[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for paer1:AAL63374.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ahuA.bssp"
#ERROR : Can't open dsspfile "3d2dA.bssp"
#ERROR : Can't open dsspfile "1e0yA.bssp"
#ERROR : Can't open dsspfile "1e8gA.bssp"
#ERROR : Can't open dsspfile "3c0pA.bssp"
#ERROR : Can't open dsspfile "3bw7A.bssp"
#ERROR : Can't open dsspfile "1e8fA.bssp"
#ERROR : Can't open dsspfile "1dznA.bssp"
#ERROR : Can't open dsspfile "2bvfA.bssp"
#ERROR : Can't open dsspfile "3d2jA.bssp"
#ERROR : Can't open dsspfile "3d2hA.bssp"
#ERROR : Can't open dsspfile "3dq0A.bssp"
#ERROR : Can't open dsspfile "3e0tA.bssp"
#ERROR : Can't open dsspfile "2ckjD.bssp"
#ERROR : Can't open dsspfile "2ckjA.bssp"
#ERROR : Can't open dsspfile "2e3tB.bssp"
#ERROR : Can't open dsspfile "2e3tA.bssp"
#ERROR : Can't open dsspfile "2e1qA.bssp"
#ERROR : Can't open dsspfile "2ckjB.bssp"
#ERROR : Can't open dsspfile "3c0qA.bssp"
#ERROR : Can't open dsspfile "2ckjC.bssp"
#ERROR : Can't open dsspfile "3cwcA.bssp"

## Summary of PDB Search
:327
    1e-26  13%  1ahuA  [d.145.1 - d.58.32] VANILLYL-ALCOHOL OXIDASE
    5e-26  11%  3d2dA  [x.x.x] BERBERINE BRIDGE-FORMING ENZYME
    9e-26  15%  1e0yA  [d.145.1 - d.58.32] VANILLYL-ALCOHOL OXIDASE
    9e-26  13%  1e8gA  [d.145.1 - d.58.32] VANILLYL-ALCOHOL OXIDASE
    1e-25  16%  3c0pA  [x.x.x] CYTOKININ DEHYDROGENASE 1
    1e-25  13%  3bw7A  [x.x.x] CYTOKININ DEHYDROGENASE 1
    2e-24  13%  1e8fA  [d.145.1 - d.58.32] VANILLYL-ALCOHOL OXIDASE
    3e-24  16%  1dznA  [d.145.1 - d.58.32] VANILLYL-ALCOHOL OXIDASE
    7e-24  15%  2bvfA  [x.x.x] 6-HYDROXY-D-NICOTINE OXIDASE
    4e-23  13%  3d2jA  [x.x.x] BERBERINE BRIDGE-FORMING ENZYME
    8e-22  13%  3d2hA  [x.x.x] BERBERINE BRIDGE-FORMING ENZYME
    2e-20  19%  3dq0A  [x.x.x] CYTOKININ DEHYDROGENASE 1
    8e-19  17%  3e0tA  [x.x.x] GLUCOOLIGOSACCHARIDE OXIDASE
    2e-16   9%  2ckjD  [x.x.x] XANTHINE OXIDOREDUCTASE
    3e-16  11%  2ckjA  [x.x.x] XANTHINE OXIDOREDUCTASE
    4e-16   9%  2e3tB  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    2e-14   9%  2e3tA  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    3e-14  11%  2e1qA  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    7e-14   9%  2ckjB  [x.x.x] XANTHINE OXIDOREDUCTASE
    1e-12  10%  3c0qA  [x.x.x] UV ENDONUCLEASE
    2e-11  10%  2ckjC  [x.x.x] XANTHINE OXIDOREDUCTASE
    5e-10  12%  3cwcA  [x.x.x] PUTATIVE GLYCERATE KINASE 2
:327

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRPKSVEELVELMKEANRDRRRLLPICKGSKAHLGPPVEYDEELQLWDMPKVLEVDEEEMVVRTSACISA
1ahuA           -APRNVADVQSIVGLANKFSFPLWPISIGRNSGYGGAAPRVSGSVVLDMNRVLEVNVEGAYCVVEPGVTY
3d2dA           -LPGSKEELSNTIRCIRKGSWTIRLRSGGHSYEGLSYTSDTPFILIDNLNRV-SIDLESETAWVESGSTL
1e0yA           -APRNVADVQSIVGLANKFSFPLWPISIGRNSGYGAAPRVSGSVVLDNMNRVLEVNVEGAYCVVEPGVTY
1e8gA           -APRNVADVQSIVGLANKFSFPLWPISIGRNSGYGGAPRVSGSVVLDNMNRVLEVNVEGAYCVVEPGVTY
3c0pA           -YPSSTADLVALLSAANSTPGWPYTIAFRGRGHSLMGQAFAPGGVVVNMASRINVSADGRYVDAGGEQVW
3bw7A           -YPSSTADLVALLSAANSTPGWPYTIAFRGRGHSLMGQAFAPGGVVVNMASRINVSADGRYVDAGGEQVW
1e8fA           -APRNVADVQSIVGLANKFSFPLWPISIGRNSGYGGAPRVSGSVVLDMMNRVLEVNVEGAYCVVEPGVTY
1dznA           -APRNVADVQSIVGLANKFSFPLWPISIGRNSGYGGAPRVSGSVVLDNMNRVLEVNVEGAYCVVEPGVTY
2bvfA           -RCLSAGDVAKSVRYACDNGLEISVRSGGHNPNGYATNDGGIVLDLRLMNSI-HIDTAGSRARIGGGVIS
3d2jA           -LPGSKEELSNTIRCIRKGSWTIRLRSGGHSYEGLSYTSDTPFILIDMNLNRVSIDLESETAWVESGSTL
3d2hA           -LPGSKEELSNTIRCIRKGSWTIRLRSGGHSYEGLSYTSDTPFILIDMNLNRVSIDLESETAWVESGSTL
3dq0A           -YPSSTADLVALLSAANSTPGWPYTIAFRGRGHLMGQAFAPGGVVVNAAPPRINVSADGRYVDAGGEQVW
3e0tA           -IPRSTEDIAAAVQCGLDAGVQISAKGGGHSYGSYGFGGEDGHLMLERMYRV-SVDDNNVATIQGGARLG
2ckjD           -QASTLKELLDLKAQHPDAKLVVGNTEIGI-EMKFKNMLFPMIVCPAWIPELNSVEHGPDGISFGAACPL
2ckjA           -QASTLKELLDLKAQHPDAK----LVVGNTEIGIEKNMLFPMIVCPAWIPELNSVEHGPDGISFGAACPL
2e3tB           IQASTMEELLDLKAQHPDAKLVVGNTEIGIE-MKFKNMLFPLIVCPAWIPELNSVVHGPEGISFGASCPL
2e3tA           -------ELLDLKAQHPDAKLVVGNTE-IGIEMKFKNMLFPLIVCPAWIPELNSVVHGPEGISFGASCPL
2e1qA           -QASTLKELLDLKAQHPDAKLVVGNTEIGIEMK-FKNMLFPMIVCPAWIPELNSVEHGPDGISFGAACPL
2ckjB           -QASTLKELLDLKAQHP--DAKLVVGNTEIGIEMKFKNMLFPMIVCPWIPELNSVEHGPDGISFGAACPL
3c0qA           -NDERLWNVEEVLKAAEALGVPVVVDTLHHALNPGRLPLEEALRLAFPTWRGRPVHLASQDPKKRPGAHA
2ckjC           -QASTLKELLDLKAQHPD--AKLVVGNTEIGIEMKFKNMLFPMIVCPWIPELNSVEHGPDGISFGAACPL
3cwcA           -ATAIEQGFREIWPDADYLKLPLADGGEGTVEAVEATAGRIVHVEVTGP----LGHRVNAFYGLSGDARS


                         .         .         *         .         .         .         .:140
query           VELQEELRKRGRRLALDPPLFRRSSIGGILSTNFYGPMAYRYMTPRDQLLSVKIVTGKGEFMKFGAPVVK
1ahuA           HDLHNYLEANNLRDKLWLDVPDLGGGSVLGNAVERGVGYTPYGDHWMMHSGMEVVLANGELLRTGMLKPE
3d2dA           GELYYAITESSSKLGFTAGWCPTVGTGGHISGGGFGMMSRKYGLAADNVVDAILIDANGAIL-----DRQ
1e0yA           HDLHNYLEANNLRDKLWLDVPSLGGGSVLGNAVERGVGYTPYGDHWMMHSGMEVVLANGELLRTGMLKPE
1e8gA           HDLHNYLEANNLRDKLWLDVPDLGGGSVLGNAVERGVGYTPYGDHWMMHSGMEVVLANGELLRTGMGALP
3c0pA           IDVLRASLARGVAPRSWTDY-LYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITGHGEMVT-----CS
3bw7A           IDVLRASLARGVAPRSWTD-YLYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITGHGEMV-----TCS
1e8fA           HDLHNYLEANNLRDKLWLDVPDLGGGSVLGNAVERGVGYTPYGDHWMMHSGMEVVLANGELLRTGKIAHL
1dznA           HDLHNYLEANNLRDKLWLDVPSLGGGSVLGNAVERGVGYTPYGDHWMMHSGMEVVLANGELLRTGMLKPE
2bvfA           GDLVKEAAKFGLAAVTGMHPK--VGFCGLALNGGVGFLTPKYGLASDNILGATLVTATGDVI-----YCS
3d2jA           GELYYAITESSSKLGFTAGWCPTVGTGGHISGGGFGMMSRKYGLAADNVVDAILIDANGAIL-----DRQ
3d2hA           GELYYAITESSSKLGFTAGWCPTVGTGGHISGGGFGMMSRKYGLAADNVVDAILIDANGAIL-----DRQ
3dq0A           IDVLRASLARGVAPRSWTD-YLYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITGHGEMVTCSKQLNA
3e0tA           YTALELLDQGNRALSHGTAPA--VGVGGHVLGGGYGFATHTHGLTLDWLIGATVVLADASIV-----HVS
2ckjD           SIVEKTLVDAVAKLPAQKQVKSVASVGGNIITASPISDLNPV----FMASGAKLTLVSRGTRRTVQPYSR
2ckjA           SIVEKTLVDAVAKLPAQKQVKSVASVGGNIITASPI----SDLNPVFMASGAKLTLVSRG----------
2e3tB           SLVESVLAEEIAKLPEQKTE-VFRGVMEQLRALAGKQNIITASPISDLNPVFMASGAKLTLVSRGTRRTV
2e3tA           SLVESVLAEEIAKLPEQKTE-VFRGVMEQLRALAIGGNIITASPISDLNPVFMASGAKLTLVSRGTRRTV
2e1qA           SIVEKTLVDAVAKLPAQKQVKSVASVGGNIITASPI----SDLNPVFMASGAKLTLVSRG------TRRT
2ckjB           SIVEKTLVDAVAKLPAQKQVKSVASVGGNIITASPI----SDLNPVFMASGAKLTLVSRGTRRFFPGYRK
3c0qA           FRVTREDWERLLSALPGPADVMVEAKGKEQG---------------------------------------
2ckjC           SIVEKTLVDAVAKLPAQK--TEVFRGVLEQLRWFAGKQVKSVASVGGN-------------------IIT
3cwcA           AFIEAAASGLEQVPPAQRDPLKTTDAGVEHIIIGIGGSATNDGGAGVQALGARLRDAQGNDIAQGGIGLE


                         +         .         .         .         .         *         .:210
query           DVAGYNIKRLIAGSWGTLAVLVEAYMRIYALPESVAVMATGRKSLQELRKLHVAGAAEADGVLYLRFEGV
1ahuA           DQPWSKIAHDGLFSQSNMGIVTKIGIWLMPNPRGYQSYLITLPKDGDLKQAVDIIRPLRLGMALQNVPTI
3d2dA           AMGEDVFWAIRGGGGGVWGAIYAWKIKLLPVPEKVTVFRVTKNVAI--DEATSLLHKWQFVAEELEEDFT
1e0yA           DQPWSKIAHLGLFSQSNMGIVTKIGIWLMPNPGGYQSYLITLPKDGDLKQAVDIIRPLRLGMALQNVPTI
1e8gA           DPYGFGPYIDGLFSQSNMGIVTKIGIWLMPNPGGYQSYLITLPKDGDLKQAVDIIRPLRLGMALQNVPTI
3c0pA           KQLNADLFDAVLGGLGQFGVITRARIAVEPAPARARWVRLVYTDFAAFSADQERLTAPRSFGPMSYVEGS
3bw7A           KQLNADLFDAVLGGLGQFGVITRARIAVEPAPARARWVRLVYTDFAAFSADQERLTAPRSFGPMSYVEG-
1e8fA           FPYGFGPYIDGLFSQSNMGIVTKIGIWLMPNPGGYQSYLITLPKDGDLKQAVDIIRPLRLGMALQNVPTI
1dznA           DQPWSKIAHDGLFSQSNMGIVTKIGIWLMPNPGGYQSYLITLPKDGDLKQAVDIIRPLRLGMALQNVPTI
2bvfA           DDERPELFWAVRGAGPNFGVVTEVEVQLYELPRKMLAGFITWAPSVS-----------------------
3d2jA           AMGEDVFWAIRGGGGGVWGAIYAWKIKLLPVPEKVTVFRVTKNVIDEATSLLHKWQFVAEELEEDFTLSV
3d2hA           AMGEDVFWAIRGGGGGVWGAIYAWKIKLLPVPEKVTVFRVTKNVIDEATSLLHKWQFVAEELEEDFTLSV
3dq0A           -----DLFDAVLGGLGQFGVITRARIAVEPAPARARWVRLVYTDFAAFSA--------------------
3e0tA           ETENADLFWALRGGGGGFAIVSEFEFNTFEAPEIITTYQVTTTWNRK-----------------------
2ckjD           EGEYFSAFKQASRREDDIAKVTSGMRVLFKPGTTEVQEL-------------------------------
2ckjA           TRRTVQMDHTFFPGYRKTLLSPEEILLSIEIPYSREGEYFSAFKQAS------DIAKVTSGMFKPGTTEV
2e3tB           RMDHTFFPGYRKTLLRPEEILLSIEIPYSKEGEFFSAFKQASRREDDIAKVTSG----------------
2e3tA           RMDHTFFPGYRKTLLRPEEILLSIEIPYSKEGEFFSAFKQASRREDDIAKVTSG----------------
2e1qA           VQMDHTFFPGYRKT--------------------------------------------------------
2ckjB           TLLSPEEILLSIEIPYSREGEYFSAFKQASRREDDIAKVTSGMRVLFKPGTTEVQELALCYGGMANRTIS
3c0qA           ----------------------------------------------------------------------
2ckjC           ASPISDLNPVFMASGAKLTLVSRGTRRTVQMDH--TFFPGYRKTLEILLSIEIPYSREGEYFSAFKQ---
3cwcA           TLASIDISGLKRLSACHIEVACDVTNPLTGKEGASAVFGPQKGATPEIERLDTALTRYAH----------


                         .         .         .         +         .         .         .:280
query           KSEVEYRLSKAGRGDVFYDREAEEKWSSVTEAEELFASNEIAKVVAPPASLPETPPGVKYLRYPLLGVMY
1ahuA           -RHILLDAAVLGDKRSYSSRTEPLSDEELDKIAKQLNLGRWNFYGALYGPEPIRRVLWETIKDAFIPGVK
3d2dA           LSVLGGADEKQVWLTMLGFHFGLKTVAKSTFDLLFPELGLVEEDYLEMSWGESFAYLAGLETVSQLNNRF
1e0yA           RHILLDAAVLGDKRSYSSRTEP---------------------------------------------CAA
1e8gA           RHILLDAAVLGDKRSYSSRTEP------LSDEELDKIAKQLNLGRWNFYGALYGPEPIRRVLWETIKDA-
3c0pA           VFVNQSLATDLANTGFFTDADVAAGERNATTVYSIEATLNYDNATAAAAAVDQ---ELASVLGTLSYVEG
3bw7A           ---SVFVNQSLATDLANTGFFTDADVARIVALAGERNATTVYSIEATLNYDNATAAAAA-VDQELASVLG
1e8fA           RHILLDAAVLGDKRSYSSRTEP-------LSDEELDKIAKQLNLGRWNFYGALYGPEPIRRVLWETIKDA
1dznA           ---------------------------------------------------------------ANGWGEY
2bvfA           ---------------------------------------------------------------------L
3d2jA           LGGADEKQVWLTMLGFHFGLKTVAKSTFDLLFPELGLVEEDYLEMSWGESFAYLAG---LETVSQLNNRF
3d2hA           LGGADEKQVWLTMLGFHFGLKTVAKSTFDLLFPELGLVEEDYL---------------------------
3dq0A           ----------------------------------------------------------------------
3e0tA           ----------------------------------------------------------------------
2ckjD           ----------------------------------------------------------------------
2ckjA           QELALCYGGMANRTISALKTTQRQLSKLWKEELLQDVCAGLAEELHLPPDAPGGMV--------------
2e3tB           ----------------------------------------------------------------------
2e3tA           ----------------------------------------------------------------------
2e1qA           ----------------------------------------------------------------------
2ckjB           ALKTTQRQLSKLWKEELLQDVCAGLA--------------------------------------------
3c0qA           ----------------------------------------------------------------------
2ckjC           ----------------------------------------------------------------------
3cwcA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VAGPPPAGVKAYWLKPQRKWDVENRDLMEKIKRVLDPNGVLSPGRLx
1ahuA           FYFPEDTPENSVL----------------------------------
3d2dA           LKFDERAFKTKVDLTKEPLPSKAFYGLLERLSKEPNGFIALNG----
1e0yA           NGWGEYRTHLAFMDQIMNWNNSSFLRFNEVLKNAVDPNGIIAPGKS-
1e8gA           FSAIPGVKFYFPEDTPENSVLRVRDKTMQGIPT--------------
3c0pA           FAFQRDVAYAAFL---VRHFGAAKWNRFVEMKNKYDPKRLLSPGQD-
3bw7A           TLSYVEGFAFQRDVAYAAFL-----DRVHGEEVALNKLGLWRVP---
1e8fA           FSAIPGVKFYFPEDTPENSVLRVRDKTMQGIPT--------------
1dznA           RTHLAFMDQIMET---YNWNNSSFLRFNEVLKNAVDPNGIIAPGKS-
2bvfA           LNNNSEVTAEMVA----EVYKPEVYSRLAAVKREYDPENRFRHNYN-
3d2jA           LKFDERAFKTKVDLTKEPLPSKAFYGLLERLSKEPNGFIALNG----
3d2hA           -----------------------------------------------
3dq0A           ----------------------AKWNRFVEMKNKYDPKRLLSPG---
3e0tA           -----------------KLYWRGNLEKLQAIKAKYDPEDVFGNVVS-
2ckjD           -----------------------------------------------
2ckjA           -----------------------------------------------
2e3tB           -----------------------------------------------
2e3tA           -----------------------------------------------
2e1qA           -----------------------------------------------
2ckjB           -----------------------------------------------
3c0qA           -----------------------------------------------
2ckjC           -----------------------------------------------
3cwcA           -----------------------------------------------