[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for paer1:AAL64645.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bkoA.bssp"
#ERROR : Can't open dsspfile "2bknA.bssp"
#ERROR : Can't open dsspfile "2aejA.bssp"

## Summary of PDB Search
:546
    3e-05  20%  2bkoA  [x.x.x] HYPOTHETICAL PROTEIN PH0236
    5e-04  24%  2bknA  [x.x.x] HYPOTHETICAL PROTEIN PH0236
    8e-04  32%  2aejA  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
:546

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkoA           ----------------------------------------------------------------------
2bknA           ----------------------------------------------------------------------
2aejA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkoA           ----------------------------------------------------------------------
2bknA           ----------------------------------------------------------------------
2aejA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkoA           ----------------------------------------------------------------------
2bknA           ----------------------------------------------------------------------
2aejA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFMTSKDLILRPLGNNKGEH
2bkoA           ---------------------------------------------------EGVELHPVIKETILEGEEI
2bknA           ---------------------------------------------------------------------I
2aejA           -------------------------------------------------------------------TRR


                         .         *         .         .         .         .         +:350
query           MEFLIVTQRSRLVGKTLALEPIHNVFPVSIIGIVPSGPVESLESYVFRPGDEILVLGDEKVIERIAAYYR
2bkoA           IGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRFGPNENFKIRAGDVLIGRGTRTSIDHLKEIAR
2bknA           IGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRFGPNENFKIRAGDVLIGRGTRTSIDHLKEIAR
2aejA           MVEVPIPEGSKLEGVSVLDADIHDVTGVIIIGVGRGDELIIDPDYSFRAGDIILGIGKPEEIERL-----


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkoA           ----------------------------------------------------------------------
2bknA           ----------------------------------------------------------------------
2aejA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkoA           ----------------------------------------------------------------------
2bknA           ----------------------------------------------------------------------
2aejA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkoA           --------------------------------------------------------
2bknA           --------------------------------------------------------
2aejA           --------------------------------------------------------