[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for paer1:AAL64884.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2afiO.bssp"
#ERROR : Can't open dsspfile "1cp2A.bssp"
#ERROR : Can't open dsspfile "2bejA.bssp"
#ERROR : Can't open dsspfile "3bfvA.bssp"
#ERROR : Can't open dsspfile "3ea0B.bssp"
#ERROR : Can't open dsspfile "1dtsA.bssp"
#ERROR : Can't open dsspfile "2afkH.bssp"
#ERROR : Can't open dsspfile "1eg7B.bssp"
#ERROR : Can't open dsspfile "3b6rA.bssp"
#ERROR : Can't open dsspfile "3dreB.bssp"
#ERROR : Can't open dsspfile "2afkG.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "2afiF.bssp"
#ERROR : Can't open dsspfile "2bekA.bssp"
#ERROR : Can't open dsspfile "2afkF.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "3cioA.bssp"
#ERROR : Can't open dsspfile "2afkE.bssp"
#ERROR : Can't open dsspfile "1de0A.bssp"
#ERROR : Can't open dsspfile "2afiE.bssp"
#ERROR : Can't open dsspfile "2afiP.bssp"
#ERROR : Can't open dsspfile "3cwqB.bssp"
#ERROR : Can't open dsspfile "3ea0A.bssp"
#ERROR : Can't open dsspfile "2bekB.bssp"
#ERROR : Can't open dsspfile "2afiN.bssp"
#ERROR : Can't open dsspfile "3dreA.bssp"
#ERROR : Can't open dsspfile "2afiM.bssp"
#ERROR : Can't open dsspfile "2afiH.bssp"
#ERROR : Can't open dsspfile "1daeA.bssp"
#ERROR : Can't open dsspfile "3ecdD.bssp"

## Summary of PDB Search
:222
    6e-07  17%  2afiO  [x.x.x] NITROGENASE IRON PROTEIN 1
    2e-06  15%  1cp2A  [c.37.1] NITROGENASE IRON PROTEIN
    4e-06  22%  2bejA  [x.x.x] SEGREGATION PROTEIN
    4e-06  22%  3bfvA  [x.x.x] MEMBRANE PROTEIN CAPA1, PROTEIN TYROSINE KINASE
    5e-06  17%  3ea0B  [x.x.x] ATPASE, PARA FAMILY
    7e-06  13%  1dtsA  [x.x.x] DETHIOBIOTIN SYNTHETASE
    1e-05  16%  2afkH  [x.x.x] NITROGENASE IRON PROTEIN 1
    2e-05  17%  1eg7B  [c.37.1] FORMYLTETRAHYDROFOLATE SYNTHETASE
    3e-05  12%  3b6rA  [x.x.x] CREATINE KINASE B-TYPE
    3e-05   8%  3dreB  [x.x.x] CREATINE KINASE B-TYPE
    4e-05  16%  2afkG  [x.x.x] NITROGENASE IRON PROTEIN 1
    4e-05  19%  1eg7A  [c.37.1] FORMYLTETRAHYDROFOLATE SYNTHETASE
    5e-05  17%  2afiF  [x.x.x] NITROGENASE IRON PROTEIN 1
    5e-05  20%  2bekA  [x.x.x] SEGREGATION PROTEIN
    5e-05  14%  2afkF  [x.x.x] NITROGENASE IRON PROTEIN 1
    6e-05  22%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    6e-05  14%  3cioA  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    1e-04  16%  2afkE  [x.x.x] NITROGENASE IRON PROTEIN 1
    1e-04  17%  1de0A  [c.37.1] NITROGENASE IRON PROTEIN
    1e-04  42%  2afiE  [x.x.x] NITROGENASE IRON PROTEIN 1
    1e-04  15%  2afiP  [x.x.x] NITROGENASE IRON PROTEIN 1
    2e-04  29%  3cwqB  [x.x.x] PARA FAMILY CHROMOSOME PARTITIONING PROTEIN
    2e-04  39%  3ea0A  [x.x.x] ATPASE, PARA FAMILY
    3e-04  14%  2bekB  [x.x.x] SEGREGATION PROTEIN
    3e-04  18%  2afiN  [x.x.x] NITROGENASE IRON PROTEIN 1
    3e-04  10%  3dreA  [x.x.x] CREATINE KINASE B-TYPE
    5e-04  18%  2afiM  [x.x.x] NITROGENASE IRON PROTEIN 1
    6e-04  43%  2afiH  [x.x.x] NITROGENASE IRON PROTEIN 1
    6e-04  14%  1daeA  [x.x.x] DETHIOBIOTIN SYNTHETASE
    8e-04   4%  3ecdD  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
:222

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxRTGTVAFTSCKGGAGKTTLAVNVSAALPLNVLLIDLGGGASRFFPAPLINIENITPTIEAYRDARVKN
2afiO           ------QCAIYGKGGIGKSTTTQNLVAALAKKVMIVDPKADSTRLILHSKAQNTIMEMAAEAGTVEDLEL
1cp2A           ------QVAIYGKGGIGKSTTTQNLTSGLHKTIMVVGLLGGLAQKSVLDTLREEGEDVELDSILKEGYGG
2bejA           --KVRRIALANQKGGVGKTTTAINLAAYLAKRVLLVDL--DPQGNATSGLGVRAERGVYHLLQGEPLEGL
3bfvA           -----SIVITSEAPGAGKSTIAANLAVAAGYKTLIVDGKPTQHYIFNLPLSSLLLNWSTYQDSIISTEIE
3ea0B           -----VFGFVSAKGGDGGSCIAANFAFALHVLAVDISLPFGDLDYLSGNTHSQDLADISNASDRLDKSLL
1dtsA           -----RYFVTGTDTEVGKTVASLQAAKAAGYRTAGYKP--VASGSEKTPEGLRNSDALALQRNSSLQLDY
2afkH           -----RQCAIYGKGGIGKSTTTQNLVAALKVMIVGCDPKADSTRLILMEMAAEAGTVEDLELEDVLKAGY
1eg7B           -----VTAITPTPAGEGKTTTSVGLTDALGKRVMVCLRGGGYAQVVPDINLHFTGDIHAVTYAHNLLAAM
3b6rA           -----HCSRGERRAIEKLVEALSSLDAGRYYALKSMTEAEQQQLIDLLLASGMARDWPDARGIWHNDNKT
3dreB           -------SRGERRAIEKLAVEALSSLDGRYYALKSMTEQQLIDDHFLFDKPVSPLLLPDARGIWHNDNKT
2afkG           -----RQCAIYGKGGIGKSTTTQNLVAALAKKVMIVGCDKADSTRLILHSKAQNTIMEELEDVLKAGYGG
1eg7A           --LILVTAITPTPAGEGKTTTSVGLTDALGKRVMVCLIKGGAAGGGYAQVVPMEDINLHFTGDIHAVTYA
2afiF           -----RQCAIYGKGGIGKSTTTQNLVAALAEMVMIVGCDPADSTRLILHSKAQNTIMEMAEDVLKAGYGG
2bekA           --KVRRIALANQKGGVGKTTTAINLAAYLAKRVLLVDLGNATSGLGRAERGVYHLLQGEPLEGLVHPVDG
2afkF           -----RQCAIYGKGGIGKSTTTQNLVAALGKKVMIVGCADSTRLILHSKAQNTIMEMAAEAGTVEDLELE
3do6A           --LILVTAVTPTPAGEGKTTTSIGLSSLNRIGSIVTLR--------------------------------
3cioA           -----ILMITGATPDSGKTFVSSTLAAVIDQKVLFIDARGYSHNLFEHGLSEYLAGKDELNKVIQHFGKG
2afkE           -----RQCAIYGKGGIGKSTTTQNLVAALKADSTRLILHSKAQNTIMEMAAEAGTVEDELEDVLKAGYGG
1de0A           -----RQCAIYGKGGIGKSTTTQNLVAALAKKVMIVGCQNTIMEMAAEAGTVEDLELEDVLKAGYGGVKC
2afiE           -----RQCAIYGKGGIGKSTTTQNLVAAL-----------------------------------------
2afiP           ----------YGKGGIGKSTTTQNLVAALAKKVMIVGLHSKAQNTIMEMAAEAGTVEDLEEDVLKAGYGG
3cwqB           ------ITVASFKGGVGKTTTAVHLSAYLQGETLLIDKRGSLPFKVVDERQAAKYAPKYQNIVIDTQARD
3ea0A           -----VFGFVSAKGGDGGSCIAANFAFA------------------------------------------
2bekB           --KVRRIALANQKGGVGKTTTAINLAAYLARLLVDLAPQGNATSGLGVRAERYHLLQGEPLEGLVHPVDG
2afiN           ---------IYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLILHSKAQNTLEDVLKAGYGG
3dreA           -----HCSRGERRAIEKLAVALSSLDGDLALKSMTEAEQQQLIDDHFLFASGMARDWPDARGIWHNDNKT
2afiM           ---------IYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLILHSKAQNTIMEMAAEAGTV
2afiH           ------QCAIYGKGGIGKSTTTQNLVAAL-----------------------------------------
1daeA           -----RYFVTGTDTEVGKTVASLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLDYATVN
3ecdD           ---------------------GITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFREVGRLILEV


                         .         .         *         .         .         .         .:140
query           LFVIPIAIDPASVWRIENWEEIFQNLTDAVRKNIVKNSIDVVVLDMYQLSRITPIETFGLDKADLIVLVV
2afiO           EDVLKAGYGGVKCVVGCAGRGVITAINFLEEEGAYEDDLDFVFYDVLDVVCGGFAMPIRENKAQEIYIVC
1cp2A           IRCVEPEPGVGCAGRGIITSINMLEQLGAYTDDL----DYVFYDVLGDVVCGGFAMPIREGKAQEIYIVA
2bejA           VHPVDFHLLPATPDLVGATVELAGAPTALREALRDEGYDLVLLDAPPSLSPLT---LNALAAAEGVVVPV
3bfvA           DLDVLTSGPIPPNPSELITSRAFANLYDTLLMN-----YNFVIIDT------------------------
3ea0B           DTVQHISPSLDLIPSPATFEKIVNIEPERVSDLIHIAASFYDYIIVDFGASIDHVGVWVLEHLDELCIVT
1dtsA           ATVNPYTFAEPTSPHIISAQEGRPIESLVMSARALEQQADWVLVEG------------------------
2afkH           GGVKCVESGGPEPGVGCAGRGVITAINFLEEEGAYEDDLDFVFYDVLDVVCGGFAMPIRENKAQEIYIVC
1eg7B           VDNHLQQGVLNIDPRTITWRRVIDLNERALRNIVIGLGGKANGVP-------------------------
3b6rA           FLVWVNEEDVISMQKGGNMKEVFTRFCTGL--TQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGV
3dreB           FLVWVNEEDHLRVIS-MQKGGNMKEVFTRFCTTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGV
2afkG           VKCVESGGPEPGV-GCAGRGVITAINFLEEEGAYEDDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVC
1eg7A           HNLLAAMVDNHLQQG--------NVLNIDPRTITWRRVIDLNERALRNIVIGLGGKANGVPRETGFDISV
2afiF           VKCVESGGPEP--GVGCAGRGVITAINFLEEEGAYEDDLDFVFYDVLDVVCGGFAMPIRENKAQEIYIVC
2bekA           FHLLPATPDLVGATVELAGAPTALREALRDEGYDLVLLDAPPSLSPLTLNALAAA---------------
2afkF           DVLKAGYGGVESGGPEPGVGCAGRGVITAINGAYEDDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVC
3do6A           ----------------------------------------------------------------------
3cioA           GFDVITRGQVPPNPSELLMRDRMRQLLEWAN----DHYDLVIVDTPPMLAVSDAAVVGRS--VGTSLLVA
2afkE           VKCVESGGPEP--GVGCAGRGVITAINFLEEEGAYEDDLDFVFYDVLDVVCGGFAMPIRENKAQEIYIVC
1de0A           VESGGPEPGVGCAGRGVITAINFLEEEGAYE----DDLDFVFYDVLGDVVCGGWAMPIRENKAQEIYIVC
2afiE           ----------------------------------------------------------------------
2afiP           VKCVESGGPEP--GVGCAGRGVITAINFLEEEGAYEDDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIV
3cwqB           LEALADGCD-------------------------------------------------------------
3ea0A           ----------------------------------------------------------------------
2bekB           FHLLPATPDLVGATVELAGAPTALREALRDEGYDLVLLDAPPSLSPLTLNAVQAEYYALEGVAGLLATLE
2afiN           VKCVESGGPEP--GVGCAGRGVITAINFLEEEGAYEDDLDFVFYDVLDVVCGGFAMPIRENKAQEIYIVC
3dreA           FLVWVNEEDHLRVISMGNMKEVFTRFCTGLTQ--IETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGV
2afiM           EDLELEDVLKAGYGGVKCVEGVITAINFLEEEGAYEDDLDFVFYDVLDVVCGGFAMPIRENKAQEIYIVC
2afiH           ----------------------------------------------------------------------
1daeA           PYTFAEPTSPHIISAQEGRPIESLVMSAGL--RALEQQADWVLVEG------------------------
3ecdD           FEALRTN--------PEGDHATEQRVRREIFA--------------------------------------


                         +         .         .         .         .         *         .:210
query           EGCEDCTKPITIIKKFFDGKLIIALNKHERGIEYPGAVVKIPFSATLDYYNRRGQFYTKPVTKLAEYLLQ
2afiO           ----------------------------------------------------------------------
1cp2A           SGEMMALYAANNISKGI-----------------------------------------------------
2bejA           Q---------------------------------------------------------------------
3bfvA           ----------------------------------------------------------------------
3ea0B           TSLRRAGQLLKLCKEFEKPISRIELNRADTSRITSDEIEK------------------------------
1dtsA           ----------------------------------------------------------------------
2afkH           SG--------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
3b6rA           HI-----KLPNLGK---HEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADR------LGFSEVELVQ
3dreB           H---------------------------------------------------------------------
2afkG           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
2afiF           SG--------------------------------------------------------------------
2bekA           ----------------------------------------------------------------------
2afkF           S---------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
3cioA           RFGLNTAKEVSLSMQRLEQAGV------------------------------------------------
2afkE           SG--------------------------------------------------------------------
1de0A           SG--------------------------------------------------------------------
2afiE           ----------------------------------------------------------------------
2afiP           CSGE------------------------------------------------------------------
3cwqB           ----------------------------------------------------------------------
3ea0A           ----------------------------------------------------------------------
2bekB           EVRAGLNPRLRLLG--------ILVTMYDGRTLLAQQVEAQ-----------------------------
2afiN           S---------------------------------------------------------------------
3dreA           H---------------------------------------------------------------------
2afiM           SGEMMA----------------------------------------------------------------
2afiH           ----------------------------------------------------------------------
1daeA           ----------------------------------------------------------------------
3ecdD           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ELxxxxxxxxxx
2afiO           ------------
1cp2A           ------------
2bejA           ------------
3bfvA           ------------
3ea0B           ------------
1dtsA           ------------
2afkH           ------------
1eg7B           ------------
3b6rA           MV----------
3dreB           ------------
2afkG           ------------
1eg7A           ------------
2afiF           ------------
2bekA           ------------
2afkF           ------------
3do6A           ------------
3cioA           ------------
2afkE           ------------
1de0A           ------------
2afiE           ------------
2afiP           ------------
3cwqB           ------------
3ea0A           ------------
2bekB           ------------
2afiN           ------------
3dreA           ------------
2afiM           ------------
2afiH           ------------
1daeA           ------------
3ecdD           ------------