[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for paer1:AAL64120.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bkjA.bssp"
#ERROR : Can't open dsspfile "3e10A.bssp"
#ERROR : Can't open dsspfile "3ek3A.bssp"
#ERROR : Can't open dsspfile "2b67A.bssp"
#ERROR : Can't open dsspfile "3bemB.bssp"
#ERROR : Can't open dsspfile "3bm1B.bssp"
#ERROR : Can't open dsspfile "3bm1A.bssp"
#ERROR : Can't open dsspfile "3bemA.bssp"
#ERROR : Can't open dsspfile "3bm2A.bssp"
#ERROR : Can't open dsspfile "3e39A.bssp"
#ERROR : Can't open dsspfile "3e39B.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"

## Summary of PDB Search
:274
    2e-24  28%  1bkjA  [d.90.1] NADPH-FLAVIN OXIDOREDUCTASE
    5e-22  25%  3e10A  [x.x.x] PUTATIVE NADH OXIDASE
    8e-22  20%  3ek3A  [x.x.x] NITROREDUCTASE
    5e-21  20%  2b67A  [x.x.x] COG0778: NITROREDUCTASE
    7e-21  16%  3bemB  [x.x.x] PUTATIVE NAD(P)H NITROREDUCTASE YDFN
    6e-20  19%  3bm1B  [x.x.x] PROTEIN YDJA
    2e-19  21%  3bm1A  [x.x.x] PROTEIN YDJA
    4e-19  17%  3bemA  [x.x.x] PUTATIVE NAD(P)H NITROREDUCTASE YDFN
    1e-13  20%  3bm2A  [x.x.x] PROTEIN YDJA
    5e-13  26%  3e39A  [x.x.x] PUTATIVE NITROREDUCTASE
    2e-12  26%  3e39B  [x.x.x] PUTATIVE NITROREDUCTASE
    1e-06  22%  3bm2B  [x.x.x] PROTEIN YDJA
:274

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSVEEALA
1bkjA           ----------------------------------------------------------------TIETIL
3e10A           ------------------------------------------------------------------DIIN
3ek3A           ---------------------------------------------------------------EVLETIK
2b67A           ----------------------------------------------------------------FLELNK
3bemB           ----------------------------------------------------------------FTHLVN
3bm1B           ----------------------------------------------------------------ALELLI
3bm1A           ----------------------------------------------------------------ALELLI
3bemA           ----------------------------------------------------------------FTHLVN
3bm2A           ----------------------------------------------------------------ALELLI
3e39A           ---------------------------------------------------------------PVLQAIR
3e39B           ---------------------------------------------------------------PVLQAIR
3bm2B           ------------------------------------------------------------------ELLI


                         .         .         *         .         .         .         .:140
query           NRRSVREFREEPLTLEELGQILWAAYGISETRYGLRTAPSAGAQYPLEVYVVVGEHGVKTGDGYLKPGVY
1bkjA           AHRSIRKFTAVPITDEQRQTIIQAG----------LAASSSSMLQVVSIVRVTDS---------------
3e10A           NRRSIRNYKGKKVEKEKIEKLLRAAQ-----------APSAGNQQPWEFIVLEDRE--------------
3ek3A           ARRSVRAYDRKQIPADDLNAILEAG----------AYAPSGHYE-TWHFTAVCNTVKLE-----------
2b67A           KRHATKHFTDKLVDPKDVRTAIEIA----------TLAPSAHNSQPWKFVVVREKNAELAKL-AYGSNFE
3bemB           ERRSASNFLSGHPITKEDLNEFELV----------ALAPSAFNLQHTKYVTVLDQDVKEKLKQAANGQYK
3bm1B           NRRSASRLAEPAPTGEQLQNILRAG----------MRAPDHKSMQPWHFFVIEGEGRER----FSAVLEQ
3bm1A           NRRSASRLAEPAPTGEQLQNILRAG----------MRAPDHKSMQPWHFFVIEG------------EGRE
3bemA           ERRSASNFLSGHPITKEDLNEFELV----------ALAPSAFNLQHTKYVTVLDQDVKE----KLKQAAN
3bm2A           NRRSASRLAEPAPTGEQL-----------------QNILRAGRAQPWHFFVIEGEG--------------
3e39A           QRRSIRRYTDEAVSDEAVRLILEAG----------IWAPSGLNNQPCRFLVIRAD---------------
3e39B           QRRSIRRYTDEAVSDEAVRLILEAG----------IWAPSGLNNQPCRFLVIRAD---------------
3bm2B           NRRSASRLAEPAPTGEQLQNILRAG----------------RAPDWHFFVIEGEG--------------R


                         +         .         .         .         .         *         .:210
query           HYDPHSHTLTLKKTGDFREALYQAALEQIWVLKAPVSLIFTAVYSRTXXXXXXXXXXXXXPMDLGHAGQN
1bkjA           ---------------EKRNELAQFAGNQAYVESAAEFLVFCIDYQRHATINPDVQADFTELVDSGIMAQN
3e10A           ----------------NIDKLSNFSKYANSLKTAPLAIVLLADEEKKISEW----------EQDAAAAEN
3ek3A           ---------------ELNERIKGAKSDDKHLRERGHSETYCCYYHAPTLVIVSNEPKQWWAGDCACAIEN
2b67A           QVSSAPVTIALFT----DTDLAKRARKIARVGGANNFSEEQLQYFKNLPAEFARYSEQQVSDYLANAGAN
3bemB           VVSSSAVLLVL---GDKQAYQQAADIYEGLKVLGILNKQEYDHVQDTVSFYENRGEQFKRDEAIRNASLS
3bm1B           GAIAA------------GSDDKAIDKARNAPFRAPLIITVVAKCEENHKVPRWEQE-----MSAGCAVMA
3bm1A           RFSAVLEQGAIAAG----SDDKAIDKARNAPFRAPLIITVVAKCEENHKVPRWEQE-----MSAGCAVMA
3bemA           GQYKVSSSAVLLVLGDKQAYQQAADIYEGLKVLGILNKQEYDHVQDTVSFYENRGEQFKRDEAIRNASLS
3bm2A           ----------------RERFSAVLEQGAIAAGSDDKAIDKARNAPFRAPLIITVVAK----CEQESAGCA
3e39A           ---------------DPRCDILAAHTRGHIVRGAKVIILVFLDREAYNEVKD---------HQAAGAAVQ
3e39B           ---------------DPRCDILAAHTYGHIVRGAKVIILVFLDREAYNEVKD---------HQAAGAAVQ
3bm2B           ERFSAVLEQGAIAAGSDDKAIDKA---RNAPFRAPLIITVVAKVPR---------------WEQESAGCA


                         .         .         .         +         .         .         .:280
query           VYLQATALGLGTVAVGAFYDDQVAEILDLPDGETPLYIMPIGRPIYQYRLTEAELIRYIEKSRR
1bkjA           CLLAAESMGLGGVYIGGLSAAQVDELLGLPENSAVLFGMCLGHPDQNPRLPAHVVVHENQYQEL
3e10A           ILLEAAYLDLGAVWLGAQPIVKNLKEFNLKSNIKPFCVISVGYPENSEDRFDAKRIHI------
3ek3A           -FLAATSLGIASCWINQLEVRAYLTSLGVPENHKVYGCVALGYKAEGAKTVKAGTITIVE----
2b67A           LVLALTDQGIGSNIILGFDKSKVNEVLEIEDRFRPELLITVGYTDEKYRLPVDEIIEK------
3bemB           AFLSAAAAGWDTCPIG-FDAEAVKRILNIDDQFEVVITIGKEKTESRRRKPVNEFVEY------
3bm1B           MQMAAVAQGFGGIWRSGAESPVVREAFGCREQDKIVGFLYLGTPQLKVPDPTPFV---------
3bm1A           MQMAAVAQGFGGIWRSGAESPVVREAFGCREQDKIVGFLYLGTP--------------------
3bemA           AFLSAAAAGWDTCPIG-FDAEAVKRILNIDDQFEVVITIGKEKTESRRRKPVNEFVEY------
3bm2A           VAQAAVAQGFGGIWRSGAESPVVREAFGCREQDKIVGFLYLGTP--------------------
3e39A           NLLAAHALQLGAVWLGE-IINQAATLLPAPARLSFEAAIAAGHP--------------------
3e39B           NLLAAHALQLGAVWLGEI-INQAATLLPAPARLSFEAAIAAGHP--------------------
3bm2B           VAQAAVAQGFGWRSGALTESPVVREAFGCREQDKIVGFLYLGTPQLVPD---------------