[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for paer1:AAL63787.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2d4zA.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "2ef7A.bssp"
#ERROR : Can't open dsspfile "2ef7B.bssp"
#ERROR : Can't open dsspfile "2d4zB.bssp"
#ERROR : Can't open dsspfile "3ddjA.bssp"
#ERROR : Can't open dsspfile "3ctuB.bssp"
#ERROR : Can't open dsspfile "3ctuA.bssp"
#ERROR : Can't open dsspfile "3c1yA.bssp"
#ERROR : Can't open dsspfile "2bz0B.bssp"
#ERROR : Can't open dsspfile "3bo9A.bssp"
#ERROR : Can't open dsspfile "3bp1B.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"

## Summary of PDB Search
:142
    1e-17  15%  2d4zA  [x.x.x] CHLORIDE CHANNEL PROTEIN
    8e-16   8%  1e6vC  [d.58.31] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
    2e-15  26%  2ef7A  [x.x.x] HYPOTHETICAL PROTEIN ST2348
    3e-15  27%  2ef7B  [x.x.x] HYPOTHETICAL PROTEIN ST2348
    7e-15  12%  2d4zB  [x.x.x] CHLORIDE CHANNEL PROTEIN
    1e-14  22%  3ddjA  [x.x.x] CBS DOMAIN-CONTAINING PROTEIN
    1e-12  19%  3ctuB  [x.x.x] CBS DOMAIN PROTEIN
    6e-12  18%  3ctuA  [x.x.x] CBS DOMAIN PROTEIN
    1e-11  14%  3c1yA  [x.x.x] DNA INTEGRITY SCANNING PROTEIN DISA
    2e-10  13%  2bz0B  [x.x.x] GTP CYCLOHYDROLASE II
    2e-07  12%  3bo9A  [x.x.x] PUTATIVE NITROALKAN DIOXYGENASE
    1e-05   7%  3bp1B  [x.x.x] NADPH-DEPENDENT 7-CYANO-7-DEAZAGUANINE REDUCTASE
    3e-04  10%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
:142

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPVDN
2d4zA           IQVGDIMVRDVTSIASTSTYGDLLHVLRQTKLKFPFVDTPDTNTLLGSIDRTEVEGLLQRRISVVNFETC
1e6vC           --------IAKELLETEIFDPARSGVRGATVHGHALR--LDENGLMLHALRRYRLNEETGEVEYVKDQVG
2ef7A           --IVKEYKTQVISVTKDAKLNDIAKVTEKNIGSVIVVDGN---KPVGIITERDIVKAIGKG-KSLETKAE
2ef7B           -----EYKTQVISVTKDAKLNDIAKVTEKNIGSVIVVDGN---KPVGIITERDIVKAIGKG-KSLETKAE
2d4zB           IQVGDIMVRDVTSIASTSTYGDLLHVLRQTKLKFFPFVDTPDTNFEEMLTLEEIYRWEQREKNVVNFETC
3ddjA           ----------VQTIYKEVRLDQAVKLLRRGFRRLPVIDDDNKVV--GIVTVVNAIKQLAKAVDKLDPVVK
3ctuB           -------PAKNLAVLIDTHNADHATLLLSQTYTRVPVVTD-EKQFVGTIGLRDIAYQEHDLSQEIADTDV
3ctuA           -------PAKNLAVLIDTHNADHATLLLSQTYTRVPVVTDKQ--FVGTIGLRDIAYQEHDLQEIADTDIV
3c1yA           -----ELIEKIKLISPGTELRKALDDIINANFGALIF-LVDDPKKYEDVIQGGFWLDTDLYELSKMDGAI
2bz0B           ---------FSLRCDCGFQLEAALTQIAEEGRGILLYH-RQEGRNIGLLNKIRAYALQDQG--YDTVEAN
3bo9A           ---------KPFGVNIILVSPWADDLVKVCIEEKVPVVT-----FGAGNPTKYIRELKENGTKVIPVVAS
3bp1B           ---------CIDDQDIEIANYEFDDALLQGAAQGEEVSEVLHSHLLKSNQPDWGSVEIAYHGAKNRYLVS
2bbsB           -----------------------------------------------------------GYLDVLTEKEI


                         .         .         *         .         .         .         .:140
query           IMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKESDVIERLVEYAEERIDEIxx
2d4zA           RIDQSPFQLVEGTSLQKTHTLFSLLGLDRAYVTSMGKLVGVVALAEIQAA--------------------
1e6vC           IELDEPIPVGAPADEDDLKERTTIYRIDGTPYREDEELLQVVQRIHELRT--------------------
2ef7A           EFTASLITIREDSPITGALALRQFNIRHLPVVDDKGNLKGIISIRDITRA--------------------
2ef7B           EFTASLITIREDSPITGALALRQFNIRHLPVVDDKGNLKGIISIRDITRA--------------------
2d4zB           RIDQSPFQLVEGTSLQKTHTLFSLLGLDRAYVTSMGKLVGVVALAEIQAA--------------------
3ddjA           DVVTNLVTIDELASVNRAAAEIVKRIGSLLILNKDNTIRGIITERDLLIA------LHHILVEKFKE---
3ctuB           HTKTDVAVVSPDFTITEVLHKLVDESF-LPVVDAEGIFQGIITRKSILKANALLHDFSKEYE--------
3ctuA           HTKTDVAVVSPDFTITEVLHKLVD-ESFLPVVDAEGIFQGIITRKSILKA--------------------
3c1yA           VLSETKIYYANVHLVPDPTIPTGETGTRHRLAKQTGKVVIAVSRRRN-----------------------
2bz0B           HQLGFAADERDFTLCADMFKLLGVNEVR--LLTNNPKKVEILTEAGINIVERV-----------------
3bo9A           DSLARVERAGADAVIAEGESGGHIGEVTTFLVNKVSRSVNIPVI--------------------------
3bp1B           FREHNEFHEQCVERIFTDIRYCQPQSLTVYARYTRGGLDINPFRSSHQSA--------------------
2bbsB           FESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRDSFDQFSERRNSILTET--


                         +         .         .         .         .         *         .:210
query           xx
2d4zA           --
1e6vC           --
2ef7A           --
2ef7B           --
2d4zB           --
3ddjA           --
3ctuB           --
3ctuA           --
3c1yA           --
2bz0B           --
3bo9A           --
3bp1B           --
2bbsB           --