[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for paer1:AAL64946.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dvaE.bssp"
#ERROR : Can't open dsspfile "3dv0E.bssp"
#ERROR : Can't open dsspfile "3dv0G.bssp"
#ERROR : Can't open dsspfile "2c31A.bssp"
#ERROR : Can't open dsspfile "3dv0A.bssp"
#ERROR : Can't open dsspfile "3dvaA.bssp"
#ERROR : Can't open dsspfile "3dv0C.bssp"
#ERROR : Can't open dsspfile "2e6kA.bssp"
#ERROR : Can't open dsspfile "1clfA.bssp"
#ERROR : Can't open dsspfile "1durA.bssp"
#ERROR : Can't open dsspfile "2bfbA.bssp"
#ERROR : Can't open dsspfile "1bluA.bssp"
#ERROR : Can't open dsspfile "1ay0A.bssp"
#ERROR : Can't open dsspfile "2bfcA.bssp"
#ERROR : Can't open dsspfile "1dtwA.bssp"
#ERROR : Can't open dsspfile "1dwlA.bssp"
#ERROR : Can't open dsspfile "2bffA.bssp"
#ERROR : Can't open dsspfile "2bfdA.bssp"
#ERROR : Can't open dsspfile "1bc6A.bssp"
#ERROR : Can't open dsspfile "1bqxA.bssp"
#ERROR : Can't open dsspfile "1a6lA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "3c38A.bssp"
#ERROR : Can't open dsspfile "2bfeA.bssp"
#ERROR : Can't open dsspfile "2bp7A.bssp"
#ERROR : Can't open dsspfile "2beuA.bssp"
#ERROR : Can't open dsspfile "1b0vA.bssp"
#ERROR : Can't open dsspfile "1bfdA.bssp"
#ERROR : Can't open dsspfile "1b0tA.bssp"
#ERROR : Can't open dsspfile "1d3wA.bssp"
#ERROR : Can't open dsspfile "3ea4A.bssp"
#ERROR : Can't open dsspfile "2ag1A.bssp"
#ERROR : Can't open dsspfile "1cp9B.bssp"
#ERROR : Can't open dsspfile "2c3yB.bssp"
#ERROR : Can't open dsspfile "1d0cB.bssp"

## Summary of PDB Search
:390
    6e-14  15%  3dvaE  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    5e-13  17%  3dv0E  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    3e-12  14%  3dv0G  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    7e-12  23%  2c31A  [x.x.x] OXALYL-COA DECARBOXYLASE
    2e-11  15%  3dv0A  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    9e-11  17%  3dvaA  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    1e-10  16%  3dv0C  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    1e-10  17%  2e6kA  [x.x.x] TRANSKETOLASE
    2e-10  34%  1clfA  [x.x.x] FERREDOXIN
    3e-10  32%  1durA  [d.58.1] 2[4FE-4S] FERREDOXIN
    3e-10  18%  2bfbA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    4e-10  19%  1bluA  [x.x.x] FERREDOXIN
    5e-10  12%  1ay0A  [c.36.1 - c.36.1 - c.48.1] TRANSKETOLASE
    5e-10  17%  2bfcA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    9e-10  13%  1dtwA  [c.36.1] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE
    9e-10  19%  1dwlA  [i.4.1] FERREDOXIN I
    2e-09  16%  2bffA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    2e-09  17%  2bfdA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    2e-09  25%  1bc6A  [x.x.x] 7-FE FERREDOXIN
    4e-09  22%  1bqxA  [d.58.1] PROTEIN (FERREDOXIN)
    3e-08  21%  1a6lA  [x.x.x] FERREDOXIN
    6e-08  38%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    6e-08   9%  3c38A  [x.x.x] AUTOINDUCER 2 SENSOR KINASE/PHOSPHATASE LUXQ
    8e-08  16%  2bfeA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    8e-08  15%  2bp7A  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    1e-07  18%  2beuA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    2e-07  15%  1b0vA  [d.58.1] PROTEIN (FERREDOXIN)
    4e-07  20%  1bfdA  [x.x.x] BENZOYLFORMATE DECARBOXYLASE
    6e-07  21%  1b0tA  [d.58.1] PROTEIN (FERREDOXIN I)
    8e-07  20%  1d3wA  [d.58.1] FERREDOXIN 1
    2e-06  17%  3ea4A  [x.x.x] ACETOLACTATE SYNTHASE, CHLOROPLASTIC
    2e-06  13%  2ag1A  [x.x.x] BENZALDEHYDE LYASE
    2e-05   8%  1cp9B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    2e-04  21%  2c3yB  [x.x.x] PYRUVATE-FERREDOXIN OXIDOREDUCTASE
    3e-04   6%  1d0cB  [d.174.1] BOVINE ENDOTHELIAL NITRIC OXIDE SYNTHASE HEME
:390

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxDVVIVTSGVAYNYVKEAVRRLNIRATVVKLGISVPVPPxxxxxxxxxxx
3dvaE           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dv0G           ----------------------------------------------------------------------
2c31A           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
2e6kA           ----------------------------------------------------------------------
1clfA           ----------------------------------------------------------------------
1durA           ----------------------------------------------------------------------
2bfbA           ----------------------------------------------------------------------
1bluA           ----------------------------------------------------------------------
1ay0A           ----------------------------------------------------------------------
2bfcA           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
1dwlA           ----------------------------------------------------------------------
2bffA           ----------------------------------------------------------------------
2bfdA           ----------------------------------------------------------------------
1bc6A           ----------------------------------------------------------------------
1bqxA           ----------------------------------------------------------------------
1a6lA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3c38A           ----------------------------------------------------------------------
2bfeA           ----------------------------------------------------------------------
2bp7A           ----------------------------------------------------------------------
2beuA           ----------------------------------------------------------------------
1b0vA           ----------------------------------------------------------------------
1bfdA           ----------------------------------------------------------------------
1b0tA           ----------------------------------------------------------------------
1d3wA           ----------------------------------------------------------------------
3ea4A           ----------------------------------------------------------------------
2ag1A           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
2c3yB           ---------------------ERVIVSMGSSCETIEEVINHLGEKIGLIKVRLYRPFVS-----------
1d0cB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dvaE           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dv0G           ----------------------------------------------------------------------
2c31A           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
2e6kA           ----------------------------------------------------------------------
1clfA           ----------------------------------------------------------------------
1durA           ----------------------------------------------------------------------
2bfbA           ----------------------------------------------------------------------
1bluA           ----------------------------------------------------------------------
1ay0A           ----------------------------------------------------------------------
2bfcA           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
1dwlA           ----------------------------------------------------------------------
2bffA           ----------------------------------------------------------------------
2bfdA           ----------------------------------------------------------------------
1bc6A           ----------------------------------------------------------------------
1bqxA           ----------------------------------------------------------------------
1a6lA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3c38A           ----------------------------------------------------------------------
2bfeA           ----------------------------------------------------------------------
2bp7A           ----------------------------------------------------------------------
2beuA           ----------------------------------------------------------------------
1b0vA           ----------------------------------------------------------------------
1bfdA           ----------------------------------------------------------------------
1b0tA           ----------------------------------------------------------------------
1d3wA           ----------------------------------------------------------------------
3ea4A           ----------------------------------------------------------------------
2ag1A           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
2c3yB           ----------------------------------------------------------------------
1d0cB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxHMATFYILRLATAGLNPVWSGDIGCYSLGINTGQQDLITHMGSSVGLGAGIALATGQFVVATVG
3dvaE           -------IWHGLPLYQAFLFSRGHFHGNQIPEGVNVLPPQIIIGAQYIQAAGVALGLKMRKKAVAITYTG
3dv0E           ------QEASQIASHFALEKEDFILPGYRDVPQIIWHGRGHFHGNQIPEGVNQAAGVALGKKAVAITYTG
3dv0G           -------IWHGLPLYQAFLFSRGHFHGNQIPEGVNVLPPQIIIGAQYIQAAGVALGLKMRKKAVAITYTG
2c31A           ---------NPDISLVNEGANALDNTRMIVDMLKPRKRLDSGTWGVMGIGMGYCVAAAAVTGKPVIAVEG
3dv0A           -------IWHGLPLYQAFLFSRGHFHGNQIPEGVNVLPPQIIIGAQYIQAAGVALGLKMRKKAVAITYTG
3dvaA           -------------------------------EGVNVLPPQIIIGAQYIQAAGVALGLKMRKKAVAITYTG
3dv0C           ------IIWHGLPLYQAFLFSRGHFHGNQIPEGVNVLPPQIIIGAQYIQAAGVALGLKMRKKAVAITYTG
2e6kA           ---------------------------------------------PLGQGISTAVGLALAVDHYTYVLAS
1clfA           ----------------------------------------------------------------------
1durA           ----------------------------------------------------------------------
2bfbA           ---------------------------------------------FVTISSPLATQIPQAVGRVVICYFG
1bluA           ----------------------------------------------------------------------
1ay0A           -----------YDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQGISNAVGMAMASDNYTYVFLG
2bfcA           ---------------------------------------------PLATQIPQAVGAAYAANRVVICYFG
1dtwA           ---------------------------------------------PLATQIPQAVGAAYAANRVVICYFG
1dwlA           ----------------------------------------------------------------------
2bffA           ---------------------------------------------PLATQIPQAVGAAYAANRVVICYFG
2bfdA           -------------------------KGRQMPVHYGCKERHFVTISPLATQIPQAVGAAYAANRVVICYFG
1bc6A           ----------------------------------------------------------------------
1bqxA           ----------------------------------------------------------------------
1a6lA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3c38A           -----------------------LMRRSSLIEAGGQVVGYLYVGIVLNDNFALLENIRSGNSENLVLAVD
2bfeA           ---------------------------------------------PLATQIPQAVGAAYAANRVVICYFG
2bp7A           ----------------RDPLKGRQLPIMYSVREAGFFTI----SGNLATQFVQAVGWAMASTKIASAWIG
2beuA           ---------------------------------------------FVTISSPLATQIPQAVGRVVICYFG
1b0vA           ----------------------------------------------------------------------
1bfdA           ----------------------------------------------LGFALPAAIGVQLAPERQVIAVIG
1b0tA           ----------------------------------------------------------------------
1d3wA           ----------------------------------------------------------------------
3ea4A           -------------------------HQMWAAQFYNYKKPRQWLSSGGLGAMGFGLPAAIGADAIVVDIDG
2ag1A           ------------------------LTYLWLSEVSRVKPGGFLCHGYLGSGVGFGTALGAQAGRRTILVTG
1cp9B           ----------------------------------------------GKTKASGAKAILLNGPQFPAYTYG
2c3yB           ----------------------------------------------------------------------
1d0cB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DSTFYHAVLPQLVDIATRSVPILIVVMDNAYTAMTGGQPSPSRAIPAERITEAFGISTFVIDPIDVKKSV
3dvaE           DGGTSQGDFYEGINFAAFKAPAIFVVQNNRFAASTPVEKQTV-AKTLAQKAVAAGIPGIQVDGMDPLAVY
3dv0E           DGGTSQGDFYEGINFAAFKAPAIFVVQNNRFAISTPVEKQTVAKTLAQKA-VAAGIPGIQVDGMDPLAVY
3dv0G           DGGTSQGDFYEGINFAAFKAPAIFVVQNNRFAISTPVE-KQTVAKTLAQKAVAAGIPGIQVDGMDPLAVY
2c31A           DSAFGF-SGMELETICRYNLPVTVIIMNNGGIYKGNEADPQLTRGRYDMMMEAFGGKGYVANPAELKAAL
3dv0A           DGGTSQGDFYEINFAGAFKAPAIFVVQNNRFAISTPVEKQTV-AKTLAQKAVAAGIPGIQVDGMDPLAVY
3dvaA           DGGTSQGDFYEGINFAAFKAPAIFVVQNNRFAASTPVEKQTVAKTLAQKA-VAAGIPGIQVDGMDPLAVY
3dv0C           DGGTSQGDFYEGINFAGAFAPAIFVVQNNRFAISTPVEKQTV-AKTLAQKAVAAGIPGIQVDGMDPLAVY
2e6kA           DGDLEGVSGEAASLAGHWGLSKLIVFWDDNRISIDGPTDLAFTEDVLARYRAYGWQTLRVEDVNDLEALR
1clfA           ----------------------------------------------------------------------
1durA           ----------------------------------------------------------------------
2bfbA           EGAASEGDAHAGFNFAATECPIIFFCRNNGYAISTPTSEQYR-GDGIAARGPGYGIMSIRVDGNDVFAVY
1bluA           ----------------------------------------------------------------------
1ay0A           DGCLQEGSSEASSLAGHLKLGNLIAIYDDNKITIDGATSISFD-EDVAKRYEAYGWEVLYVENGNEDLAG
2bfcA           EGAASEGDAHAFNFAATLECPIIFFCRNNGYAISTPTSEQYR-GDGIAARGPGYGIMSIRVDGNDVFAVY
1dtwA           EGAASEGDAHAGFNFAATECPIIFFCRNNGYAISTPTSEQYR-GDGIAARGPGYGIMSIRVDGNDVFAVY
1dwlA           ----------------------------------------------------------------------
2bffA           EGAASEGDAHAGFNFAATECPIIFFCRNNGYAISTPTSEQYR-GDGIAARGPGYGIMSIRVDGNDVFAVY
2bfdA           EGAASEGDAHAFNFAATLECPIIFFCRNNGYAISTPTSEQYR-GDGIAARGPGYGIMSIRVDGNDVFAVY
1bc6A           ----------------------------------------------------------------------
1bqxA           ----------------------------------------------------------------------
1a6lA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3c38A           TTPLKGNEPYSLDYVVHSAKDADSFIVGQTFLEVPTYLCVYS----------------------------
2bfeA           EGAASEGDAHAGFNFAATECPIIFFCRNNGYAISTPTSEQYR-GDGIAARGPGYGIMSIRVDGNDVFAVY
2bp7A           DGATAESDFHTALTFAHVYAPVILNVVNNQWAISTFQAIAGGESTTFAGRGVGCGIASLRVDGNDF----
2beuA           EGAASEGDAHAGFNFAATECPIIFFCRNNGYAISTPTSEQYR-GDGIAARGPGYGIMSIRVDGNDVFAVY
1b0vA           ----------------------------------------------------------------------
1bfdA           DGSANYS-ISALWTAAQYNIPTIFVIMNNGTYGALRWFAGVLEAENVRALAKGYGVQALKAD------NL
1b0tA           ----------------------------------------------------------------------
1d3wA           ----------------------------------------------------------------------
3ea4A           DGSFIMN-VQELATIRVENLPVKVLLLNNQHLGMVMQWEDRFYKANRLLFAAACGI--PAARVTKKADLR
2ag1A           DGSVGYS-IGEFDTLVRKQLPLIVIINNQSWGATLHFQQLA--VGPNRVTGTRLENGSYHADGYHVDSVE
1cp9B           IGLHGAGF--NIVGNTPFAYPAILFGHNGHV-SWGSTAGFGDGVDIFAEQVSPEDPNSYLHQ----GQWK
2c3yB           ----------------------------------------------------------------------
1d0cB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EIIKKAVEIVKSGRPAVVVSRRPCALIGVRKARRAGIQLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDR
3dvaE           AAVKAARERAINGEGPTLIETLCFRYGPHTMSGDNE----------------------------------
3dv0E           AAVKAARERAINGEGPTLI---------------------------------------------------
3dv0G           AAVKAARERAINGEGPTLIETLCFRYGPHTDPTNEWAKKDPLVRFRKFLEAKGLWS--------------
2c31A           E------EAVASGKPCLI----------------------------------------------------
3dv0A           AAVKAARERAINGEGPTLI---------------------------------------------------
3dvaA           AAVKAARERAINGEGPTLI---------------------------------------------------
3dv0C           AAVKAARERAING---------------------------------------------------------
2e6kA           KAIKLAKL--------------------------------------------------------------
1clfA           -------------------------------------------KIADSCVSCGACASECPVNAIS-QGDS
1durA           -------------------------------------------VINDSCIACGACKPECPVNCIQ--EGS
2bfbA           NATKEARRRAVAENQPF-----------------------------------------------------
1bluA           -------------------------------------------MITDECINCDVCEPECPNGAISQGDEP
1ay0A           IAKAIAQAKLSKDKPTLIK---------------------------------------------------
2bfcA           NATKEARRRAVAENQPFLI---------------------------------------------------
1dtwA           NATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRHPISRLRHYLLSQGWWD--------------
1dwlA           -------------------------------------------IDHEECIGCESCVELCPEVFAMIDGEE
2bffA           NATKEARRRAVAENQPFLI---------------------------------------------------
2bfdA           NATKEARRRAVAENQPFLI---------------------------------------------------
1bc6A           -------------------------------------------VITEPCIGTKDASCVEVCPVCIHEGED
1bqxA           -----------------------------------------VITEPCIGTKCASCVEVCPVDCIH-EGED
1a6lA           -------------------------------------------VVTDNCIKCKYCDCVEVCPVCFYEGPN
3bk7A           ----------------------------VRKMRIAVI-------DYDKCNGHFLCERVCPVNRMGGEENY
3c38A           ----------------------------------------------------------------------
2bfeA           NATKEARRRAVAENQPFLI---------------------------------------------------
2bp7A           ----------------------------------------------------------------------
2beuA           NATKEARRRAVAENQPFLI---------------------------------------------------
1b0vA           ----------------------------------------FLVIHPDECNDCALCEPECPAQAIFSEDEV
1bfdA           EQLKGSLEALSAKGPVLI----------------------------------------------------
1b0tA           -------------------------------------------VVTDNCIKCKYTKCVEVCPVCFYEGPN
1d3wA           ----------------------------------------------DECIDCALCEPECPAQAIFSEDEV
3ea4A           EAIQTMLD---TPGPYLLDVICPH----------------------------------------------
2ag1A           SFSAALAQALAHNRPACINVA-------------------------------------------------
1cp9B           KMLSRQETLNVKGEQPITF---------------------------------------------------
2c3yB           ----------------------------------------------------------------------
1d0cB           ----------------------KRSGSQAHEERLQEVEAEVASTGTYHLRESELVFGAKQAWRNAPRCSS


                         .         .         .         .         *         .         .:420
query           KAHVDPALCVGCGICAEVCPFNAFKPEGKREAWLELWRQA
3dvaE           ----------------------------------------
3dv0E           ----------------------------------------
3dv0G           ----------------------------------------
2c31A           ----------------------------------------
3dv0A           ----------------------------------------
3dvaA           ----------------------------------------
3dv0C           ----------------------------------------
2e6kA           ----------------------------------------
1clfA           IFVIDADTCIDCGNCANVCPVGAPVQE-------------
1durA           IYAIDADSCIDCGSCASVCPVGAPN---------------
2bfbA           ----------------------------------------
1bluA           SLCTECVGHYETSQCVEVCPVDCIIKDPSHE---------
1ay0A           ----------------------------------------
2bfcA           ----------------------------------------
1dtwA           ----------------------------------------
1dwlA           KVTAPDSTAECAQDAIDACPVEAIS---------------
2bffA           ----------------------------------------
2bfdA           ----------------------------------------
1bc6A           QYYIDPDVCIDCGACEAVCPVSAIYHEDFVPE--------
1bqxA           QYYIDPDVCIDCGACEAVCPVSAHEDFVPEEWKSYIQKNR
1a6lA           FLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQ-----
3bk7A           KPIIQEASCTGCGICVHKCPFNAISIVNLPEQL-------
3c38A           ----------------------------------------
2bfeA           ----------------------------------------
2bp7A           ----------------------------------------
2beuA           ----------------------------------------
1b0vA           PEDMAELAEVWPNITEKKDPLPDAEDWDGVKGKLQH----
1bfdA           ----------------------------------------
1b0tA           FLVIHPDECIDCALCEPECPAQAIFSEDEV----------
1d3wA           PEDMAELAEVWPNITEKKDPLPDAEVKGKLQH--------
3ea4A           ----------------------------------------
2ag1A           ----------------------------------------
1cp9B           ----------------------------------------
2c3yB           ----------------------------------------
1d0cB           AQEMFTYICNHIKYA--TNRGNLRSAITVFPQRAPGRGD-