[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for paer1:AAL64489.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dmsA.bssp"
#ERROR : Can't open dsspfile "1cxtA.bssp"
#ERROR : Can't open dsspfile "1e61A.bssp"
#ERROR : Can't open dsspfile "1e61C.bssp"
#ERROR : Can't open dsspfile "1e60A.bssp"
#ERROR : Can't open dsspfile "1e5vA.bssp"
#ERROR : Can't open dsspfile "4dmrA.bssp"
#ERROR : Can't open dsspfile "1dmrA.bssp"
#ERROR : Can't open dsspfile "2dmrA.bssp"
#ERROR : Can't open dsspfile "1e18A.bssp"
#ERROR : Can't open dsspfile "1e60C.bssp"
#ERROR : Can't open dsspfile "1cxsA.bssp"
#ERROR : Can't open dsspfile "2e7zA.bssp"
#ERROR : Can't open dsspfile "1aa6A.bssp"
#ERROR : Can't open dsspfile "1d3kA.bssp"
#ERROR : Can't open dsspfile "1btjA.bssp"
#ERROR : Can't open dsspfile "3d81A.bssp"
#ERROR : Can't open dsspfile "1a8eA.bssp"
#ERROR : Can't open dsspfile "1b3eA.bssp"
#ERROR : Can't open dsspfile "1bp5A.bssp"
#ERROR : Can't open dsspfile "1dtgA.bssp"
#ERROR : Can't open dsspfile "1bp5C.bssp"
#ERROR : Can't open dsspfile "3d4bA.bssp"
#ERROR : Can't open dsspfile "2b4yB.bssp"
#ERROR : Can't open dsspfile "2b4yA.bssp"
#ERROR : Can't open dsspfile "3cf4G.bssp"
#ERROR : Can't open dsspfile "3cf2A.bssp"
#ERROR : Can't open dsspfile "3cf1A.bssp"
#ERROR : Can't open dsspfile "1cz4A.bssp"
#ERROR : Can't open dsspfile "3dkyF.bssp"
#ERROR : Can't open dsspfile "1ci4A.bssp"
#ERROR : Can't open dsspfile "2b4yC.bssp"
#ERROR : Can't open dsspfile "2b4yD.bssp"
#ERROR : Can't open dsspfile "3cf1B.bssp"
#ERROR : Can't open dsspfile "2ekbA.bssp"
#ERROR : Can't open dsspfile "1e32A.bssp"
#ERROR : Can't open dsspfile "1e3tA.bssp"
#ERROR : Can't open dsspfile "1djlA.bssp"
#ERROR : Can't open dsspfile "2ekzA.bssp"

## Summary of PDB Search
:816
    8e-88  23%  1dmsA  [x.x.x] DMSO REDUCTASE
    2e-83  23%  1cxtA  [x.x.x] DIMETHYLSULFOXIDE REDUCTASE
    1e-81  23%  1e61A  [c.81.1 - b.52.2] DMSO REDUCTASE
    4e-81  23%  1e61C  [c.81.1 - b.52.2] DMSO REDUCTASE
    7e-81  23%  1e60A  [c.81.1 - b.52.2] DMSO REDUCTASE
    8e-80  24%  1e5vA  [c.81.1 - b.52.2] DMSO REDUCTASE
    1e-79  24%  4dmrA  [x.x.x] DMSO REDUCTASE
    1e-79  23%  1dmrA  [x.x.x] DMSO REDUCTASE
    2e-79  24%  2dmrA  [x.x.x] DMSO REDUCTASE
    2e-77  23%  1e18A  [c.81.1 - b.52.2] DMSO REDUCTASE.
    3e-77  23%  1e60C  [c.81.1 - b.52.2] DMSO REDUCTASE
    2e-76  22%  1cxsA  [x.x.x] DIMETHYLSULFOXIDE REDUCTASE
    1e-73  23%  2e7zA  [x.x.x] ACETYLENE HYDRATASE AHY
    1e-53  18%  1aa6A  [x.x.x] FORMATE DEHYDROGENASE H
    2e-25   5%  1d3kA  [c.94.1] SERUM TRANSFERRIN
    2e-25   6%  1btjA  [c.94.1] PROTEIN (SERUM TRANSFERRIN)
    6e-24   7%  3d81A  [x.x.x] NAD-DEPENDENT DEACETYLASE
    7e-24   5%  1a8eA  [c.94.1 (1n84A)] SERUM TRANSFERRIN
    4e-23   9%  1b3eA  [c.94.1] PROTEIN (SERUM TRANSFERRIN)
    5e-22   8%  1bp5A  [c.94.1] PROTEIN (SERUM TRANSFERRIN)
    1e-18   7%  1dtgA  [c.94.1] TRANSFERRIN
    4e-18   8%  1bp5C  [c.94.1] PROTEIN (SERUM TRANSFERRIN)
    1e-17   7%  3d4bA  [x.x.x] NAD-DEPENDENT DEACETYLASE
    4e-17   9%  2b4yB  [x.x.x] NAD-DEPENDENT DEACETYLASE SIRTUIN-5
    1e-16  10%  2b4yA  [x.x.x] NAD-DEPENDENT DEACETYLASE SIRTUIN-5
    6e-16  11%  3cf4G  [x.x.x] ACETYL-COA DECARBONYLASE/SYNTHASE EPSILON
    9e-11  19%  3cf2A  [x.x.x] TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE
    2e-10  19%  3cf1A  [x.x.x] TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE
    7e-10  17%  1cz4A  [b.52.2 - d.31.1] VCP-LIKE ATPASE
    3e-09   8%  3dkyF  [x.x.x] REPLICATION PROTEIN REPB
    3e-08  16%  1ci4A  [a.60.5] PROTEIN (BARRIER-TO-AUTOINTEGRATION FACTOR (BAF)
    3e-08  10%  2b4yC  [x.x.x] NAD-DEPENDENT DEACETYLASE SIRTUIN-5
    2e-07   9%  2b4yD  [x.x.x] NAD-DEPENDENT DEACETYLASE SIRTUIN-5
    2e-07  18%  3cf1B  [x.x.x] TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE
    9e-07  16%  2ekbA  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    1e-05  20%  1e32A  [b.52.2 - d.31.1 - c.37.1] P97
    3e-05   9%  1e3tA  [c.31.1] NICOTINAMIDE NUCLEOTIDE TRANSHYDROGENASE
    8e-05  11%  1djlA  [c.31.1] TRANSHYDROGENASE DIII
    7e-04  17%  2ekzA  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
:816

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLFFVRNGQRMYLL
1dmsA           ------------------------------------------------------------VENGRATAFT
1cxtA           ------------------------------------------------------------VENGRAVAFE
1e61A           ------------------------------------------------------------VENGRATAFT
1e61C           ------------------------------------------------------------VENGRATAFT
1e60A           ------------------------------------------------------------VENGRATAFT
1e5vA           ------------------------------------------------------------VENGRATAFT
4dmrA           ------------------------------------------------------------VENGRATAFT
1dmrA           ------------------------------------------------------------VENGRATAFT
2dmrA           ------------------------------------------------------------VENGRATAFT
1e18A           ------------------------------------------------------------VENGRATAFT
1e60C           ------------------------------------------------------------VENGRATAFT
1cxsA           ------------------------------------------------------------VENGRAVAFE
2e7zA           ------------------------------------------------------------VKADGKIQTK
1aa6A           ------------------------------------------------------------VDNGKIVRAE
1d3kA           ------------------------------------------------------------IAANEADAVT
1btjA           ------------------------------------------------------------IAANEADAVT
3d81A           ------------------------------------------------------------NESRLTVTLT
1a8eA           ------------------------------------------------------------IAANEADAVT
1b3eA           ---------------------------------------------------------IRAIAANEADAVT
1bp5A           ------------------------------------------------------------IAANEADAVT
1dtgA           ------------------------------------------------------------IAANEADAVT
1bp5C           ------------------------------------------------------------IAANEADAVT
3d4bA           ------------------------------------------------------------IPDFNVFDID
2b4yB           ----------------------------------------------------------------------
2b4yA           -------------------------------------------------------------------YRR
3cf4G           ----------------------------------------------------------------------
3cf2A           ----------------------------------------------------------------------
3cf1A           ----------------------------------------------------------------------
1cz4A           ----------------------------------------------------------------------
3dkyF           ----------------------------------------------------------------------
1ci4A           ----------------------------------------------------------------------
2b4yC           ----------------------------------------------------------------------
2b4yD           -------------------------------------------------------------PNAGHRAIA
3cf1B           ----------------------------------------------------------------------
2ekbA           ---------------------------------------------------------LWLVRHGETLWNR
1e32A           ----------------------------------------------------------------------
1e3tA           ----------------------------------------------------------------------
1djlA           ----------------------------------------------------------------------
2ekzA           ---------------------------------------------------------LWLVRHGETLWNR


                         .         .         *         .         .         .         .:140
query           PNPKHPQPGMCFRPASALQLWNHPLRLKKPLKRVGERGEGKFQEVDWETALNEIAQRLREIVQRYGPESV
1dmsA           PWEKDPHP--TPMLEGVLDSIYSPTRIKYPMVRRSTRGNGDFVRVSWDQALDLVAAEVKRVEETYGPQGV
1cxtA           PWDKDPAP--SHQLPGVLDSIYSPTRIKYPMVRRETRGNGDFVRVTWDEALDLVARELKRVQESYGPTGT
1e61A           PWEKDPHP--SPMLAGVLDSIYSPTRIKYPMVRRETRGNGDFVRVSWDQALDLVAAEVKRVEETYGPEGV
1e61C           PWEKDPHP--SPMLAGVLDSIYSPTRIKYPMVRRETRGNGDFVRVSWDQALDLVAAEVKRVEETYGPEGV
1e60A           PWEKDPHP--SPMLAGVLDSIYSPTRIKYPMVRRETRGNGDFVRVSWDQALDLVAAEVKRVEETYGPEGV
1e5vA           PWEKDPHP--SPMLAGVLDSIYSPTRIKYPMVRRETRGNGDFVRVSWDQALDLVAAEVKRVEETYGPEGV
4dmrA           PWEKDPHP--SPMLAGVLDSIYSPTRIKYPMVRRETRGNGDFVRVSWDQALDLVAAEVKRVEETYGPSGV
1dmrA           PWEKDPHP--SPMLAGVLDSIYSPTRIKYPMVRRETRGNGDFVRVSWDQALDLVAAEVKRVEETYGPEGV
2dmrA           PWEKDPHP--SPMLAGVLDSIYSPTRIKYPMVRRETRGNGDFVRVSWDQALDLVAAEVKRVEETYGPEGV
1e18A           PWEKDPHP--SPMLAGVLDSIYSPTRIKYPMVRRETRGNGDFVRVSWDQALDLVAAEVKRVEETYGPQGV
1e60C           PWEKDPHP--SPMLAGVLDSIYSPTRIKYPMVRRETRGNGDFVRVSWDQALDLVAAEVKRVEETYGPEGV
1cxsA           PWDKDPAP--SHQLPGVLDSIYSPTRIKYPMVRRETRGNGDFVRVTWDEALDLVARELKRVQESYGPTGT
2e7zA           SEPHPTTPPNCMKSVNADTIRTHKDRVLYPLKNVGKRGEQRWERISWDQALDEIAEKLKKIIAKYGPESL
1aa6A           AAQGKTNQGLCLKGYYGWDFINDTQRLKTPMIR--RQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAI
1d3kA           LDAGLVYDAYPNNLKPVVAEFYGSKEDPQTFYYA----VAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWN
1btjA           LDAGLVAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDNQLRGKKSCHTGLGRSAGWNIPIGLLYCD
3d81A           GAGISTPSGIDFQNVFDIDFFYSHPEEFYRFAKEGIFPMLQAKPNLAHVLLAKLEEKGLIEAVITQNIDR
1a8eA           LDAGLVAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIG
1b3eA           LDAGLVAYLAPNNLKPVVAEFYGSKEDPQTFYYAKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCD
1bp5A           LDAGLVAYLAPNNLKPVVAEFYGSKEDPQTFYYAKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCD
1dtgA           LDAGLVYDAAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSQLRGKKSCHTGLGRSAGWNIPIGLLYCD
1bp5C           LDAGLVAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDNQLRGKKSCHTGLGRSAGWNIPIGLLYCD
3d4bA           FFYSHPEERFAKEGIFPMLQAKPNLAHVLLAKL--EEKGLIEAVITQNIDRLHQRAGSKKVIELHGNVEE
2b4yB           --VGSKEPNGHRAIAECETRLGKQGRRVVVITQ---NIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAE
2b4yA           EVGSKPNAGHAIAECETR--LGKQGRRVVVITQELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPI
3cf4G           --------------------------TTKNTKLF----TSYGVNTSKAVSPEMAAKIISKALLMVGTLAL
3cf2A           ----------------------------------------------------------------------
3cf1A           ----------------------------------------------------------------------
1cz4A           ----------------------------------------------------------------------
3dkyF           ----------------------------------------------------------------------
1ci4A           ----------------------------------------------------------------------
2b4yC           ----EPNAGHRAIAECETRLGKQGRRVVVITQNI----DELHRKAGTKNLLEIHGSLFKTRCTSCGVVAE
2b4yD           ECETRLGKQGRRVV---VITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGK--
3cf1B           ----------------------------------------------------------------------
2ekbA           EGRMLGWTDLPLTAEGEAQARRLKGALPSDLLRARRTAELAGFSPRLYPELREIHFGALTLDPRYKEALL
1e32A           ----------------------------------------------------------------------
1e3tA           -----------------------------------------------AGSAEDAAFIMKNVIIVPGYGMA
1djlA           ----------------------------------------------TEINLDNAIDMIREIIITPGYGLC
2ekzA           EGRLLGWTDLPLTAEGEAQARRLKGALPSDMLRARRTAELAGFSPRLYPELREIHFGALELDPRYKEALL


                         +         .         .         .         .         *         .:210
query           AFTRHDHMSWILPFIASVIGTPNIISHEGTCHAASTAVRKFVLGASGPSSVDPDYENANYILLIGRNLDA
1dmsA           FGGSYGWKSPGRLHNCYVNGAGDYSTGAAQVIMPHVVGTLEVYEQQTAW--PVLAENTEVMVFWAADPIK
1cxtA           FGGSYGHNCQVLMRRALNLAGGFVNSSGDYSTAAAQIIMPHVMGTLQQTAWPVVVENTDLMVFWAADPMK
1e61A           FGGSYGWKSPGRLHNCYVNGAGDYSTGAAQVIMPHVVGTLEVYEQQTAW--PVLAENTEVMVFWAADPIK
1e61C           FGGSYGWKSPLTLAGGYVNGAGDYSTGAAQVIMPHVVGTLEVYEQQTAW--PVLAENTEVMVFWAADPIK
1e60A           FGGSYGWKSPGRLHNCYVNGAGDYSTGAAQVIMPHVVGTLEVYEQQTAW--PVLAENTEVMVFWAADPIK
1e5vA           FGGSYGWKSPGRLHNCYVNGAGDYSTGAAQVIMPHVVGTLEVYEQQTAW--PVLAENTEVMVFWAADPIK
4dmrA           FGGSYGWKSPGRLHNCYVNGAGDYSTGAAQVIMPHVVGTLEVYEQ--QTAWPVLAENTEVMVFWAADPIK
1dmrA           FGGSYGWKSPGRLHNCYVNGAGDYSTGAAQVIMPHVVGTLEVYEQ--QTAWPVLAENTEVMVFWAADPIK
2dmrA           FGGSYGWKSPGRLHNCYVNGAGDYSTGAAQVIMPHVVGTLEVYEQQTAW--PVLAENTEVMVFWAADPIK
1e18A           FGGSYGWKSLLRRMLTLAGGYVNGAGDYSTGQVIMPHVVGTLEVYEQQTAWPVLAENTEVMVFWAADPIK
1e60C           FGGSYGWKSPGRLHNCYVNGAGDYSTGAAQVIMPHVVGTLEVYEQQTAW--PVLAENTEVMVFWAADPIK
1cxsA           FGGSYGWKSPGRLHNCQNLAGGFVNSSGDYSTAAAQIIMPHVMGTLQQTAWPVVVENTDLMVFWAADPMK
2e7zA           GVSQTEINQGTLRRFMNLLGSPNWTSAMYMCIGNTAGVHRVTHGSYSF----ASFADSNCLLFIGKNLSN
1aa6A           QTGTGNETNYVMQKFARAVIGTNNVDCCARVHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNPAD
1d3kA           IPIGLLYRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFV
1btjA           LPEPRKPLEKAVANFFSCADGTDFPQLCQLCPGCGCSTLNQYFGY--------SGAFKCLKDGAGDVAFV
3d81A           LHQRAGSKKYTVEDVIKKLESSDVPLCDDCNSLIRPNIVFFNLPQDALREAIGLSSRASLMIVLGSSL-V
1a8eA           LLYCDLPEPRKPLEKAVASGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKC-LKDGAGDVAFV
1b3eA           LPEPRKPLEFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGA--------FKCLKDGAGDVAFV
1bp5A           LPEPRKPLEFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGY--------SGAFKCLKDGAGDVAFV
1dtgA           LPEPRKPLEFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFG--------YSGAFKCLKDGAGDVAFV
1bp5C           LPEPRKLEKAVANFFSPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGA--------FKCLKDGAGDVAFV
3d4bA           YYCVRCEKKYTVEDVIKKLESSDVPLCDDCNSLIRPNIVFFGLPQDALREAIGLSSRASLMIVLGSSL-V
2b4yB           NYKSPICPATQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSS--
2b4yA           CPKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTS--S
3cf4G           DPELLDRVVKIIPIAATGSSL-AVLADKDVDAKYINAHMLGFYLTDPKWPGLDGNGNYDMIITIGFKK--
3cf2A           ----------------------------------------------------------------------
3cf1A           ----------------------------------------------------------------------
1cz4A           ----------------------------------------------------------------------
3dkyF           --------------------------------------------------LYPSIPSDWELKLETLGV-P
1ci4A           ----------------------------------------------------------------------
2b4yC           NYKSGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGNLDPAILEEVDRELAHCDLCLVVGTSS--
2b4yD           ---GAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSV-
3cf1B           ----------------------------------------------------------------------
2ekbA           RFQGFHPPGGVFRFLEGLKAPAVLFTHGGVVRA-------------------------------------
1e32A           ----------------------------------------------------------------------
1e3tA           VAQAQHALREMAEGVEVSYAHPVAGRMPGHMNVLLAEANVPYDEVFELEEINSSFQTADVAFVIGANDV-
1djlA           AAKAQYPIADLVKLTEQGKKVRFGIHMPGQLNVLLAEAGVPYDIVLEMDEINHDFPDTDLVLVIGANDTV
2ekzA           RFQGPGGESLVFRFLEGLKAPAVLFTHGGVVRA-------------------------------------


                         .         .         .         +         .         .         .:280
query           AMGHIRRLTVAREKGXXXXXXDPRAPNLAYSSVEWIPINPGTDAAFVLSLIYVIISEGLYDAAFLKKYTN
1dmsA           TSQIGPGLEALKAKGTKVIVIDPRTKTVEFFGADHVTPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
1cxtA           TNEIGAGMKALKEKGTRVICINPVRTETAYFGADVVSPRPQTDVALMLGMAHTLYSEDLHDKDFLENCTT
1e61A           TSQIGPGLEALKAKGTKVIVIDPRTKTVEFFGAEHITPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
1e61C           TSQIGPGLEALKAKGTKVIVIDPVRTKTVFFGAEHITPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
1e60A           TSQIGPGLEALKAKGTKVIVIDPRTKTVEFFGAEHITPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
1e5vA           TSQIGPGLEALKAKGTKVIVIDPVRTKTVFFGAEHITPKPQTDVAIMLGMAHTLVAEDLYDKDF------
4dmrA           TSQIGPGLEALKAKGTKVIVIDPRTKTVEFFGAEHITPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
1dmrA           TSQIGPGLEALKAKGTKVIVIDPRTKTVEFFGAEHITPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
2dmrA           TSQIGPGLEALKAKGTKVIVIDPRTKTVEFFGAEHITPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
1e18A           TSQIGPGLEALKAKGTKVIVIDPVRTKTVFFGAEHITPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
1e60C           TSQIGPGLEALKAKGTKVIVIDPVRTKTVFFGAEHITPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
1cxsA           TNEIGAGMKALKEKGTRVICINPRTETADYFGADVVSPRPQTDVALMLGMAHTLYSEDLHDKDFLENCTT
2e7zA           HNWVSNDLKAALKRGCKLIVLDPRRTKVAEMADIWLPLRYGTDAALFLGMINVIINEQLYDKEFVENWCV
1aa6A           SHPIVNHVINAKRNG-----------------AKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHV
1d3kA           QHSTINLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLQEHFGKDKSK
1btjA           KHSTINLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLQEHFGKDKSK
3d81A           VYPAAELPLITVRSGGKLVIVNLGETPFDDIATLKYNMDVVEFARRVMEEGGI-----------------
1a8eA           KHSTINLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLQEHFGKDKSK
1b3eA           KHSTINLANKADRDNYELLCLDNTRKPVDYKDCHLAQVPSHTVVARSMGGKEDLIWELLAQEHFGKDKSK
1bp5A           KHSTIFENLAADRDQYELLCLDNTRKPVDYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQEHFGKDKSK
1dtgA           KHSTINLANKADRDNYELLCLDNTRKPVDEYKDCHLAQVPSETVVARSMGGEDLIWELLNQEHFGKDKSK
1bp5C           KHSTINLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVARSMGGKEDLIWELLNQEHFGKDKSK
3d4bA           VYPAAELPLITVRSGGKLVIVNLGETPFDDIATLKYNMDVVEFARRVMEEGGI-----------------
2b4yB           VVYPAAFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA---------------------
2b4yA           VVYPAAFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA---------------------
3cf4G           FYINQVLSAAKNFSNLKTIAIERGYIQNATMSFGNLSK--ADHYAALDELINAL----------------
3cf2A           ----------------------------------------------------------------------
3cf1A           ----------------------------------------------------------------------
1cz4A           ----------------------------------------------------------------------
3dkyF           MAISPLHDKDAHYHVLYIAKNPVTADSVRKKIKLLLGEKSLAMVQVVLNVENMYLYLTHESKDAIAKKK-
1ci4A           ----------------------------------------------------------------------
2b4yC           VVYPAAFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA---------------------
2b4yD           -VYPAAFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA---------------------
3cf1B           ----------------------------------------------------------------------
2ekbA           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
1e3tA           -----TNPAAKTDPSSPIYGMPILDVEKAGTVLFIKRSMASGYAGVENELFFRNNTMMLFGDA-------
1djlA           NSAA-QEDPNSIIAGMPVLEVWKSKQVIVMKRSLGVGYAAVDNPIFYKPNTAMLL---------------
2ekzA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           APFLIKPDGQPLTQKDLGQEGTAYLVYDNAAKSLAPHDKAQDPALDYEGEVQTPAGVIKVKTAFRLLAER
1dmsA           GF-------------------DKFLPYLMGETDSTPK---------------------------------
1cxtA           GFDLF----------------AAYLTGESDGTPKTA----------------------------------
1e61A           ------------------------------------------------GFDKFLPYLDGETDSTPKTAEW
1e61C           GFD-----------------------------KFLPYLDGETDSTPK-----------------------
1e60A           GF-------------------DKFLPYLDGETDSTPKT--------------------------------
1e5vA           ---------------------------------IANYTSGFDKFLPYL-----------------DGETD
4dmrA           GF-------------------DKFLPYLDGETDSTPKT--------------------------------
1dmrA           ------------------------------------------------GFDKFLPYLDGETDSTPKTAEW
2dmrA           -----------------GFDK------------FLPYLDGETDSTPK-----------------------
1e18A           ------------------------------------------------GFDKFLPYLDGETDSTPKTAEW
1e60C           ------------------------------------------------GFDKFLPYLDGETDSTPKTAEW
1cxsA           ------------------------------------------------GFDLFAAYLTGESDGTPKTAEW
2e7zA           GFEE-----------------------------LKERVQEYPLD-----KVAEITGC--DAGEIRKAAVM
1aa6A           IIEENLYD---------------------------------------------KAFVASRTEGFEEYRKI
1d3kA           EFQLFS----------------------------------------------------------------
1btjA           ----------------------------------------------------------------------
3d81A           ----------------------------------------------------------------------
1a8eA           EF--------------------------------------------------------------------
1b3eA           ----------------------------------------------------------------------
1bp5A           EFQLFS----------------------------------------------------------------
1dtgA           ----------------------------------------------------------------------
1bp5C           EFQL------------------------------------------------------------------
3d4bA           ----------------------------------------------------------------------
2b4yB           ----------------------------------------------------------------------
2b4yA           ----------------------------------------------------------------------
3cf4G           ----------------------------------------------------------------------
3cf2A           ----------------------------------------------------------------------
3cf1A           ----------------------------------------------------------------------
1cz4A           ----------------------------------------------------------------------
3dkyF           ----------------------------------------------------------------------
1ci4A           ----------------------------------------------------------------------
2b4yC           ----------------------------------------------------------------------
2b4yD           ----------------------------------------------------------------------
3cf1B           ----------------------------------------------------------------------
2ekbA           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
1e3tA           ----------------------------------------------------------------------
1djlA           ----------------------------------------------------------------------
2ekzA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AAKYTPENAEKITGIPADTIRRIAREFATSRGVAEDGWYTAKNGNDFDAYRAILILNALVGNIDKRGGLC
1dmsA           ----TAEWASDISGVPAETIKELARLFKSKRTMLAAGWSMQRMHHGEQAHWMLVTLASMLGQIGLPGGSY
1cxtA           ------EWAAEICGLPAEQIRELARSFVAGRTMLAAGWSIQRMHHGEQAHWMLVTLASMIGQIGLPGGSY
1e61A           AE--------GISGVPAETIKELARLFESKRTMLAAGWSMQRMHHGEQAHWMLVTLASMLGQIGLPGGYH
1e61C           ----TAEWAEGISGVPAETIKELARLFESKRTMLAAGWSMQRMHHGEQAHWMLVTLASMLGQIGLPGG--
1e60A           -----AEWAEGISGVPAETIKELARLFESKRTMLAAGWSMQRMHHGEQAHWMLVTLASMLGQIGLPGGSY
1e5vA           STPKTAEWAEGISGVPAETIKELARLFESKRTMLAAGWSMQRMHHGEQAHWMLVTLASMLGQIGLPGGSY
4dmrA           -----AEWAEGISGVPAETIKELARLFESKRTMLAAGWSMQRMHHGEQAHWMLVTLASMLGQIGLPGGSY
1dmrA           A--------EGISGVPAETIKELARLFESKRTMLAAGWSMQRMHHGEQAHWMLVTLASMLGQIGLPGGSY
2dmrA           ----TAEWAEGISGVPAETIKELARLFESKRTMLAAGWSMQRMHHGEQAHWMLVTLASMLGQIGLPGGSY
1e18A           AE--------GISGVPAETIKELARLFESKRTMLAAGWSMQRMHHGEQAHWMLVTLASMLGQIGLPGGSY
1e60C           AE--------GISGVPAETIKELARLFESKRTMLAAGWSMQRMHHGEQAHWMLVTLASMLGQIGLPGGGF
1cxsA           AAEIC--------GLPAEQIRELARSFVAGRTMLAAGWSIQRMHHGEQAHWMLVTLASMIGQIGLPGGSY
2e7zA           FAT-------------------------ESPASIPWAVSTDMQKNSCSAIRAQCILRAIVGSFVNGAEIL
1aa6A           VEGYTPESVEDITGVSASEIRQAARMYAQAKSAAILGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGV
1d3kA           ----------------------------------------------------------------------
1btjA           ----------------------------------------------------------------------
3d81A           ----------------------------------------------------------------------
1a8eA           ----------------------------------------------------------------------
1b3eA           ----------------------------------------------------------------------
1bp5A           ----------------------------------------------------------------------
1dtgA           ----------------------------------------------------------------------
1bp5C           ----------------------------------------------------------------------
3d4bA           ----------------------------------------------------------------------
2b4yB           ----------------------------------------------------------------------
2b4yA           ----------------------------------------------------------------------
3cf4G           ----------------------------------------------------------------------
3cf2A           ----------------------------------------------------------------------
3cf1A           ----------------------------------------------------------------------
1cz4A           ----------------------------------------------------------------------
3dkyF           ----------------------------------------------------------------------
1ci4A           ----------------------------------------------------------------------
2b4yC           ----------------------------------------------------------------------
2b4yD           ----------------------------------------------------------------------
3cf1B           ----------------------------------------------------------------------
2ekbA           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
1e3tA           ----------------------------------------------------------------------
1djlA           ----------------------------------------------------------------------
2ekzA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           FQESSKFPSAVTVFQDRIETIIGHVLPPIKAQRLDRLKYPETPATFDALLDAIIEEKPYPVKALFIVATS
1dmsA           HYSGGGTPSSSGPALSGITDGGASVIP--VARVVDMLENPGAEFDFN-----GTRSKFPDVKMAYWVGGN
1cxtA           HYSNGGSPTSDGPALGGISDGGATSIPCARVVDMLLNPGGEFQFNGATATY-------PDVKLAYWAGGN
1e61A           YSGGGTPSTSGPALAGITDGGGASVIP--VARVVDMLENPGAEFD-----FNGTRSKFPDVKMAYWVGGN
1e61C           -GFGLSYHYSGGGTPSTSGPALAGITDGGGASVIPVARVVDMLENPGAEFDFNGTRSKFPVKMAYWVGGN
1e60A           HYSGGGTPSTS-------GPALAGITDGGAATKGPEWLAASGASVIPVFDFNGTRSKFPDVKMAYWVGGN
1e5vA           HYSGGGTPSTSGPALAGITDGGASVIP--VARVVDMLENPGAEFD-----FNGTRSKFPDVKMAYWVGGN
4dmrA           HYSGGGTPSSGPALAGITDGGKGPEWLA--ASVIPVARVVDMLENPGAEFDFNGTRSKFPVKMAYWVGGN
1dmrA           HYSGGGTPSSGPALAGITDGGAATKGP--EWLAASGASVIPVARVVDMLEFNGTRSKFPDVKMAYWVGGN
2dmrA           HYSGGGTPSTSGPALAGITDGGAATKGASVIPVARVVDMLENPAEFDFNGTRS---KFPDVKMAYWVGGN
1e18A           HYSGGGTPSTS-------GPALAGITDGGAATKGPEWLAASGASVIPVFDFNGTRSKFPDVKMAYWVGGN
1e60C           GLSYHYSGGGTPSTSGPALAGITDGGAASGASVIPVARVVDMLENPGAEFDFNGTRSKFPVKMAYWVGGN
1cxsA           HYSNGGSPTSDG-------PALGGISDGGWATSIPCARVVDMLLNGGEFQFNGATATYPDVKLAYWAGGN
2e7zA           GAHSDLVPISKIQMHEALPEEKKKLQLGTETYPFLTTGMSALEEPSERLFTAMATEKPYPVKAFFALASN
1aa6A           NPVRGQNNVQGACDMGALPDTYPGYQYVKDPAKAWGVESLHTGYRISELPHRA---AHGEVRAAYIMGED
1d3kA           ----------------------------------------------------------------------
1btjA           ----------------------------------------------------------------------
3d81A           ----------------------------------------------------------------------
1a8eA           ----------------------------------------------------------------------
1b3eA           ----------------------------------------------------------------------
1bp5A           ----------------------------------------------------------------------
1dtgA           ----------------------------------------------------------------------
1bp5C           ----------------------------------------------------------------------
3d4bA           ----------------------------------------------------------------------
2b4yB           ----------------------------------------------------------------------
2b4yA           ----------------------------------------------------------------------
3cf4G           ----------------------------------------------------------------------
3cf2A           ----------------------------------------------------------------------
3cf1A           ----------------------------------------------------------------------
1cz4A           ----------------------------------------------------------------------
3dkyF           ----------------------------------------------------------------------
1ci4A           ----------------------------------------------------------------------
2b4yC           ----------------------------------------------------------------------
2b4yD           ----------------------------------------------------------------------
3cf1B           ----------------------------------------------------------------------
2ekbA           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
1e3tA           ----------------------------------------------------------------------
1djlA           ----------------------------------------------------------------------
2ekzA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           PFHRDVNTXXXXXXXXXXXXIVAIDILPQDHIDWSDYVLPDLMFLEREEIGSIKWSLHAGIRYSHKVLDP
1dmsA           PFVHHQDRNRMVKAWEKLETFIVHDFQWTPTARHADIVLPATTSYERNDIETIGDYSNTGILAMKKIVEP
1cxtA           PFAHHQDRNRMLKAWEKLETFIVQDFQWTATARHADIVLPATTSYERNDIESVGDYSNRAILAMKKVVDP
1e61A           PFVHHQDRNRMVKAWEKLETFVVHDFQWTPTARHADIVLPATTSYERNDIETIGDYSNTGILAMKKIVEP
1e61C           PFVHHQDRNRMVKAWEKLETFVVHDFQWTPTARHADIVLPATTSYERNDIETIGDYSNTGILAMKKIVEP
1e60A           PFVHHQDRNRMVKAWEKLETFVVHDFQWTPTARHADIVLPATTSYERNDIETIGDYSNTGILAMKKIVEP
1e5vA           PFVHHQDRNRMVKAWEKLETFVVHDFQWTPTARHADIVLPATTSYERNDIETIGDYSNTGILAMKKIVEP
4dmrA           PFVHHQDRNRMVKAWEKLETFVVHDFQWTPTARHADIVLPATTSYERNDIETIGDYSNTGILAMKKIVEP
1dmrA           PFVHHQDRNRMVKAWEKLETFVVHDFQWTPTARHADIVLPATTSYERNDIETIGDYSNTGILAMKKIVEP
2dmrA           PFVHHQDRNRMVKAWEKLETFVVHDFQWTPTARHADIVLPATTSYERNDIETIGDYSNTGILAMKKIVEP
1e18A           PFVHHQDRNRMVKAWEKLETFVVHDFQWTPTARHADIVLPATTSYERNDIETIGDYSNTGILAMKKIVEP
1e60C           PFVHHQDRNRMVKAWEKLETFVVHDFQWTPTARHADIVLPATTSYERNDIETIGDYSNTGILAMKKIVEP
1cxsA           PFAHHQDRNRMLKAWEKLETFIVQDFQWTATARHADIVLPATTSYERNDIESVGDYSNRAILAMKKVVDP
2e7zA           ALMGYANQQNALKGLMNQDLVVCYDQFMTPTAQLADYVLPGDHWLERPVVQP-NWEGIPFGNTSQQVVEP
1aa6A           PLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFT---AADRGFQRFFKAVEP
1d3kA           ----------------------------------------------------------------------
1btjA           ----------------------------------------------------------------------
3d81A           ----------------------------------------------------------------------
1a8eA           ----------------------------------------------------------------------
1b3eA           ----------------------------------------------------------------------
1bp5A           ----------------------------------------------------------------------
1dtgA           ----------------------------------------------------------------------
1bp5C           ----------------------------------------------------------------------
3d4bA           ----------------------------------------------------------------------
2b4yB           ----------------------------------------------------------------------
2b4yA           ----------------------------------------------------------------------
3cf4G           ----------------------------------------------------------------------
3cf2A           ----------------------------------------------------------------------
3cf1A           ----------------------------------------------------------------------
1cz4A           ----------------------------------------------------------------------
3dkyF           ----------------------------------------------------------------------
1ci4A           ----------------------------------------------------------------------
2b4yC           ----------------------------------------------------------------------
2b4yD           ----------------------------------------------------------------------
3cf1B           ----------------------------------------------------------------------
2ekbA           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
1e3tA           ----------------------------------------------------------------------
1djlA           ----------------------------------------------------------------------
2ekzA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           PPGVDARSAFWALMEIIRRAFPEKAKIVEYDEKYADYNAFEHYEKKFFEAALRKLAETWKLDFEEIKEAL
1dmsA           LY--EARSDYDIFAAV--------AERLGKGKEFTEGKDEMGWIKSFYDDAAKKAGGVEMPAFDAFWAEG
1cxtA           LY--EARSDYDIFAALAER-LGKGAEFTEGRDEMGWISSFYEAAVKQAEFKNVAMPSFEDFWSEGIVEFP
1e61A           LY--EARSDYDIFAAVAER-LGKGAEFTEGKDEMGWIKSFYDDAAKQGKAAGVEMPAFDAFWAEGIVEFP
1e61C           LY--EARSDYDIFAAV--------AERLGKGAEFTEGKDEMGWIKSFYDDAAKKAAGVEMPAFDAFWAEP
1e60A           LY--EARSDYDIFAAVAER-LGKGAEFTEGKDEMGWIKSFYDDAAKQGKAAGVEMPAFDAFWAEGIVEFP
1e5vA           LY--EARSDYDIFAAV--------AERLGKGAEFTEGKDEMGWIKSFYDDAAKKAAGVQMPAFDAFWAEP
4dmrA           LY--EARSDYDIFAAVAER-LGKGAEFTEGKDEMGWIKSFYDDAAKQGKAAGVQMPAFDAFWAEGIVEFP
1dmrA           LY--EARSDYDIFAAV--------AERLGKGAEFTEGKDEMGWIKSFYDDAAKKAAGVQMPAFDAFWAEP
2dmrA           LY--EARSDYDIFAAV--------AERLGKGAEFTEGKDEMGWIKSFYDDAAKKAAGVQMPAFDAFWAEP
1e18A           LY--EARSDYDIFAAVAERLGKGKEFTEGKDEMGWIKSFYDDA------AKQGKAAGVEMPAFDAFWAEP
1e60C           LY--EARSDYDIFAAV--------AERLGKGAEFTEGKDEMGWIKSFYDDAAKKAAGVEMPAFDAFWAEP
1cxsA           LY--EARSDYDIFAAL--------AERLGKGAEFTEGRDEMGWISSFYEAAVKQFKNVAMPSFEDFWSFP
2e7zA           AG--EAKDEYYFIRELAVRM------------GLEEHFPWKDRLELINY---------RISPTGMEWEEY
1aa6A           KW--DLKTDWQIISEIATR--------MGYPMHYNNT-------QEIWDELRHLCPDFYGATYEKMGELG
1d3kA           ----------------------------------------------------------------------
1btjA           ----------------------------------------------------------------------
3d81A           ----------------------------------------------------------------------
1a8eA           ----------------------------------------------------------------------
1b3eA           ----------------------------------------------------------------------
1bp5A           ----------------------------------------------------------------------
1dtgA           ----------------------------------------------------------------------
1bp5C           ----------------------------------------------------------------------
3d4bA           ----------------------------------------------------------------------
2b4yB           ----------------------------------------------------------------------
2b4yA           ----------------------------------------------------------------------
3cf4G           ----------------------------------------------------------------------
3cf2A           ----------------------------------------------------------------------
3cf1A           ----------------------------------------------------------------------
1cz4A           ----------------------------------------------------------------------
3dkyF           ----------------------------------------------------------------------
1ci4A           ----------------------------------------------------------------------
2b4yC           ----------------------------------------------------------------------
2b4yD           ----------------------------------------------------------------------
3cf1B           ----------------------------------------------------------------------
2ekbA           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
1e3tA           ----------------------------------------------------------------------
1djlA           ----------------------------------------------------------------------
2ekzA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           ERDGFYILKKKTYETRPYKTPLGTPSGKVEIYTLRALKYGIDPLPDWIPPVYKIPQASDEFYLVNGKDNF
1dmsA           ITDGADFVRYASFREDPLLNPLGTPTGLIEIYSKNIEKDDCPAHPTWMEPLERLDGPGAKYPLHHPFNRL
1cxtA           ITEGANFVRYADFREDPLFNPLGTPSGLIEIYSKNIEKMGYDDCPTWMEPAERLGGAGAKLHVVASHPKS
1e61A           VTDGADFVRYASFREDPLLNPLGTPTGLIEIYSKNIEKMGYDAHPTWMEPLERLDGPGAKLHIAASHPFN
1e61C           VTDGADFVRYASFREDPLLNPLGTPTGLIEIYSKNIEKMGYDAHPTWMEPLERLDGPGAKLHIAASFNRL
1e60A           VTDGADFVRYASFREDPLLNPLGTPTGLIEIYSKNIEKMGYDDCPAHPTWMEPLERLDGPLHIAASHLHS
1e5vA           VTDGADFVRYASFREDPLLNPLGTPTGLIEIYSKNIEKMGYDAHPTWMEPLERLDGPGAKLHIAASFNRL
4dmrA           VTDGADFVRYASFREDPLLNPLGTPTGLIEIYSKNIEKMGYDAHPTWMEPLERLDGPGAKLHIAASFNRL
1dmrA           VTDGADFVRYASFREDPLLNPLGTPTGLIEIYSKNIEKMGYDAHPTWMEPLERLDGPGAKLHIAASFNRL
2dmrA           VTDGADFVRYASFREDPLLNPLGTPTGLIEIYSKNIEKMGYDAHPTWMEPLERLDGPGAKLHIAASFNRL
1e18A           VTDGADFVRYASFREDPLLNPLGTPTGLIEIYSKNIEKMGYDAHPTWMEPLERLDGPGAKLHIAASHLHS
1e60C           VTDGADFVRYASFREDPLLNPLGTPTGLIEIYSKNIEKMGYDAHPTWMEPLERLDGPGAKLHIAASHLHS
1cxsA           ITEGANFVRYADFREDPLFNPLGTPSGLIEIYSKNIEKMGYDDCPTWMEPAERLGGAGAKLHVVASHPKS
2e7zA           QKQYTYMSKLPDYF-GPEGVGVATPSGKVELYSSVFEKLGYDPLPYYHEPLQTELAKEYPLILFAGLRED
1aa6A           FIQWPCRDTSDADQGTLFKEKFDTPNGLAQFFT-----------CDWVAPIDK-LTDEYPMVLSTVREVG
1d3kA           ----------------------------------------------------------------------
1btjA           ----------------------------------------------------------------------
3d81A           ----------------------------------------------------------------------
1a8eA           ----------------------------------------------------------------------
1b3eA           ----------------------------------------------------------------------
1bp5A           ----------------------------------------------------------------------
1dtgA           ----------------------------------------------------------------------
1bp5C           ----------------------------------------------------------------------
3d4bA           ----------------------------------------------------------------------
2b4yB           ----------------------------------------------------------------------
2b4yA           ----------------------------------------------------------------------
3cf4G           ----------------------------------------------------------------------
3cf2A           ----------------------------------------------------------------------
3cf1A           ----------------------------------------------------------------------
1cz4A           ----------------------------------------------------------------------
3dkyF           ----------------------------------------------------------------------
1ci4A           --------KHRDFVAEPGEKPVGSLAGIGEVLGKKLEERGAYVVLGQFLVLKKDEDLFREWLK-----DT
2b4yC           ----------------------------------------------------------------------
2b4yD           ----------------------------------------------------------------------
3cf1B           ----------------------------------------------------------------------
2ekbA           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
1e3tA           ----------------------------------------------------------------------
1djlA           ----------------------------------------------------------------------
2ekzA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           VSAHMVMVKNAKWIADRTVWMNPADAERLGIKDGDVVELEGLDNGFKAMAVVKVTNRVKPGVLFTYAFVG
1dmsA           HSQLNGTVEGYAVQGHEPCLMHPDDAAARGIADGDVVRVHN-DRG-QILTGVKVTDAVMKGVIQIY--EG
1cxtA           RLHSQLNGTSLRDLYAVPCLINPADAAARGIADGDVLRVFN-DRG-QILVGAKVSDAVMPGAIQIY--EG
1e61A           RLHSQLNGTVLREGYAVPCLMHPDDAAARGIADGDVVRVHN-DRG-QILTGVKVTDAVMKGVIQIY--EG
1e61C           HSQLNGTVEGYAVQGHEPCLMHPDDAAARGIADGDVVRVHN-DRG-QILTGVKVTDAVMKGVIQIYE--G
1e60A           QLNGTVLREGYAVQGHEPCLMHPDDAAARGIADGDVVRVHN-DRG-QILTGVKVTDAVMKGVIQIYEGGW
1e5vA           HSQLNGTVEGYAVQGHEPCLMHPDDAAARGIADGDVVRVHN-DRG-QILTGVKVTDAVMKGVIQIY--EG
4dmrA           HSQLNGTVEGYAVQGHEPCLMHPDDAAARGIADGDVVRVHN-DRG-QILTGVKVTDAVMKGVIQIY--EG
1dmrA           HSQLNGTVEGYAVQGHEPCLMHPDDAAARGIADGDVVRVHN-DRG-QILTGVKVTDAVMKGVIQIY--EG
2dmrA           HSQLNGTVEGYAVQGHEPCLMHPDDAAARGIADGDVVRVHN-DRG-QILTGVKVTDAVMKGVIQIY--EG
1e18A           QLNGTVLREGYAVQGHEPCLMHPDDAAARGIADGDVVRVHN-DRG-QILTGVKVTDAVMKGVIQIY--EG
1e60C           QLNGTVLREGYAVQGHEPCLMHPDDAAARGIADGDVVRVHN-DRG-QILTGVKVTDAVMKGVIQIYE--G
1cxsA           RLHSQLNGTSLRDLYAVPCLINPADAAARGIADGDVLRVFN-DRG-QILVGAKVSDAVMPGAIQIY--EG
2e7zA           SNFQSCYHQPRDAEPDPVALLHPKTAQSLGLPSGEWIWVETTHGRLKLLL--KHDGAQPEGTIRIPEQEG
1aa6A           HYSCRSMTGNCAALAPGYAQINTEDAKRLGIEDEALVWVHSRKGKIITR--AQVSDRPNKGAIYMT-YQW
1d3kA           ----------------------------------------------------------------------
1btjA           ----------------------------------------------------------------------
3d81A           ----------------------------------------------------------------------
1a8eA           ----------------------------------------------------------------------
1b3eA           ----------------------------------------------------------------------
1bp5A           ----------------------------------------------------------------------
1dtgA           ----------------------------------------------------------------------
1bp5C           ----------------------------------------------------------------------
3d4bA           ----------------------------------------------------------------------
2b4yB           ----------------------------------------------------------------------
2b4yA           ----------------------------------------------------------------------
3cf4G           ----------------------------------------------------------------------
3cf2A           -----LIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGK-KRREAVCIVLSDDTCSDEKIR------
3cf1A           -----LIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGK-KRREAVCIVLSDDTCSDEKIR------
1cz4A           ------ILRVAEANSTDRVRLDESSRRLLDAEIGDVVEIE-KVRKTVGRVYRARPEDENKGIVRID----
3dkyF           ----------------------------------------------------------------------
1ci4A           CGAN------------------------------------------------------------------
2b4yC           ----------------------------------------------------------------------
2b4yD           ----------------------------------------------------------------------
3cf1B           -------VDEAINEDNSVVSLSQPKMDELQLFRGDTVLL-KGKKRREAVCIVLSDDTCSDEKIR------
2ekbA           ----------------------------------------------------------------------
1e32A           -------VDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGK-KRREAVCIVLSDDTCSDEKIR------
1e3tA           ----------------------------------------------------------------------
1djlA           ----------------------------------------------------------------------
2ekzA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           GRTSKLISGEYQFLKEGINPQWFTTGKVEPVVGSAPTNSSVRVRRx
1dmsA           GWYDPSDVTEAGTLDKYGDVNVLSADGTSKLAQGNCGQTLAEVEK-
1cxtA           GWYDPLDPSEEGTLDKYGDVNVLSLDGTSKLAQGNCGQTIADVEK-
1e61A           GWYDPSDVTEPGTLDKYGDVNVLSAIGTSKLAQGNCGQTVAEVEK-
1e61C           GWYDPSDVTEPGTLDKYGDVNVLSADGTSKLAQGNCGQTVAEVEK-
1e60A           Y--DPSDVTEPGTLDKYGDVNVLSAIGTSKLAQGNCGQTVAEVEK-
1e5vA           GWYDPSDVTEPGTLDKYGDVNVLSADGTSKLAQGNCGQTVAEVEK-
4dmrA           GWYDPSDVTEPGTLDKYGDVNVLSADGTSKLAQGNCGQTVAEVEK-
1dmrA           GWYDPSDVTEPGTLDKYGDVNVLSADGTSKLAQGNCGQTVAEVEK-
2dmrA           GWYDPSDVTEPGTLDKYGDVNVLSADGTSKLAQGNCGQTVAEVEK-
1e18A           GWYDPSDVTEPGTLDKYGDVNVLSADGTSKLAQGNCGQTVAEVEK-
1e60C           GWYDPSDVTEPGTLDKYGDVNVLSADGTSKLAQGNCGQTVAEVEK-
1cxsA           GWYDPLDPSEEGTLDKYGDVNVLSLDGTSKLAQGNCGQTIADVEK-
2e7zA           GPETGFSGAMLHND---AMVLSDDDWNLDPEQGLPNLRGGAKAYK-
1aa6A           WPEYKYCAVRVEPI-ADQRAAEQYVIDEYNKLKTRLREAAL-----
1d3kA           ----------------------------------------------
1btjA           ----------------------------------------------
3d81A           ----------------------------------------------
1a8eA           ----------------------------------------------
1b3eA           ----------------------------------------------
1bp5A           ----------------------------------------------
1dtgA           ----------------------------------------------
1bp5C           ----------------------------------------------
3d4bA           ----------------------------------------------
2b4yB           ----------------------------------------------
2b4yA           ----------------------------------------------
3cf4G           ----------------------------------------------
3cf2A           ----------------------------------------------
3cf1A           ----------------------------------------------
1cz4A           ----------------------------------------------
3dkyF           ----------------------------------------------
1ci4A           ----------------------------------------------
2b4yC           ----------------------------------------------
2b4yD           ----------------------------------------------
3cf1B           ----------------------------------------------
2ekbA           ----------------------------------------------
1e32A           ----------------------------------------------
1e3tA           ----------------------------------------------
1djlA           ----------------------------------------------
2ekzA           ----------------------------------------------