[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for paer1:AAL63125.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dfuB.bssp"
#ERROR : Can't open dsspfile "1bobA.bssp"
#ERROR : Can't open dsspfile "3dfuA.bssp"
#ERROR : Can't open dsspfile "2cb6A.bssp"
#ERROR : Can't open dsspfile "3dcxA.bssp"
#ERROR : Can't open dsspfile "3ebjC.bssp"
#ERROR : Can't open dsspfile "2e7sD.bssp"
#ERROR : Can't open dsspfile "2e7sK.bssp"
#ERROR : Can't open dsspfile "2a5hA.bssp"
#ERROR : Can't open dsspfile "3cl4A.bssp"
#ERROR : Can't open dsspfile "2e7sB.bssp"
#ERROR : Can't open dsspfile "2e7sH.bssp"
#ERROR : Can't open dsspfile "3cl5A.bssp"
#ERROR : Can't open dsspfile "2a5hB.bssp"
#ERROR : Can't open dsspfile "1cm0B.bssp"
#ERROR : Can't open dsspfile "2e7sN.bssp"
#ERROR : Can't open dsspfile "3efaA.bssp"
#ERROR : Can't open dsspfile "3dntA.bssp"
#ERROR : Can't open dsspfile "2a6aB.bssp"
#ERROR : Can't open dsspfile "2b4bA.bssp"
#ERROR : Can't open dsspfile "2b3uB.bssp"
#ERROR : Can't open dsspfile "2b3uA.bssp"
#ERROR : Can't open dsspfile "1cm0A.bssp"
#ERROR : Can't open dsspfile "3cb8A.bssp"
#ERROR : Can't open dsspfile "2bswA.bssp"
#ERROR : Can't open dsspfile "3ec4A.bssp"
#ERROR : Can't open dsspfile "3d2pA.bssp"
#ERROR : Can't open dsspfile "2b5gB.bssp"
#ERROR : Can't open dsspfile "2b3vA.bssp"
#ERROR : Can't open dsspfile "1b6bA.bssp"
#ERROR : Can't open dsspfile "3cixA.bssp"
#ERROR : Can't open dsspfile "3c8fA.bssp"
#ERROR : Can't open dsspfile "2b4dB.bssp"
#ERROR : Can't open dsspfile "1cjwA.bssp"
#ERROR : Can't open dsspfile "2b4dA.bssp"
#ERROR : Can't open dsspfile "2bw2A.bssp"
#ERROR : Can't open dsspfile "3bj8A.bssp"
#ERROR : Can't open dsspfile "2beiB.bssp"

## Summary of PDB Search
:471
    5e-20  14%  3dfuB  [x.x.x] UNCHARACTERIZED PROTEIN FROM 6-PHOSPHOGLUCONATE
    8e-14   8%  1bobA  [x.x.x] HISTONE ACETYLTRANSFERASE
    3e-13  15%  3dfuA  [x.x.x] UNCHARACTERIZED PROTEIN FROM 6-PHOSPHOGLUCONATE
    1e-12  11%  2cb6A  [x.x.x] MOSQUITOCIDAL TOXIN
    2e-12  10%  3dcxA  [x.x.x] PROTEIN OF UNKNOWN FUNCTION (DUF1696) WITH
    6e-11   8%  3ebjC  [x.x.x] POLYMERASE ACIDIC PROTEIN
    4e-10   5%  2e7sD  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    2e-07   6%  2e7sK  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    4e-07  13%  2a5hA  [x.x.x] L-LYSINE 2,3-AMINOMUTASE
    9e-07   8%  3cl4A  [x.x.x] HEMAGGLUTININ-ESTERASE
    1e-06   5%  2e7sB  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    3e-06   6%  2e7sH  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    4e-06   9%  3cl5A  [x.x.x] HEMAGGLUTININ-ESTERASE
    1e-05  12%  2a5hB  [x.x.x] L-LYSINE 2,3-AMINOMUTASE
    1e-05  15%  1cm0B  [d.108.1] P300/CBP ASSOCIATING FACTOR
    2e-05   6%  2e7sN  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    2e-05  24%  3efaA  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    3e-05   9%  3dntA  [x.x.x] PROTEIN HIPA
    4e-05  13%  2a6aB  [x.x.x] HYPOTHETICAL PROTEIN TM0874
    4e-05  15%  2b4bA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    4e-05  15%  2b3uB  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    5e-05  15%  2b3uA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    5e-05  21%  1cm0A  [d.108.1] P300/CBP ASSOCIATING FACTOR
    7e-05  10%  3cb8A  [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME
    8e-05  28%  2bswA  [x.x.x] GLYPHOSATE N-ACETYLTRANSFERASE
    8e-05  14%  3ec4A  [x.x.x] PUTATIVE ACETYLTRANSFERASE FROM THE GNAT FAMILY
    1e-04  13%  3d2pA  [x.x.x] PUTATIVE ACETYLGLUTAMATE SYNTHASE
    1e-04  14%  2b5gB  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    1e-04  15%  2b3vA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    1e-04  23%  1b6bA  [d.108.1] PROTEIN (ARYLALKYLAMINE N-ACETYLTRANSFERASE)
    1e-04  16%  3cixA  [x.x.x] FEFE-HYDROGENASE MATURASE
    1e-04  11%  3c8fA  [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME
    2e-04  15%  2b4dB  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    2e-04  16%  1cjwA  [d.108.1] PROTEIN (SEROTONIN N-ACETYLTRANSFERASE)
    3e-04  15%  2b4dA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    4e-04   6%  2bw2A  [x.x.x] BYPASS OF FORESPORE C
    5e-04  15%  3bj8A  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    5e-04  21%  2beiB  [x.x.x] DIAMINE ACETYLTRANSFERASE 2
:471

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxVHVVALMTQPFPCPGRCTFCPSSADAPKSYMPDSPVVLRAKRNRYDPYLQTAGRIKVYIENGHTPS
3dfuB           --------------------ARRGQFLHTSLTHGITVDPLETSGGIVSAHPIGQDRWVASALDELGETIV
1bobA           ----------------------------------------------------------------------
3dfuA           ----------------------------------------------------------------------
2cb6A           ------------------------------------------------LLNYLRTNSPSIFVSTTRARYN
3dcxA           ----------------------------------------------------------------------
3ebjC           ----------------------------------------------------------------------
2e7sD           ----------------------------------------------------------------------
2e7sK           ----------------------------------------------------------------------
2a5hA           ----------------DCSYCRHCTRRRFAGQSDDSPERIDKAIDYIRNTPQVR----------------
3cl4A           ----YGLNSTETITTGFDFNCHYLVLPSGNYLAISNELLLTV----------------PTKAICLNKR--
2e7sB           ----------------------------------------------------------------------
2e7sH           ----------------------------------------------------------------------
3cl5A           ----------------FDFNCHYLVLPSGNYLAISNELLL-------TVPTKAICLNKRKDFTPVQVVDS
2a5hB           ----------------DCSYCRHCTRRRFAGQSDDSPERIDKAIDYIRNTPQVR----------------
1cm0B           ----------------------------------------------------------------------
2e7sN           ----------------------------------------------------------------------
3efaA           ----------------------------------------------------------------------
3dntA           --------------KLANGAHTFKPEWLASRYARPLSLSLPLQRGNITSDAVFNFFDNLLPDSPI-----
2a6aB           ----------------------------------------------------------------------
2b4bA           ----------------------------------------------------------------------
2b3uB           ----------------------------------------------------------------------
2b3uA           ----------------------------------------------------------------------
1cm0A           ----------------------------------------------------------------------
3cb8A           ----------------------------------------------------------------------
2bswA           ----------------------------------------------------------------------
3ec4A           ----------------------------------------------------------------------
3d2pA           ----------------------------------------------------------------------
2b5gB           ----------------------------------------------------------------------
2b3vA           ----------------------------------------------------------------------
1b6bA           ----------------------------------------------------------------------
3cixA           ----------------CRKNCLYCGL----------------RRDNKNLKRYRMTPEEIVERARLAVQFG
3c8fA           ----------------CLMRCLYCHNRDTWDT------------HGGKEVTVEDLMKEVVTYRHFMNASG
2b4dB           ----------------------------------------------------------------------
1cjwA           ----------------------------------------------------------------------
2b4dA           ----------------------------------------------------------------------
2bw2A           ----------------EPLQVHVQKVYLDGDVSIEHKHEKVFSMDD-----FWAAYAGWTLVEQKKGYV-
3bj8A           ----------------------------------------------------------------------
2beiB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KIEAVIMGGTFSALPRGYREWFVANIYKALNDFPHWTSSADPTPNLEAEQIRNETAELRMVALTVETRPD
3dfuB           GLLVGELGGSIVEIADDKRAQLAAALTYAGFLSTLQ--------RDASYFLDEFLGDPDVTSDIVDSAQQ
1bobA           ----------------------------------------------------------------------
3dfuA           ------LGGSIVEIADDKRAQLAAALTYAGFLSTLQR--------DASYFLDEFLGDPDVTSDIVDSAQQ
2cb6A           NLGLEITPWTPHSANNNIIYRYEIFAPGGIDINA------SFSRNHNPFPNQDEI-----------TFPG
3dcxA           ----------------------------------------------------------------------
3ebjC           -----------------------------------------------------------------EKAMK
2e7sD           -----------------------------------------LKEDYNTRELSDRDDEVKRLREDIA-KEN
2e7sK           -----------------------------------------------KRELSDRDDEVKRLREDI-AKEN
2a5hA           --DVLLSGGD----ALLVSDETLEYIIAKLREIPHV------------------------EIVRIGSRTP
3cl4A           --KDFTPVQVVDS--RWNNARQSDNMTAVA------------------CQPPYCYFRNSTTNYVGVYDIN
2e7sB           -----------------------------------------------KRELSDRDDEVKRLRED-IAKEN
2e7sH           -----------------------------------------------KRELSDRDDEVKRLREDI-AKEN
3cl5A           ---------------RWNNARQSDNMTAVA------------------CQPPYCYFRNSTTNYVGVYDIN
2a5hB           --DVLLSGGDALLVSDETLEYIIAKLREIPHVEIVRIGSRTPVVLPQ-----------------------
1cm0B           ----------------------------------------------------------------------
2e7sN           -----------------------------------------------KRELSDRDDEVKRLREDI-AKEN
3efaA           ----------------------------------------------------------------------
3dntA           --VRDRIVKRY----HAKSRQPFDLLSEIGRDSVGAVTLIPIAWEKLTE---------------------
2a6aB           ----------------------------------------------------------------------
2b4bA           ----------------------------------------------------------------------
2b3uB           ----------------------------------------------------------------------
2b3uA           ----------------------------------------------------------------------
1cm0A           ----------------------------------------------------------------------
3cb8A           ----------------------------------------------------------------LDTNGF
2bswA           ----------------------------------------------------------------------
3ec4A           ----------------------------------------------------------------------
3d2pA           ----------------------------------------------------------------------
2b5gB           ----------------------------------------------------------------------
2b3vA           ----------------------------------------------------------------------
1b6bA           ----------------------------------------------------------------------
3cixA           AKTIVLQSGEDPYYMP----DVISDIVKEIKKMGVA----------------------------VTLSLG
3c8fA           GGVTASGG------EAILQAEFVRDWFRACKKEGIHT--------------------------CLDTNGF
2b4dB           ----------------------------------------------------------------------
1cjwA           ----------------------------------------------------------------------
2b4dA           ----------------------------------------------------------------------
2bw2A           -----------------LFRKQMDDISPLSKVNGYIGV--------------------------SDNGVI
3bj8A           ----------------------------------------------------------------------
2beiB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           FINKAEVDFLLKLGVTRVELGVQSIYDDVLQKVKRGHGAAEVVEATAILKDSAYKVCYHVMPGLPGSDPD
3dfuB           FQALPSLDEVIAQYDSINNPGRQRLFRDLARRQAEISRAQD-IELWAIQK--------------------
1bobA           ------------------------------------------------------------------SIVG
3dfuA           FQALPSLDEVIAQYDSINNPGRQRLFRDLARRQAEISRAQD-IELWAIQKE-------------------
2cb6A           GIRPEFIRSTYEYHIVRIWINPNFINPSTLNDVSGPSNISKVFWHENHSEGNNMDQDFDMF--APNGEIP
3dcxA           -------------GGNAAEVNLDEL----AQELGPIGDNEQLALAYRVIRDFVFTKRLILIDKQGVTGKK
3ebjC           EYGEDPKIETNKFAAICTHLFMYSHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFRR
2e7sD           ELRTKAEEEADKLNVEDLTASLFDEANNLVADAREKYAIEILNKRLTEQL--------------------
2e7sK           ELRTKAEEEADKLNVEDLTASLFDEANNLVADAREKYAIEILNKRLTEQL--------------------
2a5hA           VVLPQRITP------ELVNLKKYHPVWLNTHFNHPNEITEESTRACQLLADAGVPLGNQSVLLRGVNDCV
3cl4A           HGDAGFTSILSGLFSQQGVFRYDNVSSVWPLYSGRCPTAAD-----------------------------
2e7sB           ELRTKAEEEADKLNVEDLTASLFDEANNLVADAREKYAIEILNKRLTEQLR-------------------
2e7sH           ELRTKAEEEADKLNVEDLTASLFDEANNLVADAREKYAIEILNKR-------------------------
3cl5A           HGDAGFTSILSGLFSQQGVFRYDNVSSVWPLYSGRCPTAAD-----------------------------
2a5hB           -----RITPELVNLKKYHPV------WLNTHFNHPNEITEESTRACQLLADAGVPLGNQSVLLRGVNDCV
1cm0B           ----------------------------------------------------------------------
2e7sN           ELRTKAEEEADKLNVEDLTASLFDEANNLVADAREKYAIEILNKR-------------------------
3efaA           ----------------------------------------------------------------------
3dntA           ----ARLEEVLTAYKADIPLGIRE---ENDFRISVAGAQEKTALLRIGNDWCIPKTPTTHIIKLPIDNEY
2a6aB           ----------------------------------------------------------------------
2b4bA           ----------------------------------------------------------------------
2b3uB           ----------------------------------------------------------------------
2b3uA           ----------------------------------------------------------------------
1cm0A           ----------------------------------------------------------------------
3cb8A           VRRYDPVIDELLEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAKYLANKNVKVWIRYVVVPGWSDDDD
2bswA           ----------------------------------------------------------------------
3ec4A           ----------------------------------------------------------------------
3d2pA           ----------------------------------------------------------------------
2b5gB           ----------------------------------------------------------------------
2b3vA           ----------------------------------------------------------------------
1b6bA           ----------------------------------------------------------------------
3cixA           EWPREYYEKWKEAGADRYLLRHETANPVLHRKLRPDTSFENRLNLLTLKELGYETGAG-SMVGLPGQTID
3c8fA           VRRYDPVIDELLEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAKYLANKNVKVWIRYVVVPGWSDDDD
2b4dB           ----------------------------------------------------------------------
1cjwA           ----------------------------------------------------------------------
2b4dA           ----------------------------------------------------------------------
2bw2A           STFHGRPEPASEPIQSFFQIDLERLESHMQKNLLKGIPFRTKAEFEDVIEH-------------------
3bj8A           ----------------------------------------------------------------------
2beiB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RDLEMVREIFSNPSYMPDCVKIYPLYVVPNTELSEDWRRGLYKSYDEETWLELLAKIYASIPRWVRVMRF
3dfuB           ----------------------------------------------------------------------
1bobA           ENAVQFSPLFTYPIYGDSEKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVR-
3dfuA           ----------------------------------------------------------------------
2cb6A           NN--------------------------------------------------------------------
3dcxA           VSYHSVPYK------AITHFEVETAGTFDDAELKLWISGQKDPLVKELKKGTDVVGIQKTI---------
3ebjC           EVHTYYLEKANKIKSEKT--HIHIFSFTGEEMATKADYT-------------------------------
2e7sD           ----------------------------------------------------------------------
2e7sK           ----------------------------------------------------------------------
2a5hA           HVKELVNKLVKIR---VRPYYIYQCDLSLGLEHFRTPV------SKGIEIIEGLRGHTSGYCVPTFVVDA
3cl4A           ----------------------------------------------------------------------
2e7sB           ----------------------------------------------------------------------
2e7sH           ----------------------------------------------------------------------
3cl5A           ----------------------------------------------------------------------
2a5hB           HVKELVNKLVKIR---VRPYYIYQCDLSLGLEHFRTPV------SKGIEIIEGLRGHTSGYCVPTFVVDA
1cm0B           ----------------------------------------------------------------------
2e7sN           ----------------------------------------------------------------------
3efaA           ----------------------------------------------------------------------
3dntA           YCLLLAKELPDAEIIKAGNVRALAVERFDRRWNAERTVL--LRLPQEDCQTFGLPSSVKYESDGGPGIAR
2a6aB           ----------------------------------------------------------------------
2b4bA           ----------------------------------------------------------------------
2b3uB           ----------------------------------------------------------------------
2b3uA           ----------------------------------------------------------------------
1cm0A           ----------------------------------------------------------------------
3cb8A           SAHRLGEFTRDMG--NVEKIELLPYHELGKHKWVAMGEEYKLDGVKPPKK-ETMERVKG-----------
2bswA           ----------------------------------------------------------------------
3ec4A           ----------------------------------------------------------------------
3d2pA           --------------------------------------------QEAQSLAEHAASETRRLISSAVAALE
2b5gB           ----------------------------------------------------------------------
2b3vA           ----------------------------------------------------------------------
1b6bA           ----------------------------------------------------------------------
3cixA           DLVDDLLFLKEHD---FDMVGIGPFIPHPDTPLEKKGDFTLTLKMVALTRILLPDSNIPATTAMGTIVPG
3c8fA           SAHRLGEFTRDM--GNVEKIELLPYHELGKHKWVAMGEEYKLDGVKPPKKETM-----------------
2b4dB           ----------------------------------------------------------------------
1cjwA           ----------------------------------------------------------------------
2b4dA           ----------------------------------------------------------------------
2bw2A           ----------------------------------------------------------------------
3bj8A           ----------------------------------------------------------------------
2beiB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GRDIPLHHVLDGPRWGNMRQIVLKHMERLGLKCQEIRCREVGIKLANNVPIQPGPVEVKKTEYEASGGLE
3dfuB           ----------------------------------------------------------------------
1bobA           -DEAKWVDCFAEERKTHNLSDVFEKVSEYSLNGEEFVVYKSSHRRVQIFSLLFIEAANYIDETDPSWQIY
3dfuA           ----------------------------------------------------------------------
2cb6A           ----------------------------------------------------------------------
3dcxA           ----------------------------------------------------------------------
3ebjC           ----------------------------------------------------------------------
2e7sD           ----------------------------------------------------------------------
2e7sK           ----------------------------------------------------------------------
2a5hA           PGGGGKTPVPNYVISQSHD---------------------------------------------------
3cl4A           ----------------------------------------------------------------------
2e7sB           ----------------------------------------------------------------------
2e7sH           ----------------------------------------------------------------------
3cl5A           ----------------------------------------------------------------------
2a5hB           GGGKTPVPNYVISQSH------------------------------------------------------
1cm0B           ----------------------------------------------------------------------
2e7sN           ----------------------------------------------------------------------
3efaA           ----------------------------------------------------------------------
3dntA           IAFLGSSEALKDRYDFK-----------------------------------------------------
2a6aB           --------------------VVKKLLDELDLKVKDLDVVGVGIGPGGLTGLRVGTVVGLVSPYDIPVAPL
2b4bA           ----------------------------------------------------------------------
2b3uB           ----------------------------------------------------------------------
2b3uA           ----------------------------------------------------------------------
1cm0A           ----------------------------------------------------------------------
3cb8A           ----------------------------------------------------------------------
2bswA           ----------------------------------------------------------------------
3ec4A           ----------------------------------------------------------------------
3d2pA           GGVHRVQILNGAADLFTRNGIGTSIAKEAFVSIRQAHSGDIPHIAA--LIRPLILLHRSREYLENHISEF
2b5gB           ----------------------------------------------------------------------
2b3vA           ----------------------------------------------------------------------
1b6bA           ----------------------------------------------------------------------
3cixA           GREITLRCGANVIMPNWTPSP---YRQLYQLYPGKICVFEK-----------------------------
3c8fA           ----------------------------------------------------------------------
2b4dB           ----------------------------------------------------------------------
1cjwA           ----------------------------------------------------------------------
2b4dA           ----------------------------------------------------------------------
2bw2A           ----------------------------------------------------------------------
3bj8A           ----------------------------------------------------------------------
2beiB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           IFLEAVGPDDTLYAILRLRIPNRPHRPELYKAALVRELHVYGPAVPVGKQGIWWQHSGMGRELMRLAEEI
3dfuB           ----------------------------------------------------------------------
1bobA           WLLNKKTKELIGFVTTYKYWHYIDKK---------FRAKISQFLI-----FPPYQNKGHGSCLYEAIIQS
3dfuA           ----------------------------------------------------------------------
2cb6A           ----------------------------------------------------------------------
3dcxA           ----------------------------------------------------------------------
3ebjC           ----------------------------------------------------------------------
2e7sD           ----------------------------------------------------------------------
2e7sK           ----------------------------------------------------------------------
2a5hA           ----------------------------------------------------------------------
3cl4A           ----------------------------------------------------------------------
2e7sB           ----------------------------------------------------------------------
2e7sH           ----------------------------------------------------------------------
3cl5A           ----------------------------------------------------------------------
2a5hB           ----------------------------------------------------------------------
1cm0B           ----------------------------------------------------NEQVKGYGTHLMNHLKEY
2e7sN           ----------------------------------------------------------------------
3efaA           -----------------------------------------------------YRGHGWGRQLLTAAEEW
3dntA           ----------------------------------------------------------------------
2a6aB           NSFETA-KSCPADGVVLVARRARKGYHYCAVYLKDKG----------------LNPLKEPSVVSDEELEE
2b4bA           ----------------------------------------------------DYRGFGIGSEILKNLSQV
2b3uB           ----------------------------------------------------DYRGFGIGSEILKNLSQV
2b3uA           -----------------------------------------------------YRGFGIGSEILKNLSQV
1cm0A           ----------------------------------------------------NEQVKGYGTHLMNHLKEY
3cb8A           ----------------------------------------------------------------------
2bswA           ----------------------------------------------------GYREQKAGSSLIKHAEEI
3ec4A           -----------------------------------------------------YRGRGLAARLIRKVIAG
3d2pA           SILEH---DGNLYGCAALKTFAEADCGEIACLAVSPQ----------------AQDGGYGERLLAHIIDK
2b5gB           ----------------------------------------------------DYRGFGIGSEILKNLSQV
2b3vA           ----------------------------------------------------DYRGFGIGSEILKNLSQV
1b6bA           -----------------------------------------------------FRQQGKGSVLLWRYLHH
3cixA           ----------------------------------------------------------------------
3c8fA           ----------------------------------------------------------------------
2b4dB           ----------------------------------------------------DYRGFGIGSEILKNLSQV
1cjwA           ----------------------------------------------------SFRQQGKGSVLLWRYLHH
2b4dA           ----------------------------------------------------DYRGFGIGSEILKNLSQV
2bw2A           ----------------------------------------------------------------------
3bj8A           ----------------------------------------------------DYRGFGIGSEILKNLSQV
2beiB           -----------------------------------------------------YRGQGIGSKIIKKVAEV


                         .         .         +         .         .         .         .:490
query           AGEFGALKIAVISGVGVREYYRKLGYERCGPYMCKPLGAPLGVADDGLVxx
3dfuB           ---------------------------------------------------
1bobA           WLEDKSITEITVPNEAFDDLRDRNDIQRLRKLGYDAVF-------------
3dfuA           ---------------------------------------------------
2cb6A           ---------------------------------------------------
3dcxA           ---------------------------------------------------
3ebjC           ---------------------------------------------------
2e7sD           ---------------------------------------------------
2e7sK           ---------------------------------------------------
2a5hA           ---------------------------------------------------
3cl4A           ---------------------------------------------------
2e7sB           ---------------------------------------------------
2e7sH           ---------------------------------------------------
3cl5A           ---------------------------------------------------
2a5hB           ---------------------------------------------------
1cm0B           HIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATL--
2e7sN           ---------------------------------------------------
3efaA           ATQRGFTHGEIHGELTAQRFYELCGYRVTAGP-------------------
3dntA           ---------------------------------------------------
2a6aB           ITKEFSPKIVLKLISPAVLVEESERLFREK---------------------
2b4bA           ARCRCSSHFLVAEWEPSINFYKRRGASDLS---------------------
2b3uB           ARCRCSSHFLVAEWEPSINFYKRRGASDLS---------------------
2b3uA           ARCRCSSHFLVAEWEPSINFYKRRGASDLSSEEGWRLF-------------
1cm0A           HIKHDILNFLTYADEYAIGYFKKQGFSKEI---------------------
3cb8A           ---------------------------------------------------
2bswA           LRKRGADLLWCNARTSASGYYKKLGFSEQGEV-------------------
3ec4A           AARGEVPYLHSYASASAIRLYESLGFRARRAT-------------------
3d2pA           ARGIGISRL-FALSTNTGEWFAERGFQTAS---------------------
2b5gB           ARCRCSSHFLVAEWEPSINFYKRRGASDLSSE-------------------
2b3vA           ARCRCSSHFLVAEWEPSINFYKRRGASDLS---------------------
1b6bA           VGAQPAVRRAVLMCDALVPFYQRFGFHPAGP--------------------
3cixA           ---------------------------------------------------
3c8fA           ---------------------------------------------------
2b4dB           ARCRCSSHFLVAEWEPSINFYKRRGASDLS---------------------
1cjwA           VGAQPAVRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLT-----------
2b4dA           ARCRCSSHFLVAEWEPSINFYKRRGASDLS---------------------
2bw2A           ---------------------------------------------------
3bj8A           AMKCRCSSMHFLWNEPSINFYKRRGASDLG---------------------
2beiB           ALDKGCFRLAVLDWNQRADLYKALGAQDLT---------------------