------------------------------------------------------------------
3dzbB           ----------------------------------------------------------------------
1d2hA           ----------------------------------------------------------------------
2dpmA           ----------------------------------------------------------------------
3e05A           ----------------------------------------------------------------------
3c0kA           ----------------------------------------------------------------------
3diiA           ----------------------------------------------------------------------
3b3gA           ----------------------------------------------------------------------
1eizA           ----------------------------------------------------------------------
3c3pC           ----------------------------------------------------------------------
2aowA           ----------------------------------------------------------------------
2cmgA           ----------------------------------------------------------------------
2b25A           KQYMLR----------------------------------------------------------------
3c6mC           DEVVY-----------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           MDSDEALKARRGLYIKVEKSLYRTPKLRNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGK
2as0A           ------------------------------------------------------------LDVFTYTGGF
3c6kA           ------------------------QNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKD
3cc2M           ---------------------QRQQEWRNEGAVERIERPTRLDKARS--QGYKAKQGVIVARVSVRKGSA
2c7oA           ------------------------------------------------------------IDLFAGLGGF
2b9eA           ---LKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNK
3c6kB           -------------------------NIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKD
2ar0B           GEDDKKLVQAVFHNVSTTITEPKQITALVSNDSLDWQYFTPRPLIKTIIHLLKPQPREVVQDPAAGTAGF
2cwwB           ------------------------------VDLRAGQKTGAYLDQRENRLYMERFRGERALDVFSYAGGF
2cwwA           ------------------------------------------------------------------AGGF
3e05C           -------------------AQYPVIGIDDDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASV
2b25A           VPFGKIVGKFPGQILRSSFGMLRRPAEDYVVLMKRGTAITFPKDINMILSMMDINPGDTVLEAGSGSGGM
2ausC           MSTQEMIERSKGIAVDVEKVF-------------------------------------------------
3c6mC           -GGAIDRYWPTADGRLVEYDIDEVQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKD
3d79A           MSGKVMKEKNRGKAVKVIHHA-------------------------------------------------
3duwA           ------------------------------AAANLPAHDVSPTQGKFLQLLVQIQGARNILEIGTLGGYS
3c3yA           LQSEELCQYILRTSVYPREAGFLKELREANESHPDSYMSTSPLAGQLMSFVLKLVNAKKTIEVGVFTGYS
2ausA           MSTQEMIERSKGIAVDVEKVF-------------------------------------------------
2b3tA           -LTDEQCQQLDALLTRRRDIAHLTGVWSLPLFVSPATLIPRPDTECLVEQALARLPEQRILDLGTGTGAI
2apoA           MNTKEILNADKGVAVDVERVY-------------------------------------------------
1eg2A           ------------------------------------------------------------LDFFAGSGVT
2ar0A           -------------------------TALVSNDSLDWQYFTPRPLIKTIIHLLKPQPREVVQDPAAGTAGF
3a25A           ------------------------------------------------------------VDMFAGIGHL
2cx0A           VDSSALEKLYR-----------------------------------------------------------
3eeyA           ------------------------------------LTIKNSLGQSHDYIKMFVKEGDTVVDATCGNGND
2an3A           -------------------------------------VGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVY
2an3B           ------------------------------------------------------------IDIGSGPTVY
3e05D           ---------------------YPVIGIDDDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASV
3e05H           --------------------QYPVIGIDDDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASV
3c6mB           -------------------------NIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKD
3bgvB           ------------------------------------------------------------LDLGCGKGGD
3e05B           -------------------AQYPVIGIDDDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASV
3dxxA           ------------------------------------------------------------LEIGFGMGAS
3eeyB           ------------------------------------LTIKNSLGQSHDYIKMFVKEGDTVVDATCGNGND
3dzbA           ----------------------------------------------------------------------
3cbgA           -------------------------------HLPGAPMQISPEQAQFLGLLISLTGAKQVLEIGVFRGYS
3c6mA           -------------------------NIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKD
3dzbB           ----------------------------------------------------------------------
1d2hA           ------------------------------------------------------------LDVACGTGVD
2dpmA           ------------------------------------------------------------------NGLY
3e05A           ---------------------YPVIGIDDDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASV
3c0kA           -----------------PIEEHGKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKR---VLNCFSYTGGF
3diiA           ----------------------------------------------------------------------
3b3gA           ------------------------------------------------------------LDVGCGSGIL
1eizA           ------------------------------------------------------------VDLGAAPGGW
3c3pC           IPVDSRIGAY---LDGLLPEADPVVAAEQ-IARERNIPIVDRQTGRLLYLLARIKQPQLVVVPGDGLGCA
2aowA           ---------------------------NHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEI
2cmgA           ------------------------------RQLLFKNFLHIESELLAHMGGCTKKELKEVLIVDGFDLEL
2b25A           ----------------------------------------------------------------------
3c6mC           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TTHLAQMGIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDRDFPKIKAGVALVDPPCTDIGV
2as0A           AIHAAIAGAEVIGIDKSPRAIETAKENAKLNGVEDRKFIVGSAFEEEKLQKKGEKFDIVVLDPPA-----
3c6kA           VLIVKLKPKMVTMVEIDQMVIDGCKKYMRKVLDNLKYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPI
3cc2M           RKRRHKAGRRVTRITRRKDIQRVAEERASRTFPNLRV----LNSYSVGQDGRQKWHEVILIDPNHPAIQN
2c7oA           RLALESCGAEVYSNEWDKYAQEVYEMNFGEKPEGDITQVN-------EKTIPDHD--ILCAGFPCQAFSI
2b9eA           TSHLAALLKNQFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGVRL
3c6kB           VCEIVKKPKMVTMVEIDQMVIDGCKKYMRKVLDNLKYQVLIEDCIPVLKRYAKEGREFDYVI-------N
2ar0B           LIEADRYVRAFIGLELVPGTRRLALNCLLHDIEGNLDHGGAIRLGNTLDGENLPKAHIVATNPPFGSAAG
2cwwB           ALHLALGFREVVAVDSSAEALRRAEENARLNGLGNVRVLEANAFDLLRRLEKEGERFDLVVLDPPAFAKG
2cwwA           ALHLALGFREVVAVDSSAEALRRAEENARLNGLGNVRVLEANAFDLLRRLE---------KEGERFDLVV
3e05C           SIEASNLMGRIFALERNPQYLGFIRDNLKKFVAR---NVTLVEAFAPEGLDDLPDPDRVFIGGSGGMLEE
2b25A           SSKAVGSQGRVISFEVRKDHHDLAKKNYKHWRDSWKLSH--VEEWPDNVDFIHKDISGATFDAVALDMLN
2ausC           ----------------------------------------------------------------------
3c6mC           VLIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVIN
3d79A           ----------------------------------------------------------------------
3duwA           TIWLARGGGRVVTLEASEKHADIARSNIERANLNDRVTGLALDSLQQIENEKYEPFDFIFIDADKQNN--
3c3yA           LLLTALSDGKITAIDFDREAYEIGLPFIRKAGVEHKINFIESDAMLALDNLLQGQESEGSYDFGFVDADK
2ausA           ----------------------------------------------------------------------
2b3tA           ALALASEDCEIIAVDRMPDAVSLAQRNAQHLAIKNIHILQSDW----FSALAGQQFAMIVSNPPYIDEQD
2apoA           ----------------------------------------------------------------------
1eg2A           ARVAIQEGRNSICTDAAPVFKEYYQKQLTFLRSYEIVEGAANFGAALQR---------------------
2ar0A           LIEADRYVRAFIGLELVPGTRRLALNCLLHDIEGDHGGAIRLGNTLGSDGENLPKAHIVATNPPFGSAAG
3a25A           SLPIAVYGAKVIAIEKDPYTFKFLVENIHLNKVEDRMSAYNMDNRDFP---GENIADRILMGYVVRTHEF
2cx0A           ----------------------------------------------------------------------
3eeyA           TAFLASLVGRVFGFDIQDKAIANTTKKLTDLNLIDRVTLIKDGHQNMDKYIDC-PVKAVMFNLGYLPSGD
2an3A           QLLSACSFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIKGECWQDKERQLRARVKRVL---
2an3B           QLLSACSHFDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRV--
3e05D           SIEASNLMPNGRIFALERNPQYLGFIRDNLKKFVANVTLVEAFAPEGLDDLPDPDRVFIGGSGGM-----
3e05H           SIEASNLNGRIFALERNPQYLGFIRDNLKKFV---ARNVTLVEAFAPEGLDDLPDPDRVFIGGSGGMLEE
3c6mB           LCEIVKKPKMVTMVEIDQMVIDGCKKYMRKTLKGDCYQVLIEDCIPVLKRKEGREFDYVINDLTA-----
3bgvB           LLKWKKRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLI-----DKFRDPQMC
3e05B           SIEASNLMGRIFALERNPQYLGFIRDNLKKFVAR-NVTLVEAFAPEGLDDLPDPDRVFIGGSGG------
3dxxA           LVAMAKDEQDFLGIEVHSPGVGACLASAHEEGLSNLRVMCHDAVEVLHKMIPDNSLRMVQLFFPDPWHKA
3eeyB           TAFLASLVGRVFGFDIQDKAIANTTKKLTDLNLIDRVTLIKDGHQNMD-KYIDCPVKAVMFNLGYLPSG-
3dzbA           ---RDHPDYEILGYNRSDYSRNIALERGIVDRATGDFKEFAPLADVIIKQTAYLKELADLDLKDNVIITD
3cbgA           ALAMALQDGQIIACDQDPNATAIAKKYWQKAGVAEKISLRLGPALA---------------TLEQLTQGK
3c6mA           VLIVKLKPKMVTMVEIDQMVIDGCKKYMRK--TCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREDY--
3dzbB           ---RDHPDYEILGYNRSDYSRNIALERGIVDRATGDFKEFAPLADVIIKQTAYLKELADLDLKDNVIITD
1d2hA           SIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSF
2dpmA           RVNSKNQFNVPYGRYKNPKIVDEELISAISVYINNNQLEIKVGD-FEKAIVDVRTGDFVYFDPPYIPLFT
3e05A           SIEASNLMPNGRIFALERNPQYLGFIRDNLKKFARNVTLVEAFAPEGLDDLPDPDRVFIGGSGGMLE---
3c0kA           AVSALGGCSQVVSVDTSQEALDIARQNVELNKLDLSKAEDDVFKLLRTYRDRGEKFDVIVDPPK------
3diiA           --DFLEAGDKVCFIDIDEKRSADF---AKERPNLFYFHGDVADPLTLKKFVEYAMEKLQRIDVLVNNACG
3b3gA           SFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVESLPEQVDIIISEPMGYMLF------
1eizA           SQYVVTQKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVM----SDMAPNMSGTPA
3c3pC           SWWFARAISSRVVIDPDRDNVEHARRLHDNGLIDRVELQVGDPLGIAAGQR-------------------
2aowA           DLQILSVQAQYPGVCINNEVVEPSAEQIAKYKELVAKISNLENVKFAWHKETSSEYQSRMLEKKELQ---
2cmgA           AHQLFKYDTHIDFVQADEKILDSFISFFPHFHEVKNNKNFTHAKQLLDLDIKK-----------------
2b25A           ----------------------------------------------------------------------
3c6mC           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RPKIYHKVTFEAAKTLARYQIQFLKTALKIAPYVIYSTCTLTYIENEGVIEKAGAEIVDAGIEIGAPGWG
2as0A           -----FVQHEKDLKAGLRAYFNVNFAGVKDGGILVTCSCSQHVDLQFKDIIAAGAKAGKFLKLEPYRTQA
3c6kA           STSSTWEFLRLILDLSMK--------VLKQDGKYFTQGNCVNLTEALSLYEEQLGRLY--------CPVE
3cc2M           DDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGSEKTRPSLRSNGG-----------------------
2c7oA           SGK--QKGFEDSRGTLFFDIARIVREKVVFMENVKNFASHDNGNTLEVVKNELDYSFHAKVLNALDYGIP
2b9eA           HALAGFQQRALCHALTFPSL-----------QRLVYSTCSLCQEENEDVVRDALQQNPGAPALPAWPHRG
3c6kB           DLTAVPISTSPSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLY--------CPVE
2ar0B           TNITRTFVHPTSNKQLCFQHIETLHPGGRA--AVVVPDNVLFEGGKGTDIRRDLDKCHLHTITGIFYAQG
2cwwB           KKDVER------AYRAYKEVNLRAIKLLKEGGILATASCSHHMTEPLAMVAEAAQDAHRLLRVVEKRGQP
2cwwA           LDPPAFAKGKKDVERAYRAYKEVNLRALKEGGILATASCSHHMTEPLFYVAEAAQDAHRLLRVVEKRGQP
3e05C           IIDAVDRRLKSVLNAVTLDTLTKAVEFLEDHGYMVEVACVNVAKTKGTEYSHNPVYIITA----------
2b25A           PHVT----------------LPVFYPHLKHGGVCAVYVVNITQVIELLDGIRTLALSCEKISEVIVRDWL
2ausC           ----------------------------------------------------------------------
3c6mC           DLTAVPISTSPSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQ--------LGRLYCPVE
3d79A           ----------------------------------------------------------------------
3duwA           -----------------PAYFEWALKLSRPGTVIIGDNVVREGEVIDNTSNDPRVQGIRRFYELIAAEPR
3c3yA           PN--YIKYHERLMK------------LVKVGGIVAYDNTLWGGTVAQPESEVPDFMKENREAVIELNKLL
2ausA           ----------------------------------------------------------------------
2b3tA           PHLQQGDVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQAFILAGYHDVE--TCRDYGDNE
2apoA           ----------------------------------------------------------------------
1eg2A           ----------------------------------------------------------------------
2ar0A           TNITRTFVHPTSNKQLCFQHIETLHP--GGRAAVVVPDNVLFEGGKGTDIR-------------------
3a25A           IPKALHYHNTVPEKLMPREPFETFKRITK-----------------------------------------
2cx0A           ----------------------------------------------------------------------
3eeyA           ISTRPETTIQALSKAMEL----------------------------------------------------
2an3A           ----------------------------------------------------------------------
2an3B           ----------------------------------------------------------------------
3e05D           ----------------LEEIIDAVDRRLKSEGVIVLNAVTLDTL----------TKAVEFLEDHG-----
3e05H           IIDAVDRRGVIVLNAVTLDTLTKAVEFLEDHGYMVEVACVNVAKEYKMFESHNPVYIITA----------
3c6mB           -----VPISTSSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLY--------CPVE
3bgvB           FDICSCQFVCHYSFESYEQADMMLRNALSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGD
3e05B           ----------------------------------------------------------------------
3dxxA           RHNKRRIVQVPFAELVKS--------KLQLGGVFHMATDWEPYAE-------------------------
3eeyB           ----------------------------------------------------------------------
3dzbA           AGSTKREIVEAAERYLTGKNVQFVGSHPAGSAADAYYIFTPTSLTKETTIPELKSRYVEIDAAEHD----
3cbgA           PLPEFDLIFIDADKRNYPRYYEIGLNLLRRGGLMVIDNVLWGKVTEVDPQEAQTQVLQQFNRDLA-----
3c6mA           ---VINDLTAVPISTTWEFLRLILDLSMKVLKKYFTQGNCVNLTEALSLYEEQLGRLYCPV---------
3dzbB           AGSTKREIVEAAERYLTGKNVQFVGSHPAGSHAADFENAYYIFTPTSLTKETTIPELKDILSGLKSRYVE
1d2hA           AHLPDSKGDQSEHRLA----LKNIASMVRPGGLLVIDHKNYDYILSTGCAPPG-----------------
2dpmA           SYTHEGFSFADQVRLRDA-----FKRLSDTGAYVMLSNSSSALVEE--LYKDFNIHYVEG----------
3e05A           ----------EIIDAVDRR--------LKSEGVIVLNAVTLDTLTK---AVEFLEDHGYMVEVACVNVAK
3c0kA           ----FVENKSQLGACRGYKDINLAIQLLNEGGILLTFSCSGLTSDLFQKI------IADAAIDAGRDVQF
3diiA           SKGILSSLLY------------------------------------------------------------
3b3gA           ----------------------------------------------------------------------
1eizA           VDIPRAMYLVEL-------ALEMCRDVLAPGGSFVVKVFQ---GEGFDEYLREIRSLFTKVKVRKPDSSR
3c3pC           ----------------------------------------------------------------------
2aowA           ----------------------------------------------------------------------
2cmgA           ----------------------------------------------------------------------
2b25A           ----------------------------------------------------------------------
3c6mC           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           CRECRRFLPHVHNTPGFFIAVLRGARKEP
2as0A           PDHPILASKDTEYLKCLFLYVED------
3c6kA           FSKEIVCVPSYLELWVFYTVWKK------
3cc2M           -----------------------------
2c7oA           QKRERIYMICFRNDLNIQ-----------
2b9eA           LSHCLRASPETTLSSGFFVAVIE------
3c6kB           FSKEIVCVPSYLELWVFYTVWKK------
2ar0B           VKTNTKGTVANPNQDKNCTDDVWVYDL--
2cwwB           FDHPLLNHPETHYLKFAVFQVL-------
2cwwA           FDHPLLNHPETHYLKFAVFQVL-------
3e05C           -----------------------------
2b25A           -VCLVARPVHWQPGHTAFLVKLR------
2ausC           -----------------------------
3c6mC           FSKEIVCVPSYLELWVFYTVWKK------
3d79A           -----------------------------
3duwA           VSATALQTVGSKGYDGFIAVV--------
3c3yA           AADPRIEIVHLPLGDGITFCR--------
2ausA           -----------------------------
2b3tA           RVTLGRY----------------------
2apoA           -----------------------------
1eg2A           -----------------------------
2ar0A           -----------------------------
3a25A           -----------------------------
2cx0A           -----------------------------
3eeyA           -----------------------------
2an3A           -----------------------------
2an3B           -----------------------------
3e05D           -----YMVEVACVNVAKTKGLTEYKMFES
3e05H           -----------------------------
3c6mB           FSKEIVCVPSYLELWVFYTVWKK------
3bgvB           DFNLEVDVPEFLVYFPLLNEMAKKY----
3e05B           -----------------------------
3dxxA           -----------------------------
3eeyB           -----------------------------
3dzbA           -----------------------------
3cbgA           -QDERVRISVIPLGDGMTLALKK------
3c6mA           -----------------------------
3dzbB           IDAAE------------------------
1d2hA           -----------------------------
2dpmA           -----------------------------
3e05A           TKEYKMFE----SHNPVYIITAW------
3c0kA           IEQFRQAADHPVIATYPEGLYLKGF----
3diiA           -----------------------------
3b3gA           -----------------------------
1eizA           ARSREVYI---------------------
3c3pC           -----------------------------
2aowA           -----------------------------
2cmgA           -----------------------------
2b25A           -----------------------------
3c6mC           -----------------------------