[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for paer1:AAL64389.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1clcA.bssp"
#ERROR : Can't open dsspfile "3e6uD.bssp"
#ERROR : Can't open dsspfile "3e6uA.bssp"
#ERROR : Can't open dsspfile "3boaA.bssp"
#ERROR : Can't open dsspfile "3e73A.bssp"
#ERROR : Can't open dsspfile "2ahfA.bssp"
#ERROR : Can't open dsspfile "3e6uB.bssp"
#ERROR : Can't open dsspfile "2c1yB.bssp"
#ERROR : Can't open dsspfile "1c4fA.bssp"
#ERROR : Can't open dsspfile "2awmA.bssp"
#ERROR : Can't open dsspfile "2awjA.bssp"
#ERROR : Can't open dsspfile "2c0fB.bssp"
#ERROR : Can't open dsspfile "2afaA.bssp"
#ERROR : Can't open dsspfile "2c0eA.bssp"
#ERROR : Can't open dsspfile "2c0gB.bssp"
#ERROR : Can't open dsspfile "2c0fA.bssp"
#ERROR : Can't open dsspfile "1dyvA.bssp"
#ERROR : Can't open dsspfile "2ec4A.bssp"
#ERROR : Can't open dsspfile "3ed8D.bssp"
#ERROR : Can't open dsspfile "2b5eA.bssp"
#ERROR : Can't open dsspfile "2dlxA.bssp"
#ERROR : Can't open dsspfile "2c0gA.bssp"
#ERROR : Can't open dsspfile "2c0eB.bssp"
#ERROR : Can't open dsspfile "2b1lB.bssp"
#ERROR : Can't open dsspfile "2aytA.bssp"
#ERROR : Can't open dsspfile "2dj3A.bssp"
#ERROR : Can't open dsspfile "1a8lA.bssp"
#ERROR : Can't open dsspfile "2c1yA.bssp"
#ERROR : Can't open dsspfile "2dj1A.bssp"
#ERROR : Can't open dsspfile "3dxbA.bssp"
#ERROR : Can't open dsspfile "3ed3A.bssp"
#ERROR : Can't open dsspfile "2av4A.bssp"
#ERROR : Can't open dsspfile "2aytB.bssp"
#ERROR : Can't open dsspfile "1a8yA.bssp"
#ERROR : Can't open dsspfile "2dj2A.bssp"
#ERROR : Can't open dsspfile "2b1lA.bssp"
#ERROR : Can't open dsspfile "2cvkA.bssp"
#ERROR : Can't open dsspfile "3ed3B.bssp"
#ERROR : Can't open dsspfile "3dxbD.bssp"
#ERROR : Can't open dsspfile "2dj0A.bssp"
#ERROR : Can't open dsspfile "3d6iB.bssp"
#ERROR : Can't open dsspfile "3dvwA.bssp"
#ERROR : Can't open dsspfile "3dyrB.bssp"

## Summary of PDB Search
:667
    8e-18   8%  1clcA  [x.x.x] ENDOGLUCANASE CELD EC: 3.2.1.4
    6e-17  11%  3e6uD  [x.x.x] LANC-LIKE PROTEIN 1
    5e-16  12%  3e6uA  [x.x.x] LANC-LIKE PROTEIN 1
    8e-16  10%  3boaA  [x.x.x] PROTEIN DISULFIDE-ISOMERASE
    3e-15  10%  3e73A  [x.x.x] LANC-LIKE PROTEIN 1
    4e-14  13%  2ahfA  [x.x.x] UNSATURATED GLUCURONYL HYDROLASE
    8e-11  11%  3e6uB  [x.x.x] LANC-LIKE PROTEIN 1
    2e-10   6%  2c1yB  [x.x.x] WINDBEUTEL PROTEIN
    5e-10   4%  1c4fA  [d.22.1] GREEN FLUORESCENT PROTEIN
    8e-09   6%  2awmA  [x.x.x] GREEN FLUORESCENT PROTEIN
    3e-08   4%  2awjA  [x.x.x] GREEN-FLUORESCENT PROTEIN
    4e-08   7%  2c0fB  [x.x.x] WINDBEUTEL PROTEIN
    6e-08  12%  2afaA  [x.x.x] NAG ISOMERASE
    6e-08   5%  2c0eA  [x.x.x] WINDBEUTEL PROTEIN
    6e-08   4%  2c0gB  [x.x.x] WINDBEUTEL PROTEIN
    2e-07   4%  2c0fA  [x.x.x] WINDBEUTEL PROTEIN
    2e-07   6%  1dyvA  [c.47.1 (1un2A)] THIOL-DISULFIDE INTERCHANGE PROTEIN
    5e-07  13%  2ec4A  [x.x.x] FAS-ASSOCIATED FACTOR 1
    6e-07   7%  3ed8D  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    7e-07  18%  2b5eA  [x.x.x] PROTEIN DISULFIDE-ISOMERASE
    9e-07  14%  2dlxA  [x.x.x] UBX DOMAIN-CONTAINING PROTEIN 7
    1e-06   8%  2c0gA  [x.x.x] WINDBEUTEL PROTEIN
    2e-06   8%  2c0eB  [x.x.x] WINDBEUTEL PROTEIN
    7e-06  16%  2b1lB  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBE
    9e-06  21%  2aytA  [x.x.x] GLUTAREDOXIN-LIKE PROTEIN
    1e-05  15%  2dj3A  [x.x.x] PROTEIN DISULFIDE-ISOMERASE A4
    2e-05  17%  1a8lA  [x.x.x] PROTEIN DISULFIDE OXIDOREDUCTASE
    2e-05   4%  2c1yA  [x.x.x] WINDBEUTEL PROTEIN
    2e-05  14%  2dj1A  [x.x.x] PROTEIN DISULFIDE-ISOMERASE A4
    3e-05  17%  3dxbA  [x.x.x] THIOREDOXIN N-TERMINALLY FUSED TO PUF60(UHM)
    5e-05  14%  3ed3A  [x.x.x] PROTEIN DISULFIDE-ISOMERASE MPD1
    6e-05  16%  2av4A  [x.x.x] THIOREDOXIN-LIKE PROTEIN 4A (DIM1)
    7e-05  23%  2aytB  [x.x.x] GLUTAREDOXIN-LIKE PROTEIN
    1e-04   7%  1a8yA  [x.x.x] CALSEQUESTRIN
    1e-04  14%  2dj2A  [x.x.x] PROTEIN DISULFIDE-ISOMERASE A4
    2e-04  16%  2b1lA  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBE
    3e-04  20%  2cvkA  [x.x.x] THIOREDOXIN
    5e-04  17%  3ed3B  [x.x.x] PROTEIN DISULFIDE-ISOMERASE MPD1
    5e-04  21%  3dxbD  [x.x.x] THIOREDOXIN N-TERMINALLY FUSED TO PUF60(UHM)
    0.001   6%  2dj0A  [x.x.x] THIOREDOXIN-RELATED TRANSMEMBRANE PROTEIN 2
    0.001  10%  3d6iB  [x.x.x] MONOTHIOL GLUTAREDOXIN-3
    0.001   9%  3dvwA  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBA
    0.001  27%  3dyrB  [x.x.x] THIOREDOXIN-1
:667

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xDARERCLSSSSSPFVLEGLKSRVKWWGWCKEAFEAAEREDKPVLVDVGAVWCHWCHVMDERTYNDEEVA
1clcA           ----------------------------------------------------------------------
3e6uD           ----------------------------------------------------------------------
3e6uA           ----------------------------------------------------------------------
3boaA           ------------------------AVVKLATDSFNEYIQSHDLVLAEFFAPWCGHCKNM------APEYV
3e73A           ----------------------------------------------------------------------
2ahfA           ----------------------------------------------------------------------
3e6uB           ----------------------------------------------------------------------
2c1yB           ---------------------TGCVDLD--ELSFEKTVERFPYSVVKFDIAYPKGEKHEAFTAFSKSAHK
1c4fA           ------------------------NVYIMADKQKNGIKVNFKIRHNIEDGS-VQLADHYQQNTPIGDGPV
2awmA           -----------------------HNVYITADKQKNGIKANFKIRHNIEDGS-VQLADHYRQNTPIGDGPV
2awjA           -----------------------HNVYITADKQKNG-IKANFKIRHNIEDGSVQLADHYQQNTPIGDGPV
2c0fB           ---------------------TGCVDLD--ELSFEKTVERFPYSVVKFDIAFPYGEKHEAFSKSAHKATK
2afaA           ----------------------------------------------------------------------
2c0eA           ---------------------TGCVDLD--ELSFEKTVERFPYSVVKFDIAYPYGEKHEAFTA---FSKS
2c0gB           ----------------------------LDELSFEKTVERFPYSVVKFDIASPYGEKHEAFSKSAHKATK
2c0fA           ---------------------TGCVDLD--ELSFEKTVERFPYSVVKFDIAFPYGEKHEAFSKSAHKATK
1dyvA           -----------------------SEYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVK
2ec4A           -DALLQFTAEFSSRYGDCHPVFFIGSLEAAQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIV
3ed8D           --------------------FNSHNVYITATRGTKNGIKANFTVRHNVEDGSVQLADHYQQNTPIGDGPV
2b5eA           -------------------------FQLVGKNHDEIVNDPKKDVLVLYYAPWCGHCKRLAP--TYQELAD
2dlxA           -------SGIDKKLTTLADLFRPLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVK
2c0gA           ---------------------TGCVDLD--ELSFEKTVERFPYSVVKFDIASPYGEKHEAFTA---FSKS
2c0eB           ---------------------TGCVDLD--ELSFEKTVERFPYSVVKFDIAYPYGEKHEAFSKSAHKATK
2b1lB           ------------------------------QFYQADVLTQGKPVLLNVWATWCPTCRAEHQYKDDRQKAI
2aytA           ------------------------------KELAQKEFKEPVSIKLFSQAIGCESCQTA-----------
2dj3A           ----------------------------------AIVMDPKKDVLIEFYAPWCGHCKQL-------EPIY
1a8lA           ------------------------------KEEFFSKMVNPVKLIVFVRKDHCQYCDQLKQLVQELSELT
2c1yA           ------------------------------ELSFEKTVERFPYSVVKFDIAYPKGEKHEAFTA---FSKS
2dj1A           -----------------------NGVWVLNDGNFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIASTL
3dxbA           ------------------------------DSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEY
3ed3A           ------------------------------KSFDKAIHNTNYTSLVEFYAPWCGHCKKLSSTF---RKAA
2av4A           ---------------------------------------DERLVCIRFGHDYDPDCMKMDELL---YKVA
2aytB           ------------------------------KELAQKEFKEPVSIKLFSQAIGCESCQTAEE---------
1a8yA           -------------------GVDRVINVN--AKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEM--EELI
2dj2A           -------------------------------DNFDDVVNNADIILVEFYAPWCGHCKKLAP--EYEKAAK
2b1lA           ------------------------------QFYQADVLTQGKPVLLNVWATWCPTCRAEHQYLNQLSAQG
2cvkA           ------------------------------DQNFDETLGQHPLVLVDFWAEWCAPCRIAPI----LEEIA
3ed3B           ------------------------------KSFDKAIHNTNYTSLVEFYAPWCGHCKKLSSTFRKAAKRL
3dxbD           ------------------------------DSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIAD--
2dj0A           ------------------------------------ERDKRVTWIVEFFANWSNDCQSFAP--IYADLSL
3d6iB           -------------------------------TYLTTTAAGDKLIVLYFHTSWALKQVFEAISNEPSNSNV
3dvwA           ------------------------------LANPIPQQQAGKVEVLEFFGYFCPHCAHLEPVL---SKHA
3dyrB           ------------------------------DSFDTDVLKADGAILVDFWAEWCGPCKMIA----------


                         .         .         *         .         .         .         .:140
query           EFINKHFIPXXXXXXXXXXXXXXLQEAAQLISGQSGWPLTVFMTPKGQVIWAATYLPPRREMGLPGMLEV
1clcA           ----------------------------------------------------------------------
3e6uD           ----------------------------------------------------------------------
3e6uA           ----------------------------------------------------------------------
3boaA           KAAETLVEKNITLAQIDCTENQDLCMEH----NIPGFPSLKIF-KNSDVNNSIDYEGPRTAEAIVQMIKQ
3e73A           ----------------------------------------------------------------------
2ahfA           ----------------------------------------------------------------------
3e6uB           ----------------------------------------------------------------------
2c1yB           ATKDLLIAT---VGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVDVTL---DNLKAF
1c4fA           LLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAG-----------------------------------
2awmA           LLPDNHYL--------------------------------------------------------------
2awjA           LLPDNHYLS-------------------------------------------------------------
2c0fB           DLLIATVGV------KDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVD----------VT
2afaA           ----------------------------------------------------------------------
2c0eA           AHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVD----------VT
2c0gB           DLLIATVG------VKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVD----------VT
2c0fA           DLLIATVGV------KDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVD----------VT
1dyvA           KKLPEGVKMTKYHVNFMGGDLGKD--------LTQAWAVAMAL-GVEDKVTVPLFEGVQKT---------
2ec4A           SYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVDQFPLFLIIMGKRSSNEVLNVIQ--GNTTVDELMMR
3ed8D           LLPDNHYLSYQTVLSKDPNEKRDHMVLLEFVTA-AGITL-------------------------------
2b5eA           TYANATSDVLIAKLDHTENDVRGV--------VIEGYP-TIVLYPGGKKSESVVY---QGSRSLDSLFDF
2dlxA           NIIREHFIFWQVYHDSEEGQRYIQFY------KLGDFPYVSILDPRTGQKLVEWHQLD-----VSSFLDQ
2c0gA           AHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVD----------VT
2c0eB           DLLIATVGVKDYGELENKAL------GDRYKVDDKNFPSIFLFKGNADEYVQLPSHV-------DVTLDN
2b1lB           SWLKELGNPYALSLFDGDGMLG-------LDLGVYGAPETFLIDGNGIIR--YRH---AGDLNPRVWEEE
2aytA           ----------------------------------------------------------------------
2dj3A           TSLGKKYKGQKDLVIAKMDATANDITNDQY--KVEGFPTIYFAPSGDKKNPIKFEGGNRD---LEHLSKF
1a8lA           DKLSYEIV--------------------------------------------------------------
2c1yA           AHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVD------------
2dj1A           KDNDPPIAVAKIDATSASMLASKF--------DVSGYPTIKIL-KKGQAVDYDGSRTQ------EEIVAK
3dxbA           QGKLTVAK--------------------------------------------------------------
3ed3A           KRLDGVVQVAAVNCDLNKNKALCAKY------DVNGFPTLMVFRPPKISAHANEVYSG------ARTLAP
2av4A           DDIKNFCVIYLVDITEVPDFNTMY--------ELYDPVSVMFF-YRNKHMMIDLGTGNNNKINWPMFIDI
2aytB           ----------------------------------------------------------------------
1a8yA           LELAAQVLEDKGVGFGLVDSEKDAAVAKKL--GLTEEDSIYVFKEDEVI---------------------
2dj2A           ELSKRSPPIPLAKVDATEQTDLAKRF------DVSGYPTLKIFRKGRPF---------------------
2b1lA           IRVVGMNYKDDRQKAISWLKELGNPYALSLFDGDGGAPETFLIDGNGIIR--YRH---AGDLNPRVWEEE
2cvkA           KEYEGKLLVAKLDVDENPKTARYRVSIPTVILFKDGQPVEVLVGA-------------------------
3ed3B           DGVVQVAA--------------------------------------------------------------
3dxbD           ----------------------------------------------------------------------
2dj0A           KYNCTGLNFGKVDVGRYTDVSTRYKVSTSP--LTKQLPTLILFQGGKEAMRRPQIDKK------------
3d6iB           SFL-------------------------------------------------------------------
3dvwA           KSFKDDM---------------------------------------------------------------
3dyrB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LEAVLRAYREKRGEVEKFHEDLARELKKWHSPSPGEPRREGQAEVLAALAASFDEEYGGFGGAPKFPPIT
1clcA           ----------------------------------------------------------------------
3e6uD           -----------------------------------------------AFPNPYADYNKSLAEGYFDA---
3e6uA           ----------------------------------------------------------------------
3boaA           SQPAVAVVADLPAYLANETFVTPVIVQSGKIDADFNATFYSMANKHFDFVSAENADDDFKLSIYLPSAM-
3e73A           -------------------------------------------MAQRAFPNPYADYNKSLAEGYFDAA-G
2ahfA           -------------------------------------------DALGITARNLKKFGDRF---PHVSDGS
3e6uB           ----------------------------------------------RAFPNPYADYNKSLAEGYFD----
2c1yB           VSANTPLYIGRDG---------------------------------------------------------
1c4fA           ----------------------------------------------------------------------
2awmA           ----------------------------------------------------------------------
2awjA           ----------------------------------------------------------------------
2c0fB           LDNLKAFVSANTPLYIG-----RDGCIKEFNEVLKNYANIPDAEQLKLIEKLQAKQEQLTDPEQQQNARA
2afaA           ------------------------------------------------NFGKNAVVPTGFGKGQIKEEGT
2c0eA           LDNLKAFVSANT--PLYIGRDGCIKEFNEVLKNYANI-PDAEQLKLIEKLQAKQEQLTDP----------
2c0gB           LDNLKAFVSANTPLYIGRDG--------------------------------------------------
2c0fA           LDNLKAFVSANTPLYIGRDG--------------------------------------------------
1dyvA           ----------------------------------------------------------------------
2ec4A           LMAAMEIFTAQQQE--------------------------------------------------------
3ed8D           ----------------------------------------------------------------------
2b5eA           IKENGHFDVDGKALYEEAQEKAAEE---------------------------------------------
2dlxA           VTGFLGEHGQ------------------------------------------------------------
2c0gA           LDNLKAFVSANTPLYDGCIKEFNEVLKNYANIPDAEQLKLQNARAYLIYMRKIHEV-----GYDFLEEET
2c0eB           LKAFVSANTPLYIGRDGCIKEFNEVLKNYANIPDAE----------------------------------
2b1lB           IKPLWEKYSKEAAQ--------------------------------------------------------
2aytA           ----------------------------------------------------------------------
2dj3A           IDEHATKRSRTKEELS------------------------------------------------------
1a8lA           ----------------------------------------------------------------------
2c1yA           ----------------------------------------------------------------------
2dj1A           VREVSQPDWTPPPEVTSGPS--------------------------------------------------
3dxbA           ----------------------------------------------------------------------
3ed3A           IVDFSLSRIRSYVKKFVRIDTLGSLLRKSP----------------------------------------
2av4A           VETIFRGARKGRGLV-------------------------------------------------------
2aytB           ----------------------------------------------------------------------
1a8yA           ----------------------------------------------------------------------
2dj2A           ----------------------------------------------------------------------
2b1lA           IKPLWEKYSKE-----------------------------------------------------------
2cvkA           ----------------------------------------------------------------------
3ed3B           ----------------------------------------------------------------------
3dxbD           ----------------------------------------------------------------------
2dj0A           ----------------------------------------------------------------------
3d6iB           ----------------------------------------------------------------------
3dvwA           ----------------------------------------------------------------------
3dyrB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           QLELLMMRHFYDGVGIYGKMAERTLDAMALGGVYDQLLGGFFRYSTDRSWLIPHYEKLLIDNAELLAVYT
1clcA           -------------TSMFDN-DTKETVYIADFSSVNEEGTYYLAVPGVGKSVNFKIAMNVYEDAFKTAMLG
3e6uD           -------------------------AGRLTPEFSQRLTNKIRELLQQGLKSADPRDGTGYTWAGIAVLYL
3e6uA           -----------------LAEGYFDAAGRLTPEFSQRLTNKIRELLERGLKSADPRDGTGYTWAGIAVLYL
3boaA           --DEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFAQYVESGLPLGYLFYNDEEELEEYKPLFT
3e73A           RLTPEFSQRLTNKIRELLQ------------------------QMERGLKSADPRDGTGYTWAGIAVLYL
2ahfA           NKYVLNDNTDWTD----GFWSGILWLCYEYTGDEQYREGAVRTVASFRERLDRFENLHHNIGFLYSLSAK
3e6uB           ------------------------AAGRLTPEFSQRLTNKIRELLQQMEKSADPRDGTGYTWAGIAVLYL
2c1yB           ----------------------------------------------------------------------
1c4fA           ----------------------------------------------------------------------
2awmA           ----------------------------------------------------------------------
2awjA           ----------------------------------------------------------------------
2c0fB           YLI-YMRKIHEVGYDFLEEETKRLL---------------------------------------------
2afaA           HLWITARLYSVAGRPGAYDLVDHGIKANG--ALRDKKYGGWYACVNDQGVVDASK---QGYQHFFALLGA
2c0eA           ----------------------------------------------------------------------
2c0gB           ----------------------------------------------------------------------
2c0fA           ----------------------------------------------------------------------
1dyvA           ----------------------------------------------------------------------
2ec4A           ----------------------------------------------------------------------
3ed8D           ----------------------------------------------------------------------
2b5eA           ----------------------------------------------------------------------
2dlxA           ----------------------------------------------------------------------
2c0gA           KRLLRLKEELLRKLNILEVFRVHKVTKTA-----------------------------------------
2c0eB           ----------------------------------------------------------------------
2b1lB           ----------------------------------------------------------------------
2aytA           ----------------------------------------------------------------------
2dj3A           ----------------------------------------------------------------------
1a8lA           ----------------------------------------------------------------------
2c1yA           ----------------------------------------------------------------------
2dj1A           ----------------------------------------------------------------------
3dxbA           ----------------------------------------------------------------------
3ed3A           ----------------------------------------------------------------------
2av4A           ----------------------------------------------------------------------
2aytB           ----------------------------------------------------------------------
1a8yA           ----------------------------------------------------------------------
2dj2A           ----------------------------------------------------------------------
2b1lA           ----------------------------------------------------------------------
2cvkA           ----------------------------------------------------------------------
3ed3B           ----------------------------------------------------------------------
3dxbD           ----------------------------------------------------------------------
2dj0A           ----------------------------------------------------------------------
3d6iB           ----------------------------------------------------------------------
3dvwA           ----------------------------------------------------------------------
3dyrB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KAYRQFGKALYKRTAEGIVKWLDEFMRAPEGGYYASQDADVDGEEGGYYRWSXXXXXXXXXXXYPVASKH
1clcA           MYLLRCGTSVSATYNGIHYSHGPCHTNDAYLDWHDAGDYNKYVVNAGITVGSMFLAWEHFKDQLEIPEKN
3e6uD           HLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKI
3e6uA           HLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKI
3boaA           ELAKKNRGLMNFVSIDARKFGRHAGN--------------------------------------------
3e73A           HLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKI
2ahfA           AQWIVEKDESARKLALDAADVLMRRWRADAGIIQAWGPK---GDPENGGRIIIDCLLNLPLLLW--AGEQ
3e6uB           HLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKI
2c1yB           ----------------------------------------------------------------------
1c4fA           ----------------------------------------------------------------------
2awmA           ----------------------------------------------------------------------
2awjA           ----------------------------------------------------------------------
2c0fB           ----------------------------------------------------------------------
2afaA           ASAVTTGHPEARKLLDYTIEVIEKYFWSEEEQCLESWDEAFSQTEDYRGGN-------------------
2c0eA           ----------------------------------------------------------------------
2c0gB           ----------------------------------------------------------------------
2c0fA           ----------------------------------------------------------------------
1dyvA           ----------------------------------------------------------------------
2ec4A           ----------------------------------------------------------------------
3ed8D           ----------------------------------------------------------------------
2b5eA           ----------------------------------------------------------------------
2dlxA           ----------------------------------------------------------------------
2c0gA           ----------------------------------------------------------------------
2c0eB           ----------------------------------------------------------------------
2b1lB           ----------------------------------------------------------------------
2aytA           ----------------------------------------------------------------------
2dj3A           ----------------------------------------------------------------------
1a8lA           ----------------------------------------------------------------------
2c1yA           ----------------------------------------------------------------------
2dj1A           ----------------------------------------------------------------------
3dxbA           ----------------------------------------------------------------------
3ed3A           ----------------------------------------------------------------------
2av4A           ----------------------------------------------------------------------
2aytB           ----------------------------------------------------------------------
1a8yA           ----------------------------------------------------------------------
2dj2A           ----------------------------------------------------------------------
2b1lA           ----------------------------------------------------------------------
2cvkA           ----------------------------------------------------------------------
3ed3B           ----------------------------------------------------------------------
3dxbD           ----------------------------------------------------------------------
2dj0A           ----------------------------------------------------------------------
3d6iB           ----------------------------------------------------------------------
3dvwA           ----------------------------------------------------------------------
3dyrB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           FGLEEYPWPEGKATLRVARPLEGPEAERIYQILIEARRKRKPPFTDTTVYVGWSCAMAYAELLASRLASV
1clcA           NSIPDFLDELKYEIDWILTMQYPDGSGRVAHGGFIMPENEHDERFFVPWSSAATADFVAMTAMAARIFRP
3e6uD           DPHAPNEMLYGRIGYIICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQV
3e6uA           DPHAPNEMLYGRIGVNKNFGVEKIPQSHIQQICETIKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQV
3boaA           ----------------------------------------------------------------------
3e73A           DPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQV
2ahfA           TGDPEYRRVAEAHALKSRRFLVRGDDSSYHTFYFAIRGGTHQGNTDGSTWTRGQAWGIYGFALNSRYLGN
3e6uB           DPHAPNEMLYGRIGQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQV
2c1yB           ----------------------------------------------------------------------
1c4fA           ----------------------------------------------------------------------
2awmA           ----------------------------------------------------------------------
2awjA           ----------------------------------------------------------------------
2c0fB           ----------------------------------------------------------------------
2afaA           ----------------------------------------------------------------------
2c0eA           ----------------------------------------------------------------------
2c0gB           ----------------------------------------------------------------------
2c0fA           ----------------------------------------------------------------------
1dyvA           ----------------------------------------------------------------------
2ec4A           ----------------------------------------------------------------------
3ed8D           ----------------------------------------------------------------------
2b5eA           ----------------------------------------------------------------------
2dlxA           ----------------------------------------------------------------------
2c0gA           ----------------------------------------------------------------------
2c0eB           ----------------------------------------------------------------------
2b1lB           ----------------------------------------------------------------------
2aytA           ----------------------------------------------------------------------
2dj3A           ----------------------------------------------------------------------
1a8lA           ----------------------------------------------------------------------
2c1yA           ----------------------------------------------------------------------
2dj1A           ----------------------------------------------------------------------
3dxbA           ----------------------------------------------------------------------
3ed3A           ----------------------------------------------------------------------
2av4A           ----------------------------------------------------------------------
2aytB           ----------------------------------------------------------------------
1a8yA           ----------------------------------------------------------------------
2dj2A           ----------------------------------------------------------------------
2b1lA           ----------------------------------------------------------------------
2cvkA           ----------------------------------------------------------------------
3ed3B           ----------------------------------------------------------------------
3dxbD           ----------------------------------------------------------------------
2dj0A           ----------------------------------------------------------------------
3d6iB           ----------------------------------------------------------------------
3dvwA           ----------------------------------------------------------------------
3dyrB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GNKYHAVRTLERFGVEXXXXXXXXXXXXXXXXXXIAALEDYAYCILAWIEGYSHTAKLEFLKVAESAGEI
1clcA           YDPQYAEKCINSYEFLKNNPANVFANQSGFSTGEYATVSDADDRLWAAAEMWETLGDEEYLRDFENRAAQ
3e6uD           SQHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADV
3e6uA           SQGKLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADV
3boaA           ----------------------------------------------------------------------
3e73A           SQGKLHSLVKPSV------------------DYVCQLKFPSGNYPPCIGDNDLLVHWCHGAPGVIYMLIQ
2ahfA           ADLLETAKRMARHFLARVPEDGVVYWDFEVPQEPSSYSSASAITACGLLEIASQLERQRFIDAAKTTVTA
3e6uB           SQGSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADV
2c1yB           ----------------------------------------------------------------------
1c4fA           ----------------------------------------------------------------------
2awmA           ----------------------------------------------------------------------
2awjA           ----------------------------------------------------------------------
2c0fB           ----------------------------------------------------------------------
2afaA           ----------------------------------------------------------------------
2c0eA           ----------------------------------------------------------------------
2c0gB           ----------------------------------------------------------------------
2c0fA           ----------------------------------------------------------------------
1dyvA           ----------------------------------------------------------------------
2ec4A           ----------------------------------------------------------------------
3ed8D           ----------------------------------------------------------------------
2b5eA           ----------------------------------------------------------------------
2dlxA           ----------------------------------------------------------------------
2c0gA           ----------------------------------------------------------------------
2c0eB           ----------------------------------------------------------------------
2b1lB           ----------------------------------------------------------------------
2aytA           ----------------------------------------------------------------------
2dj3A           ----------------------------------------------------------------------
1a8lA           ----------------------------------------------------------------------
2c1yA           ----------------------------------------------------------------------
2dj1A           ----------------------------------------------------------------------
3dxbA           ----------------------------------------------------------------------
3ed3A           ----------------------------------------------------------------------
2av4A           ----------------------------------------------------------------------
2aytB           ----------------------------------------------------------------------
1a8yA           ----------------------------------------------------------------------
2dj2A           ----------------------------------------------------------------------
2b1lA           ----------------------------------------------------------------------
2cvkA           ----------------------------------------------------------------------
3ed3B           ----------------------------------------------------------------------
3dxbD           ----------------------------------------------------------------------
2dj0A           ----------------------------------------------------------------------
3d6iB           ----------------------------------------------------------------------
3dvwA           ----------------------------------------------------------------------
3dyrB           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           LLAKFLEEGGFKDVETVDEIIPTPNYPALDTPNFSGNAVAAIALATLSEVTGDAKYKEAAYRAVSALYGK
1clcA           FSKKIEADFDWDNVANLGMFTGRTLGTTYYWGCNGTVVRQTMILQVANKISPNNDYVNAALDAISHVFG-
3e6uD           IWQYGLLKKGYG--------------------LCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEY
3e6uA           IWQYGLLKKGYG--------------------LCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEY
3boaA           ----------------------------------------------------------------------
3e73A           AYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEY
2ahfA           LRDGYARDDGEAEGFIRRGSYHVRGGISPDDYTIWGD---------------------------------
3e6uB           IWQYGLLKKGYG--------------------LCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEY
2c1yB           ----------------------------------------------------------------------
1c4fA           ----------------------------------------------------------------------
2awmA           ----------------------------------------------------------------------
2awjA           ----------------------------------------------------------------------
2c0fB           ----------------------------------------------------------------------
2afaA           ----------------------------------------------------------------------
2c0eA           ----------------------------------------------------------------------
2c0gB           ----------------------------------------------------------------------
2c0fA           ----------------------------------------------------------------------
1dyvA           ----------------------------------------------------------------------
2ec4A           ----------------------------------------------------------------------
3ed8D           ----------------------------------------------------------------------
2b5eA           ----------------------------------------------------------------------
2dlxA           ----------------------------------------------------------------------
2c0gA           ----------------------------------------------------------------------
2c0eB           ----------------------------------------------------------------------
2b1lB           ----------------------------------------------------------------------
2aytA           ----------------------------------------------------------------------
2dj3A           ----------------------------------------------------------------------
1a8lA           ----------------------------------------------------------------------
2c1yA           ----------------------------------------------------------------------
2dj1A           ----------------------------------------------------------------------
3dxbA           ----------------------------------------------------------------------
3ed3A           ----------------------------------------------------------------------
2av4A           ----------------------------------------------------------------------
2aytB           ----------------------------------------------------------------------
1a8yA           ----------------------------------------------------------------------
2dj2A           ----------------------------------------------------------------------
2b1lA           ----------------------------------------------------------------------
2cvkA           ----------------------------------------------------------------------
3ed3B           ----------------------------------------------------------------------
3dxbD           ----------------------------------------------------------------------
2dj0A           ----------------------------------------------------------------------
3d6iB           ----------------------------------------------------------------------
3dvwA           ----------------------------------------------------------------------
3dyrB           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           MERVGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1clcA           ----------------------------------------------------------------------
3e6uD           GEH-------------------------------------------------------------------
3e6uA           GEHGC-----------------------------------------------------------------
3boaA           ----------------------------------------------------------------------
3e73A           G---------------------------------------------------------------------
2ahfA           ----------------------------------------------------------------------
3e6uB           GEH-------------------------------------------------------------------
2c1yB           ----------------------------------------------------------------------
1c4fA           ----------------------------------------------------------------------
2awmA           ----------------------------------------------------------------------
2awjA           ----------------------------------------------------------------------
2c0fB           ----------------------------------------------------------------------
2afaA           ----------------------------------------------------------------------
2c0eA           ----------------------------------------------------------------------
2c0gB           ----------------------------------------------------------------------
2c0fA           ----------------------------------------------------------------------
1dyvA           ----------------------------------------------------------------------
2ec4A           ----------------------------------------------------------------------
3ed8D           ----------------------------------------------------------------------
2b5eA           ----------------------------------------------------------------------
2dlxA           ----------------------------------------------------------------------
2c0gA           ----------------------------------------------------------------------
2c0eB           ----------------------------------------------------------------------
2b1lB           ----------------------------------------------------------------------
2aytA           ----------------------------------------------------------------------
2dj3A           ----------------------------------------------------------------------
1a8lA           ----------------------------------------------------------------------
2c1yA           ----------------------------------------------------------------------
2dj1A           ----------------------------------------------------------------------
3dxbA           ----------------------------------------------------------------------
3ed3A           ----------------------------------------------------------------------
2av4A           ----------------------------------------------------------------------
2aytB           ----------------------------------------------------------------------
1a8yA           ----------------------------------------------------------------------
2dj2A           ----------------------------------------------------------------------
2b1lA           ----------------------------------------------------------------------
2cvkA           ----------------------------------------------------------------------
3ed3B           ----------------------------------------------------------------------
3dxbD           ----------------------------------------------------------------------
2dj0A           ----------------------------------------------------------------------
3d6iB           ----------------------------------------------------------------------
3dvwA           ----------------------------------------------------------------------
3dyrB           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1clcA           -------------------------------------
3e6uD           -------------------------------------
3e6uA           -------------------------------------
3boaA           -------------------------------------
3e73A           -------------------------------------
2ahfA           -------------------------------------
3e6uB           -------------------------------------
2c1yB           -------------------------------------
1c4fA           -------------------------------------
2awmA           -------------------------------------
2awjA           -------------------------------------
2c0fB           -------------------------------------
2afaA           -------------------------------------
2c0eA           -------------------------------------
2c0gB           -------------------------------------
2c0fA           -------------------------------------
1dyvA           -------------------------------------
2ec4A           -------------------------------------
3ed8D           -------------------------------------
2b5eA           -------------------------------------
2dlxA           -------------------------------------
2c0gA           -------------------------------------
2c0eB           -------------------------------------
2b1lB           -------------------------------------
2aytA           -------------------------------------
2dj3A           -------------------------------------
1a8lA           -------------------------------------
2c1yA           -------------------------------------
2dj1A           -------------------------------------
3dxbA           -------------------------------------
3ed3A           -------------------------------------
2av4A           -------------------------------------
2aytB           -------------------------------------
1a8yA           -------------------------------------
2dj2A           -------------------------------------
2b1lA           -------------------------------------
2cvkA           -------------------------------------
3ed3B           -------------------------------------
3dxbD           -------------------------------------
2dj0A           -------------------------------------
3d6iB           -------------------------------------
3dvwA           -------------------------------------
3dyrB           -------------------------------------