[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for paer1:AAL64528.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bbnJ.bssp"
#ERROR : Can't open dsspfile "3d3bJ.bssp"
#ERROR : Can't open dsspfile "3d3cK.bssp"
#ERROR : Can't open dsspfile "3d3cJ.bssp"

## Summary of PDB Search
:106
    2e-21  32%  3bbnJ  [x.x.x] RIBOSOMAL PROTEIN S10
    1e-16  40%  3d3bJ  [x.x.x] 30S RIBOSOMAL PROTEIN S10
    3e-16  40%  3d3cK  [x.x.x] 30S RIBOSOMAL PROTEIN S10
    4e-16  39%  3d3cJ  [x.x.x] 30S RIBOSOMAL PROTEIN S10
:106

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSLASRRKVRIRLYGTNPADVEQVAREIVDLAKKMGVQVRGPIPLPTRRLIVTVRRAPSGQGYHTFDHWE
3bbnJ           ------QKIRIKLRSYWVPLIEDSCKQIMDAARTTNAKTMGPVPLPTKKRIFCVLKSPHVHK-DARFHFE
3d3bJ           LGSMQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRS---------------------
3d3cK           LGSMQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRS---------------------
3d3cJ           LGSMQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPT----------------------R


                         .         .         *         .         .         .         .:140
query           MRISKRLIDIEASERVLRRLMTIRVPDTVKIELQLx
3bbnJ           IRTHQRLIDILYTAQTIDSLMQLDLPAGVDVEVKL-
3d3bJ           -RTHLRLVDIEPTEKTVDALMRLDLAAGVDVQISL-
3d3cK           -RTHLRLVDIEPTEKTVDDLMRLDLAAGVDVQISL-
3d3cJ           SRTHLRLVDIEPTEKTVDDLMRLDLAAGVDVQISL-