[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for paer1:AAL65054.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3a1tA.bssp"
#ERROR : Can't open dsspfile "3a1vB.bssp"
#ERROR : Can't open dsspfile "3defA.bssp"
#ERROR : Can't open dsspfile "3eg5B.bssp"
#ERROR : Can't open dsspfile "3a1uB.bssp"
#ERROR : Can't open dsspfile "3a1vA.bssp"
#ERROR : Can't open dsspfile "2e87A.bssp"
#ERROR : Can't open dsspfile "3bc1A.bssp"
#ERROR : Can't open dsspfile "3a1sB.bssp"
#ERROR : Can't open dsspfile "2cxxB.bssp"
#ERROR : Can't open dsspfile "2bkuA.bssp"
#ERROR : Can't open dsspfile "2e9sA.bssp"
#ERROR : Can't open dsspfile "3bfkB.bssp"
#ERROR : Can't open dsspfile "1d5cA.bssp"
#ERROR : Can't open dsspfile "1dpfA.bssp"
#ERROR : Can't open dsspfile "3cbqA.bssp"
#ERROR : Can't open dsspfile "1cluA.bssp"
#ERROR : Can't open dsspfile "3dz8A.bssp"
#ERROR : Can't open dsspfile "2a5fA.bssp"
#ERROR : Can't open dsspfile "2dbyA.bssp"
#ERROR : Can't open dsspfile "3a1uA.bssp"
#ERROR : Can't open dsspfile "1byuA.bssp"
#ERROR : Can't open dsspfile "2dwqB.bssp"
#ERROR : Can't open dsspfile "3bc1E.bssp"
#ERROR : Can't open dsspfile "1a2kE.bssp"
#ERROR : Can't open dsspfile "3doeA.bssp"
#ERROR : Can't open dsspfile "3bh6A.bssp"
#ERROR : Can't open dsspfile "3bbpA.bssp"
#ERROR : Can't open dsspfile "2dykA.bssp"
#ERROR : Can't open dsspfile "1a2kC.bssp"
#ERROR : Can't open dsspfile "2dfkD.bssp"
#ERROR : Can't open dsspfile "3ea5C.bssp"
#ERROR : Can't open dsspfile "2aseA.bssp"
#ERROR : Can't open dsspfile "2bnxA.bssp"
#ERROR : Can't open dsspfile "3cwzA.bssp"
#ERROR : Can't open dsspfile "221pA.bssp"
#ERROR : Can't open dsspfile "3ea5A.bssp"
#ERROR : Can't open dsspfile "2efcB.bssp"
#ERROR : Can't open dsspfile "1an0B.bssp"
#ERROR : Can't open dsspfile "3a1sA.bssp"
#ERROR : Can't open dsspfile "3ddcA.bssp"
#ERROR : Can't open dsspfile "1egaA.bssp"
#ERROR : Can't open dsspfile "1byuB.bssp"
#ERROR : Can't open dsspfile "3bh7A.bssp"
#ERROR : Can't open dsspfile "3bb3A.bssp"
#ERROR : Can't open dsspfile "1cc0A.bssp"
#ERROR : Can't open dsspfile "3e5hA.bssp"
#ERROR : Can't open dsspfile "3c5cA.bssp"
#ERROR : Can't open dsspfile "1ahjB.bssp"
#ERROR : Can't open dsspfile "2bmdA.bssp"
#ERROR : Can't open dsspfile "1e96A.bssp"
#ERROR : Can't open dsspfile "2bcgY.bssp"
#ERROR : Can't open dsspfile "1aipE.bssp"
#ERROR : Can't open dsspfile "2d7cA.bssp"
#ERROR : Can't open dsspfile "1cf4A.bssp"
#ERROR : Can't open dsspfile "3bjiD.bssp"
#ERROR : Can't open dsspfile "1ceeA.bssp"
#ERROR : Can't open dsspfile "2ahjB.bssp"
#ERROR : Can't open dsspfile "2bmeC.bssp"
#ERROR : Can't open dsspfile "2c2hA.bssp"
#ERROR : Can't open dsspfile "2cjwA.bssp"
#ERROR : Can't open dsspfile "2c5lA.bssp"
#ERROR : Can't open dsspfile "1ecrA.bssp"
#ERROR : Can't open dsspfile "2d74A.bssp"
#ERROR : Can't open dsspfile "1a2kD.bssp"
#ERROR : Can't open dsspfile "1a4rA.bssp"
#ERROR : Can't open dsspfile "1egaB.bssp"
#ERROR : Can't open dsspfile "2bmeB.bssp"
#ERROR : Can't open dsspfile "2ahoA.bssp"
#ERROR : Can't open dsspfile "1am4D.bssp"
#ERROR : Can't open dsspfile "121pA.bssp"
#ERROR : Can't open dsspfile "2cldX.bssp"
#ERROR : Can't open dsspfile "2e9sB.bssp"
#ERROR : Can't open dsspfile "3ch5A.bssp"
#ERROR : Can't open dsspfile "2bmjA.bssp"
#ERROR : Can't open dsspfile "2a5dA.bssp"
#ERROR : Can't open dsspfile "1an0A.bssp"
#ERROR : Can't open dsspfile "3c5cB.bssp"
#ERROR : Can't open dsspfile "2aedA.bssp"
#ERROR : Can't open dsspfile "3cb4D.bssp"
#ERROR : Can't open dsspfile "3bfkE.bssp"
#ERROR : Can't open dsspfile "2atxA.bssp"
#ERROR : Can't open dsspfile "1ajeA.bssp"
#ERROR : Can't open dsspfile "3bfkA.bssp"
#ERROR : Can't open dsspfile "1ds6A.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "1aipA.bssp"
#ERROR : Can't open dsspfile "2bvnA.bssp"
#ERROR : Can't open dsspfile "621pA.bssp"
#ERROR : Can't open dsspfile "2bvnB.bssp"
#ERROR : Can't open dsspfile "2cxxC.bssp"
#ERROR : Can't open dsspfile "2b6hA.bssp"
#ERROR : Can't open dsspfile "3bb4A.bssp"
#ERROR : Can't open dsspfile "3degC.bssp"
#ERROR : Can't open dsspfile "2dfkB.bssp"
#ERROR : Can't open dsspfile "1e0sA.bssp"
#ERROR : Can't open dsspfile "3bfkC.bssp"
#ERROR : Can't open dsspfile "1as0A.bssp"
#ERROR : Can't open dsspfile "2atvA.bssp"
#ERROR : Can't open dsspfile "2bmeA.bssp"
#ERROR : Can't open dsspfile "3conA.bssp"
#ERROR : Can't open dsspfile "3cw2B.bssp"
#ERROR : Can't open dsspfile "2c2hB.bssp"
#ERROR : Can't open dsspfile "2ahjD.bssp"
#ERROR : Can't open dsspfile "3eg5A.bssp"
#ERROR : Can't open dsspfile "1bh2A.bssp"
#ERROR : Can't open dsspfile "521pA.bssp"
#ERROR : Can't open dsspfile "1as2A.bssp"
#ERROR : Can't open dsspfile "1b23P.bssp"
#ERROR : Can't open dsspfile "2ce2X.bssp"
#ERROR : Can't open dsspfile "2efhB.bssp"
#ERROR : Can't open dsspfile "2bv3A.bssp"
#ERROR : Can't open dsspfile "2dwqA.bssp"
#ERROR : Can't open dsspfile "2al7A.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "1cipA.bssp"
#ERROR : Can't open dsspfile "1efcA.bssp"
#ERROR : Can't open dsspfile "3chuA.bssp"
#ERROR : Can't open dsspfile "2dy1A.bssp"
#ERROR : Can't open dsspfile "2clsB.bssp"
#ERROR : Can't open dsspfile "3c5cD.bssp"
#ERROR : Can't open dsspfile "1eftA.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "1eexA.bssp"
#ERROR : Can't open dsspfile "1doaA.bssp"
#ERROR : Can't open dsspfile "2bcjQ.bssp"
#ERROR : Can't open dsspfile "1agrA.bssp"

## Summary of PDB Search
:346
    3e-21  24%  3a1tA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    5e-16  20%  3a1vB  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    7e-16  16%  3defA  [x.x.x] T7I23.11 PROTEIN
    2e-15   9%  3eg5B  [x.x.x] PROTEIN DIAPHANOUS HOMOLOG 1
    3e-15  24%  3a1uB  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    5e-14  21%  3a1vA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    1e-13  30%  2e87A  [x.x.x] HYPOTHETICAL PROTEIN PH1320
    2e-12  15%  3bc1A  [x.x.x] RAS-RELATED PROTEIN RAB-27A
    1e-10  24%  3a1sB  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    2e-10  13%  2cxxB  [x.x.x] PROBABLE GTP-BINDING PROTEIN ENGB
    4e-10  16%  2bkuA  [x.x.x] GTP-BINDING NUCLEAR PROTEIN RAN
    7e-10  11%  2e9sA  [x.x.x] RAS-RELATED PROTEIN RAB-6B
    7e-10  14%  3bfkB  [x.x.x] SMALL GTPASE RAB11
    9e-10  12%  1d5cA  [c.37.1] RAB6 GTPASE
    1e-09  11%  1dpfA  [c.37.1] RHOA
    1e-09  11%  3cbqA  [x.x.x] GTP-BINDING PROTEIN REM 2
    1e-09  19%  1cluA  [c.37.1] TRANSFORMING PROTEIN P21/H-RAS-1
    2e-09   8%  3dz8A  [x.x.x] RAS-RELATED PROTEIN RAB-3B
    2e-09  13%  2a5fA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    2e-09  26%  2dbyA  [x.x.x] GTP-BINDING PROTEIN
    3e-09  21%  3a1uA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    4e-09  17%  1byuA  [c.37.1] PROTEIN (GTP-BINDING PROTEIN RAN)
    5e-09  17%  2dwqB  [x.x.x] GTP-BINDING PROTEIN
    6e-09  13%  3bc1E  [x.x.x] RAS-RELATED PROTEIN RAB-27A
    7e-09  15%  1a2kE  [c.37.1] RAN
    9e-09  13%  3doeA  [x.x.x] ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 2
    1e-08  15%  3bh6A  [x.x.x] ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 3
    1e-08  11%  3bbpA  [x.x.x] RAS-RELATED PROTEIN RAB-6A
    1e-08  21%  2dykA  [x.x.x] GTP-BINDING PROTEIN
    2e-08  15%  1a2kC  [c.37.1] RAN
    2e-08  16%  2dfkD  [x.x.x] CELL DIVISION CYCLE 42 ISOFORM 1
    2e-08  19%  3ea5C  [x.x.x] GTP-BINDING NUCLEAR PROTEIN RAN
    2e-08  14%  2aseA  [x.x.x] CELL DIVISION CONTROL PROTEIN 42 HOMOLOG
    2e-08   7%  2bnxA  [x.x.x] DIAPHANOUS PROTEIN HOMOLOG 1
    3e-08  11%  3cwzA  [x.x.x] RAS-RELATED PROTEIN RAB-6A
    3e-08  19%  221pA  [x.x.x] H-RAS P21 PROTEIN
    4e-08  15%  3ea5A  [x.x.x] GTP-BINDING NUCLEAR PROTEIN RAN
    4e-08  13%  2efcB  [x.x.x] SMALL GTP-BINDING PROTEIN-LIKE
    5e-08  19%  1an0B  [c.37.1] CDC42HS-GDP
    5e-08  21%  3a1sA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    5e-08  19%  3ddcA  [x.x.x] GTPASE HRAS
    6e-08  16%  1egaA  [c.37.1 - d.52.3] PROTEIN (GTP-BINDING PROTEIN ERA)
    6e-08  16%  1byuB  [c.37.1] PROTEIN (GTP-BINDING PROTEIN RAN)
    6e-08  15%  3bh7A  [x.x.x] ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 3
    7e-08  14%  3bb3A  [x.x.x] T7I23.11 PROTEIN
    8e-08  13%  1cc0A  [c.37.1] TRANSFORMING PROTEIN RHOA
    8e-08  14%  3e5hA  [x.x.x] RAS-RELATED PROTEIN RAB-28
    8e-08  15%  3c5cA  [x.x.x] RAS-LIKE PROTEIN 12
    9e-08  13%  1ahjB  [b.34.4] NITRILE HYDRATASE (SUBUNIT BETA)
    9e-08  14%  2bmdA  [x.x.x] RAS-RELATED PROTEIN RAB4A
    1e-07  16%  1e96A  [c.37.1] RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
    1e-07  12%  2bcgY  [x.x.x] GTP-BINDING PROTEIN YPT1
    1e-07  20%  1aipE  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    1e-07  14%  2d7cA  [x.x.x] RAS-RELATED PROTEIN RAB-11A
    1e-07  13%  1cf4A  [c.37.1] PROTEIN (CDC42 HOMOLOG)
    1e-07  16%  3bjiD  [x.x.x] RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
    2e-07  15%  1ceeA  [c.37.1] GTP-BINDING RHO-LIKE PROTEIN
    2e-07  13%  2ahjB  [b.34.4] NITRILE HYDRATASE
    2e-07  16%  2bmeC  [x.x.x] RAS-RELATED PROTEIN RAB4A
    3e-07  14%  2c2hA  [x.x.x] RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 3
    3e-07  17%  2cjwA  [x.x.x] GTP-BINDING PROTEIN GEM
    3e-07  16%  2c5lA  [c.37.1 (1he8B)] GTPASE HRAS
    4e-07  10%  1ecrA  [e.2.1] PROTEIN (REPLICATION-TERMINATOR PROTEIN)
    5e-07  13%  2d74A  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    6e-07  16%  1a2kD  [c.37.1] RAN
    7e-07  15%  1a4rA  [c.37.1] G25K GTP-BINDING PROTEIN
    7e-07  16%  1egaB  [c.37.1 - d.52.3] PROTEIN (GTP-BINDING PROTEIN ERA)
    8e-07  16%  2bmeB  [x.x.x] RAS-RELATED PROTEIN RAB4A
    8e-07  12%  2ahoA  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    1e-06  20%  1am4D  [c.37.1] CDC42HS
    2e-06  21%  121pA  [c.37.1 (1bkdR)] H-RAS P21 PROTEIN
    2e-06  18%  2cldX  [x.x.x] GTPASE HRAS
    2e-06  20%  2e9sB  [x.x.x] RAS-RELATED PROTEIN RAB-6B
    2e-06  15%  3ch5A  [x.x.x] GTP-BINDING NUCLEAR PROTEIN RAN
    3e-06  17%  2bmjA  [x.x.x] CENTAURIN GAMMA 1
    3e-06  11%  2a5dA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    3e-06  17%  1an0A  [c.37.1] CDC42HS-GDP
    3e-06  18%  3c5cB  [x.x.x] RAS-LIKE PROTEIN 12
    4e-06  11%  2aedA  [x.x.x] RAS-RELATED PROTEIN RAB-14
    4e-06  18%  3cb4D  [x.x.x] GTP-BINDING PROTEIN LEPA
    4e-06  15%  3bfkE  [x.x.x] SMALL GTPASE RAB11
    4e-06  13%  2atxA  [x.x.x] SMALL GTP BINDING PROTEIN TC10
    4e-06  19%  1ajeA  [x.x.x] CDC42HS
    5e-06  16%  3bfkA  [x.x.x] SMALL GTPASE RAB11
    5e-06  15%  1ds6A  [c.37.1] RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
    6e-06  11%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    6e-06  19%  1aipA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    7e-06  19%  2bvnA  [x.x.x] ELONGATION FACTOR TU
    8e-06  20%  621pA  [x.x.x] H-RAS P21 PROTEIN
    9e-06  17%  2bvnB  [x.x.x] ELONGATION FACTOR TU
    9e-06  13%  2cxxC  [x.x.x] PROBABLE GTP-BINDING PROTEIN ENGB
    1e-05  11%  2b6hA  [x.x.x] ADP-RIBOSYLATION FACTOR 5
    1e-05  13%  3bb4A  [x.x.x] T7I23.11 PROTEIN
    1e-05  13%  3degC  [x.x.x] GTP-BINDING PROTEIN LEPA
    1e-05  14%  2dfkB  [x.x.x] CELL DIVISION CYCLE 42 ISOFORM 1
    2e-05  10%  1e0sA  [c.37.1] ADP-RIBOSYLATION FACTOR 6
    2e-05  14%  3bfkC  [x.x.x] SMALL GTPASE RAB11
    2e-05  15%  1as0A  [x.x.x] GIA1
    2e-05  17%  2atvA  [x.x.x] RAS-LIKE ESTROGEN-REGULATED GROWTH INHIBITOR
    3e-05  12%  2bmeA  [x.x.x] RAS-RELATED PROTEIN RAB4A
    3e-05  21%  3conA  [x.x.x] GTPASE NRAS
    4e-05  12%  3cw2B  [x.x.x] TRANSLATION INITIATION FACTOR 2 SUBUNIT GAMMA
    5e-05  17%  2c2hB  [x.x.x] RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 3
    5e-05  14%  2ahjD  [b.34.4] NITRILE HYDRATASE
    6e-05  16%  3eg5A  [x.x.x] CELL DIVISION CONTROL PROTEIN 42 HOMOLOG
    6e-05  19%  1bh2A  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN
    9e-05  17%  521pA  [x.x.x] H-RAS P21 PROTEIN
    9e-05  15%  1as2A  [x.x.x] GIA1
    1e-04  12%  1b23P  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    1e-04  19%  2ce2X  [x.x.x] GTPASE HRAS
    2e-04  13%  2efhB  [x.x.x] SMALL GTP-BINDING PROTEIN-LIKE
    2e-04  17%  2bv3A  [x.x.x] ELONGATION FACTOR G
    2e-04  20%  2dwqA  [x.x.x] GTP-BINDING PROTEIN
    2e-04  11%  2al7A  [x.x.x] ADP-RIBOSYLATION FACTOR-LIKE 10C
    3e-04  12%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    3e-04  14%  1cipA  [c.37.1 - a.66.1] PROTEIN (GUANINE NUCLEOTIDE-BINDING PROTEIN
    4e-04  14%  1efcA  [c.37.1 - b.43.3 - b.44.1] PROTEIN (ELONGATION FACTOR)
    4e-04  10%  3chuA  [x.x.x] P-AMINOBENZOATE N-OXYGENASE
    5e-04  19%  2dy1A  [x.x.x] ELONGATION FACTOR G
    7e-04   9%  2clsB  [x.x.x] RHO-RELATED GTP-BINDING PROTEIN RHO6
    7e-04  13%  3c5cD  [x.x.x] RAS-LIKE PROTEIN 12
    7e-04  22%  1eftA  [x.x.x] ELONGATION FACTOR TU
    8e-04  17%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    8e-04  11%  1eexA  [c.1.19] PROPANEDIOL DEHYDRATASE
    8e-04  20%  1doaA  [c.37.1] PROTEIN (GTP-BINDING PROTEIN)
    8e-04  15%  2bcjQ  [x.x.x] G ALPHA I1, GUANINE NUCLEOTIDE-BINDING PROTEIN
    0.001  15%  1agrA  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(I)
:346

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxKLPYVYAADELISLFLTTYSREEARGSTAEPAFVKQKRLEIKRIVSSGKAIASILREMALRMP
3a1tA           ----------------------------------------------------------------------
3a1vB           ----------------------------------------------------------------------
3defA           ----------------------------------------------------------------------
3eg5B           -------------------------------------------------RSGLRDMHLLSCLESLSLTSH
3a1uB           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
2e87A           -------ERPTVLTADELIDKAF--------RRAEKAASSFRGNKVKKARLREELRVRTVSNVVRDNRTP
3bc1A           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
2e9sA           ----------------------------------------------------------------------
3bfkB           ----------------------------------------------------------------------
1d5cA           ----------------------------------------------------------------------
1dpfA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
1cluA           ----------------------------------------------------------------------
3dz8A           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2dbyA           ----------------------------------------------------------------------
3a1uA           ----------------------------------------------------------------------
1byuA           ----------------------------------------------------------------------
2dwqB           ----------------------------------------------------------------------
3bc1E           ----------------------------------------------------------------------
1a2kE           ----------------------------------------------------------------------
3doeA           ----------------------------------------------------------------------
3bh6A           ----------------------------------------------------------------------
3bbpA           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
2dfkD           ----------------------------------------------------------------------
3ea5C           ----------------------------------------------------------------------
2aseA           ----------------------------------------------------------------------
2bnxA           -----------------------------------------------------------------SLNNN
3cwzA           ----------------------------------------------------------------------
221pA           ----------------------------------------------------------------------
3ea5A           ----------------------------------------------------------------------
2efcB           ----------------------------------------------------------------------
1an0B           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
3ddcA           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
3bh7A           ----------------------------------------------------------------------
3bb3A           ----------------------------------------------------------------------
1cc0A           ----------------------------------------------------------------------
3e5hA           ----------------------------------------------------------------------
3c5cA           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
2bmdA           ----------------------------------------------------------------------
1e96A           ----------------------------------------------------------------------
2bcgY           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
2d7cA           ----------------------------------------------------------------------
1cf4A           ----------------------------------------------------------------------
3bjiD           ----------------------------------------------------------------------
1ceeA           ----------------------------------------------------------------------
2ahjB           ----------------------------------------------------------------------
2bmeC           ----------------------------------------------------------------------
2c2hA           ----------------------------------------------------------------------
2cjwA           ----------------------------------------------------------------------
2c5lA           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
1a2kD           ----------------------------------------------------------------------
1a4rA           ----------------------------------------------------------------------
1egaB           ----------------------------------------------------------------------
2bmeB           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
1am4D           ----------------------------------------------------------------------
121pA           ----------------------------------------------------------------------
2cldX           ----------------------------------------------------------------------
2e9sB           ----------------------------------------------------------------------
3ch5A           ----------------------------------------------------------------------
2bmjA           ----------------------------------------------------------------------
2a5dA           ----------------------------------------------------------------------
1an0A           ----------------------------------------------------------------------
3c5cB           ----------------------------------------------------------------------
2aedA           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
3bfkE           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
1ajeA           ----------------------------------------------------------------------
3bfkA           ----------------------------------------------------------------------
1ds6A           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
2b6hA           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
3degC           ----------------------------------------------------------------------
2dfkB           ----------------------------------------------------------------------
1e0sA           ----------------------------------------------------------------------
3bfkC           ----------------------------------------------------------------------
1as0A           ----------------------------------------------------------------------
2atvA           ----------------------------------------------------------------------
2bmeA           ----------------------------------------------------------------------
3conA           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
2c2hB           ----------------------------------------------------------------------
2ahjD           ----------------------------------------------------------------------
3eg5A           ----------------------------------------------------------------------
1bh2A           ----------------------------------------------------------------------
521pA           ----------------------------------------------------------------------
1as2A           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
2ce2X           ----------------------------------------------------------------------
2efhB           ----------------------------------------------------------------------
2bv3A           ----------------------------------------------------------------------
2dwqA           ----------------------------------------------------------------------
2al7A           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1cipA           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
3chuA           ----------------------------------------------------------------------
2dy1A           ----------------------------------------------------------------------
2clsB           ----------------------------------------------------------------------
3c5cD           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
1eexA           ------------------------------------------------------FDLIDHFIARYGINLN
1doaA           ----------------------------------------------------------------------
2bcjQ           ----------------------------------------------------------------------
1agrA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FLDRLHPFYRELIDAVIGARAYKHVVAKVGNANLAVKAIAKEAITAVRTAPDKKALLDARRMYKARIIDL
3a1tA           ----------------------------------------------------------------------
3a1vB           ----------------------------------------------------------------------
3defA           ------------------------------------------------------------------FQQF
3eg5B           PVSWVQTFGAEGLASLL------DILKRLHDEKDSRNQHEIIRCLKAFMNNKFGIKTMLETEEGILLLVR
3a1uB           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
2e87A           GLSTLPKFYQELVDVLVDRDTFH-KAAGIDWAIRIIRELEERYVERIRYSNDPNEIAELRRQFYGRVASV
3bc1A           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
2e9sA           ----------------------------------------------------------------------
3bfkB           ----------------------------------------------------------------------
1d5cA           ----------------------------------------------------------------------
1dpfA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
1cluA           ----------------------------------------------------------------------
3dz8A           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2dbyA           ----------------------------------------------------------------------
3a1uA           ----------------------------------------------------------------------
1byuA           ----------------------------------------------------------------------
2dwqB           ----------------------------------------------------------------------
3bc1E           ----------------------------------------------------------------------
1a2kE           ----------------------------------------------------------------------
3doeA           ----------------------------------------------------------------------
3bh6A           ----------------------------------------------------------------------
3bbpA           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
2dfkD           ----------------------------------------------------------------------
3ea5C           ----------------------------------------------------------------------
2aseA           ----------------------------------------------------------------------
2bnxA           PVSWVQTFGAEGLASLLDILKRLHDEKEETSGNYDSRNQHE----------IIRCLKAFMNNKFGIKTML
3cwzA           ----------------------------------------------------------------------
221pA           ----------------------------------------------------------------------
3ea5A           ----------------------------------------------------------------------
2efcB           ----------------------------------------------------------------------
1an0B           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
3ddcA           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
3bh7A           ----------------------------------------------------------------------
3bb3A           ----------------------------------------------------------------------
1cc0A           ----------------------------------------------------------------------
3e5hA           ----------------------------------------------------------------------
3c5cA           ----------------------------------------------------------------------
1ahjB           ---KVPHTVDADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYERMEPRHYMMTPYYERYVIGVATL
2bmdA           ----------------------------------------------------------------------
1e96A           ----------------------------------------------------------------------
2bcgY           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
2d7cA           ----------------------------------------------------------------------
1cf4A           ----------------------------------------------------------------------
3bjiD           ----------------------------------------------------------------------
1ceeA           ----------------------------------------------------------------------
2ahjB           -------------------------------------------------------------EKGILTQDE
2bmeC           ----------------------------------------------------------------------
2c2hA           ----------------------------------------------------------------------
2cjwA           ----------------------------------------------------------------------
2c5lA           ----------------------------------------------------------------------
1ecrA           --------------------------------------------------------------------DL
2d74A           ----------------------------------------------------------------------
1a2kD           ----------------------------------------------------------------------
1a4rA           ----------------------------------------------------------------------
1egaB           ----------------------------------------------------------------------
2bmeB           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
1am4D           ----------------------------------------------------------------------
121pA           ----------------------------------------------------------------------
2cldX           ----------------------------------------------------------------------
2e9sB           ----------------------------------------------------------------------
3ch5A           ----------------------------------------------------------------------
2bmjA           ----------------------------------------------------------------------
2a5dA           ----------------------------------------------------------------------
1an0A           ----------------------------------------------------------------------
3c5cB           ----------------------------------------------------------------------
2aedA           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
3bfkE           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
1ajeA           ----------------------------------------------------------------------
3bfkA           ----------------------------------------------------------------------
1ds6A           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
2b6hA           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
3degC           ----------------------------------------------------------------------
2dfkB           ----------------------------------------------------------------------
1e0sA           ----------------------------------------------------------------------
3bfkC           ----------------------------------------------------------------------
1as0A           ----------------------------------------------------------------------
2atvA           ----------------------------------------------------------------------
2bmeA           ----------------------------------------------------------------------
3conA           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
2c2hB           ----------------------------------------------------------------------
2ahjD           ----------------------------------------------------------------------
3eg5A           ----------------------------------------------------------------------
1bh2A           ----------------------------------------------------------------------
521pA           ----------------------------------------------------------------------
1as2A           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
2ce2X           ----------------------------------------------------------------------
2efhB           ----------------------------------------------------------------------
2bv3A           ----------------------------------------------------------------------
2dwqA           ----------------------------------------------------------------------
2al7A           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1cipA           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
3chuA           ----------------------------------------------------------------------
2dy1A           ----------------------------------------------------------------------
2clsB           ----------------------------------------------------------------------
3c5cD           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
3bb1A           --------------------------------------------------------------TQTKLLEL
1eexA           VMAMDPNVKRSEIVPLTTAMTPAKIVEVVSHMNVVEMMMAMQKMRARRTPSQQAHVTNVKDN---PVQIA
1doaA           ----------------------------------------------------------------------
2bcjQ           ----------------------------------------------------------------------
1agrA           ---------------------------------------------------------DARQLFVLAGAAE


                         +         .         .         .         .         *         .:210
query           LNDLRPELEKMREIVVFLRKLPSIDPELFTIVVAGAPNVGKSSFVRCVSTAKPEVAEYPFTTKQIHLGHI
3a1tA           ---------------------------MVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVF
3a1vB           ---------------------------MVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKK-EVF
3defA           PAATQEKLIEFF------GKLKQKDMNSMTVLVLGKGGVGKSSTVNSLIGEQVRVSPFQAGLR-PVMVSR
3eg5B           AMDPAVPNMMIDA-----------AKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSG
3a1uB           ---------------------------MVKVALAGCPNVGKTSLFNALTGTKQYVANTVEKK----EGVF
3a1vA           ---------------------------MVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVF
2e87A           LRDIDDRLRYLNKAREVLKDLPVVDLEIPTVVIAGHPNVGKSTLLKALTTAKPEIASYPFTTRGINVGQF
3bc1A           ---------------------------LIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRV
3a1sB           -------------------------PLHVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVF
2cxxB           -----------------------------TIIFAGRSNVGKSTLIYRLTGKKVRRKIIEIEWKNHKIIDP
2bkuA           ----------------------------FKLVLVGDGGTGKTTFVKRHLTGEFEKKYVPTLGVEVHPLVF
2e9sA           ----------------------------FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTM
3bfkB           ---------------------------LFKIVLIGDSGVGKSNLLSRFTRDEFNLESKSTIGVEFATKSI
1d5cA           ----------------------------YKLVFLGEQAVGKTSIITRFYDTFDNNYQSTIGIDFLSKTLY
1dpfA           ----------------------------KKLVIVGDVACGKTCLLIVFSKDQFPAVYVPTVFENYVADIE
3cbqA           ---------------------------IFKVMLVGESGVGKSTLAGTFGGLQGDSAHEPENPEDTYERRI
1cluA           ----------------------------YKLVVVGAPGVGKSALTIQLIQNHFVDEDSYRKQVVIDGETC
3dz8A           ------------------NLYFQGNFDMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTV
2a5fA           ----------------------------MRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYK
2dbyA           -----------------------------AVGIVGLPNVGKSTLFNALTRANALAANYPFATIDKNVGVV
3a1uA           ---------------------------MVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVF
1byuA           ---------------------------QFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVPTLGVEVHPLVF
2dwqB           -----------------------------AVGIVGLPNVGKSTLFNALTRANALAKNVGVVPLEDER-LY
3bc1E           ---------------------------LIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRV
1a2kE           ---------------------------QFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVF
3doeA           ---------------------------ELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHR
3bh6A           ----------------------------VRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQ
3bbpA           ----------------------------FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTM
2dykA           ---------------------------MHKVVIVGRPNVGKSSLFNR------------LLKKRSDLKEG
1a2kC           ---------------------------QFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVF
2dfkD           ---------------------------TIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVM
3ea5C           ----------------------------FKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVF
2aseA           ----------------------------IKCVVVGDGAVGKTCLLISYTTNKLPSEYVPTVFDNYAVTVM
2bnxA           ETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSG
3cwzA           ----------------------------FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTM
221pA           ----------------------------YKLVVVGAGGVGKSALTIQLIQNH-------FVDEYDPTIEE
3ea5A           ---------------------------QFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVF
2efcB           ----------------------------AKLVLLGDVGAGKSSLVLRFVKDQFVEFQESTIGAAFFSQTL
1an0B           ----------------------------IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVI
3a1sA           ----------------------------VKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVF
3ddcA           ----------------------------YKLVVVGAGGVGKSALTIQLIQNH-FVEKYDPTIEDSYRKQV
1egaA           ---------------------------CGFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGI
1byuB           ---------------------------QFKLVLVGDGGTGKTTFVKRHLT-------GEFEKKYVPTLGV
3bh7A           ----------------------------VRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQ
3bb3A           ---------------VGFQQFPAATQEKLIEFFGKLKQKDMNSMNSLIGEQVVRVSPFGLRPVMVSRTM-
1cc0A           ----------------------------KKLVIVGDGACGKTCLLIVNSKDQFPEVYVPTVFENYVADIE
3e5hA           ---------------------------QLKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRI
3c5cA           ----------------------------VNLAILGRRGAGKSALTKFLTKRFISEYDPNLEDTYSSEETV
1ahjB           MVEKGILTQDELESLAGGPFPLSESEGRPAPVETTTFEVGQRVRVR--DEYVPGHIRMPAYCRGRVGTIS
2bmdA           ---------------------------LFKFLVIGNAGTGKSCLLHQFIEKKFKEFGSKIINVGGKYVKL
1e96A           -------------------------PQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVM
2bcgY           ---------------------------LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTV
1aipE           ------------------------------VGTIGHVDHGKTTLTAALTTAAENPAHVEYETAKRHY---
2d7cA           ---------------------------LFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSI
1cf4A           ----------------------------IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVM
3bjiD           ----------------------------IKCVVVGDGAVGKTCLLISYTTNAFPGYIPTVFDNYSANVMK
1ceeA           ----------------------------IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVM
2ahjB           LESLAGGPFPLSRPSESEGRP--------APVETTTFEVGQRVRVRDEYVPG--HIRMPAYCRGRVGTIS
2bmeC           ---------------------------LFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKII
2c2hA           ------------------------------CVVVGDGAVGKTCLLISYTTNAFPGDNYSANVMVDGKPVN
2cjwA           ----------------------------YRVVLIGEQGVGKSTLANIFAGVHDSEVLGEDTYERTLMVDG
2c5lA           ----------------------------YKLVVVGAVGVGKSALTIQLIQNH-FVDEYDPTIEDSYRKQV
1ecrA           VDRLNTTFRQMEQELAIFAAHLEQHK-LLVARVFSLPEVKKEDEHVKQHLGNDAQSLALRHFRHLFIQQQ
2d74A           -------------------------QAEVNIGMVGHVDHGKTTLTALTGVWTDTLRRGITIKIGFADAEI
1a2kD           ---------------------------QFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVF
1a4rA           ----------------------------IKCVVVGDVAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVM
1egaB           ---------------------------CGFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGI
2bmeB           ---------------------------LFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKII
2ahoA           --------------------------PEVNIGVVGHVDHGKTTLVQAITGIWTSGMTIKLGYAETNIGVC
1am4D           -------------------------PQTIKCVVVGDGAVGKTCLLISYTTNKFYVPTVFDNYAVTVMIGG
121pA           ----------------------------YKLVVVGAGGVGKSALTIQLIQNH-------FVDEYDPTIED
2cldX           ----------------------------YKLVVVGAGGVGKSALTQLIQNHFVDPTIEDSYRKQVVIDG-
2e9sB           ----------------------------FKLVFLGEQSVGKTSLITRFMYDSFDNDFLSKTMYLEDRTVR
3ch5A           -------------------------PQQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVF
2bmjA           ---------------------------ELRLGVLGDARSGKSSLIHRFLTGSYQVLEKTESEQYKKEMLV
2a5dA           ----------------------------MRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYK
1an0A           ----------------------------IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVI
3c5cB           ----------------------------VNLAILGRRGAGKSALTKFLTKRFISEYDPNLEDTYSSEETV
2aedA           ---------------------------IFKYIIIGDMGVGKSCLLHQFTEKTIGVEFGTRIIEVSGQKIK
3cb4D           ------------------------------------KNIRNFSIIHISTLSDRIIQICGGQSVTLDYKAS
3bfkE           ---------------------------LFKIVLIGDSGVGKSNLLSRFTRDEFNLGVEFATKSIQLKIIK
2atxA           ---------------------------MLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVT
1ajeA           ---------------------------TIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVM
3bfkA           ---------------------------LFKIVLIGDSGVGKSNLLSRFTRDEFNLGVEFATKSIQLNNKI
1ds6A           ----------------------------IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVM
2a78A           ---------------------------LHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVV
1aipA           ------------------------------VGTIGHVDHGKTTLTAAVTAAENPTAHVEYETA-------
2bvnA           -----------------------------NVGTIGHVDHGKTTLTAAITTVLAKTYGARGITINTSHVEY
621pA           ----------------------------YKLVVVGAGGVGKSALTIQLIQNH-FVDEYDPTIEDSYRKQV
2bvnB           ------------------------------VGTIGHVDHGKTTLTAAITTVLAKTYGARGITINTSHVEY
2cxxC           ------------------------------IIFAGRSNVGKSTLIYRLTGKKVRGVTRKIIEIEWKNHKI
2b6hA           ---------------------------QMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYK
3bb4A           ------------------------------VGFQQFPAATQEKLIEFFSTVNSLIGEQVVRVSPFLRVSR
3degC           ---------------------------IRNFSIIAHIDHGKSTLSDRIIQICGGLSDREMEAQVLDSMDQ
2dfkB           ----------------------------IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVM
1e0sA           ---------------------------EMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYK
3bfkC           ---------------------------LFKIVLIGDSGVGKSNLLSRFTRDE-FNLESKGVEFATKSIQL
1as0A           ----------------------------VKLLLLGAVESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYS
2atvA           ----------------------------VKLAIFGRAGVGKSALVVRFLTKRFIWEYDPTLESTYRHQAT
2bmeA           ---------------------------LFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKII
3conA           ----------------------------YKLVVVGAGGVGKSALTIQLIQNHF-VDEYDPTIEDSYRKQV
3cw2B           ---------------------------EVNIGVVGHVDHGKTTLVQAITGIWTSTIKLGYAETNIGVCES
2c2hB           ----------------------------IKCVVVGDGAVGKTCLLSYTTNAFPGEYIDNYSANVMVDGKP
2ahjD           ------------------------------PVETTTFEVGQRVRVRDEYVPGHI--RMPAYCRGRVGTIS
3eg5A           ----------------------------IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVM
1bh2A           ----------------------------VKLLLLGAGESGKSTIVKQM--KIIHEAGYSEEECKQYKAVV
521pA           ----------------------------YKLVVVGAVGVGKSALTIQLIQNHF-VDEYDPTIEDSYRKQV
1as2A           ----------------------------VKLLLLGAVESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYS
1b23P           ------------------KGEFIRTKPHVNVGTIGHVDHGKVEVKDYGDIDKAPEERARGITINTAHVEY
2ce2X           ----------------------------YKLVVVGAGGVGKSALTIQLIQNH-------FVDECDPTIED
2efhB           ----------------------------AKLVLLGDVGAGKSSLVLRFVAAFFSQTLAVNDATVKFEIWD
2bv3A           ---------------------------LRNIGIAAHIDAGKTTTTRILYYTGRI--HKRGITITAAVTTC
2dwqA           ---------------------------MLAVGIVGLPNVGKSTLFNALTRAEDERLYALQRTFAKGERVP
2al7A           ----------------------------MELTLVGLQYSGKTTFVNVIAVGFNMRKVTKGNVTIKIWDIG
3cphA           ---------------------------IMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTV
1cipA           ----------------------------VKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYS
1efcA           ---------------------------------------YGGAARAFDQIDNAPEEKARGITINTSHVEY
3chuA           -----------------------------------------------------------------LGRLV
2dy1A           -----------------------------TVALVGHAGSGKTTLTEATTTDYTPEAKLHRTTVRTGVAPL
2clsB           ----------------------------CKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLE
3c5cD           ----------------------------VNLAILGRRGAGKSALTVKFLTKR-------FISEYDPNLED
1eftA           -----------------------------NVGTIGHVDHGKTTFVTAAENPNVEVKDYGDITINTAHVEY
3bb1A           LGNLKQEDVN-----------------SLTILVMGKGGVGKSSTVNSIIGERVSISPFQSEGPRPVMVSR
1eexA           ADAAEGAWRGFDEQETTVAVARYAPFNAIALLVGSQ----------------------------------
1doaA           ---------------------------TIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVM
2bcjQ           ----------------------------LKLLLLGTGESGKSTFIKQMRIIHGS--GYSDEDKRGFTKLV
1agrA           EGFMTAELAGKDSGVQACFNRSREYQ-LNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTT-GIVETHF


                         .         .         .         +         .         .         .:280
query           FLRGDRVQVIDTPGLLDRPLSERNQIEKQAILALRHLAGVIVFVVDPTPHSGYSLEMQERLWREIKEGFS
3a1tA           TYKGYTINLIDLPGTYSLGYSSIDEKIARDYL-LKGDADLVILVADSV-----NPEQSLYLLLEILE-ME
3a1vB           TYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVA------DSVNPEQSLYLLLEILEM-E
3defA           TMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVLLYVDRLDVYAELDKQVVIAITQTFGKEIW
3eg5B           TSIALKVGCQLINALITPAEELDFRVHIRSELMRLGLHQVLQELREENEDMKVQLCVFDEQGDEDFFDLK
3a1uB           TYKGYTINLIDLPGTYSLGYSSIDEKIARDYL-LKGDADLVILVADSV-----NPEQSLYLLLEILE-ME
3a1vA           TYKGYTINLIDLPG-TYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEK-----
2e87A           EDGYFRYQIIDTPGLLDRPISERNEIEKQAILRYLGNLIIYIFDPSEHCGFPLEEQIHLFEEVHGEFKD-
3bc1A           VYRANGPDGVGRGQRIHLQLWDTAGLERFRSLTTAFFRDGFLLLFDLT--NEQSFLNVRNWISQLQMHAY
3a1sB           TYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVI-LVADSV--------NPEQSLYLLLEILE
2cxxB           GFGFGLPKEVQERIKDEIVHFIEDNAKNIDVAVLVVDGKAAPEIIK-RWEKRGEIPIDVEFYQFLREL-D
2bkuA           HTNR------GPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENI-
2e9sA           YLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQTSKWI-DDVRTERGSDVIIMLV
3bfkB           QLKNNKIIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKKNSFENIEKWLKELRDNADSNIV----
1d5cA           LDEGPVRLQLWDTA-------GQERFRSLIPSYIRDSAAAIVVYDITNRQSFENTTKWIQDILNERGKDV
1dpfA           VDGKQVELALWDTAGQEDYDRARPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPINKKDL
3cbqA           MVDKEEVTLVVYDIWEQGDAGGWLRDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHLPVILV
1cluA           LLDILDTAGQEEYSAMRDQYM-------------RTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDD
3dz8A           YRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILV-
2a5fA           NVKFNVWDVGGQD---------KIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIIN--DREMRD
2dbyA           PVVPTHVEFVDIAGLVK-GAHKGEGLGNQFLAHIRE-VAAIAHVLR------------------------
3a1uA           TYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILA-
1byuA           HTNRGPIKFNVWDTAGQEKFGGLRDGYYIQ-------AQCAIIMFDVTSRVTYKNVPNWHRDLVRVCEN-
2dwqB           ALQRTFAKGERVPPVVPTHFVDIAGLVNQFLAHIRE-VAAIAHVLRCFP---------------------
3bc1E           VYRAGQRIHLQLWDTAGLERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYSEN-----
1a2kE           HTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENI-------
3doeA           GFKLNIWDVGGQK---------SLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLV--EERLAG
3bh6A           GFKLNVWDIGGL---------RKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSC--
3bbpA           YLEDRTVRLQLWDTAGLERFRSLIPSYIRDST------VAVVVYDITNVNSFQQTTKWIDDVRTERGSDV
2dykA           VVETDRGRFLLVDTGGLWSGDKWEKKIQEKVDRALEDAEVVLFAVDGR--AELTQADYEVAEYLRRKGK-
1a2kC           HTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQ-------CAIIMFDVTSRVTYKNVPNWHRDLVRVC-EN
2dfkD           IGGEPYTLGLFDTAGQEDYDRLRPLSYPQTD--------VFLVCFSVVSPSSFENVKEKWVPEITHHCPK
3ea5C           HTNRGPFNVWDTAG-----------QEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCE
2aseA           IGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHTPFLLVGTQIDL
2bnxA           TSIALKVGCLQLI---NALITPAEELDFRVHIRSELMRLGLHQVLQELREIENE-DMKVQLCVFDEQ-GD
3cwzA           YLEDRTVRLQLWDTAGLERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWI-DDVRTERGSDVIIMLV
221pA           SYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDD
3ea5A           HTNRGPIKFNVWDT------AGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENI-
2efcB           AVNDAT------VKFEIWDTAGQERYHSLAPMYYRGAAAAIIVFDVTNQASFERAKKWVQELQAQGNPNM
1an0B           GGEPYTLGLFDTAGQEDYDRLRPLSYPQ---------TDVFLVCFSVVSPSSFENVKEKWVPEITHHCPK
3a1sA           TYKGYTINLIDLPG--------TYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYL-LLEILE
3ddcA           VIDGETCLLD----ILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTK--SFEDIHQYREQIKRVKDSDD
1egaA           HTEGAYQAIYVDTPGLHMEEKRAINRLMNK--AASSSIGDVELVIFVVEGTRWTPDDEMVLNKLREGKA-
1byuB           EVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVC-EN
3bh7A           GFKLNVWDIGGQ---------RKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSC--
3bb3A           --GGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVLLYVDRLDVYR--VDELDKQVVIAITQTFG
1cc0A           VDGKQVELALWDTAGQEDYDRLRPLSYPDTD--------VILMCFSIDSPDSLENIPEKWTPEVKHFCPN
3e5hA           TLPGNLNVTLQIWDIGGQTIGGKMLDKY------IYGAQGVLLVYDITNYQSFENLEDWYTVVKKVSEES
3c5cA           DHQPVHLRVMDTADPRNCERYLNWAH-----------AFLVVYSVDSQSFDSSSSYLELLALHAKETQRS
1ahjB           HRTTEKWPFPDAIGHNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLF----------------------
2bmdA           QIWDTAGQERFRSVTRSY----------------YRGAAGALLVYDITRETYNALTNWLTDARMLASQNI
1e96A           VDGKPVNLGLWDTAGLEDYDRLRPLSYPQTD--------VFLICFSLVSPASFENVRAKWYPEVRHHCPN
2bcgY           ELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWL-QEIDRYATSTVLKLLV
1aipE           -------SHVDCPGHAD--------YIKNMITGAAQ-MDGAILVVSAA--DGPM-PQTREHILLARQVGV
2d7cA           QVDGKTIKAQIWDTAGLERYRAITSAYYRGAV-------GALLVYDIAKHLTYENVERWLKELRDHADSN
1cf4A           IGGEPYTLGLFDTAGLEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGT
3bjiD           PVNLGLWDTAGQEDYDRLRPLSYP----------QTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNT-
1ceeA           IGGEPYTLGLFDTAGQEDYDRLRPLSYPQTD--------VFLVCFSVVPSSFENVKEKWVPEITHHCPKT
2ahjB           HRTTEKWPFPDAIGHGRND-AGEEPTYHVKFAAEELFGSGGSVVVDLF----------------------
2bmeC           NVGGKYVKLQIWDTAGQERF------RSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNI
2c2hA           LGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRH----HCPHTPILLVGTKLD
2cjwA           ESATIILLDMWENEWLHDH--------------CMQVGDAYLIVYSITDRA--SFEKASELRIQLRRARQ
2c5lA           VIDGETCL-------LDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSD
1ecrA           SENRSSKAAVRLPGVLCQVDNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLTLNAYR
2d74A           RRCSNCGRYSTSPICIDSPGHEALMTTMLAGASLMDGAILVIAANEPCPR-----PQTREHLMALQIIGQ
1a2kD           HTNRGPIKFNVWD-------TAGQEKFGGLRDGYYIQAQCAIIMFDVTSR--VTYKNVPNWHRDLVRVCE
1a4rA           IGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLL---
1egaB           HTEGAYQAIYVDTPGLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWT----PDDEMVLNKLREGK
2bmeB           NVGGKYVKLQIWDTAGQERFRSVTRSYYRGA-------AGALLVYDITSRETYNALTNWLTDARMLASQN
2ahoA           ESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGMDGAILVVA--ANEPFPQPQTREHFVALGIIGV
1am4D           EPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLV--------CFSVVSPS-----SFENVKEKWVPEHHCPK
121pA           SYRKQVVIDGETCLL---DILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKDSDD
2cldX           ----------ETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDD
2e9sB           LQLWDTASLIPSYI---------------------RDSTVAVVVYDITNLN--SFQQTSKWIDDVRTERG
3ch5A           HTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQC-------AIIMFDVTSRVTYKNVPNWHRDLVRVCENI
2bmjA           DGQTHLVLIREEAGAPDAKFSGWADAV---------IFVFSLEDEN-------SFQAVSRLHGQLSRGRG
2a5dA           NVKFNVWDVGGQD---------KIRPLWRHYYTGTQGLIFVVDCAD--RDRIDEARQELHRIINDREMRD
1an0A           GGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCP---------K
3c5cB           DHQPVHLRVMDTA--------DLDTPRNCERYLNWAHAFLVVYSVDSRQSFDSSSSYLELLALHAKETQS
2aedA           LQIWDT--------------AVTRSYYRGAA------GALMVYDITRRSTYNHLSSWLTDARNLTNPN-T
3cb4D           DGETYQLNFIDTPG------HVDFSYEVSRSLAACE---GALLVVDAG--QGVEAQTLANCYTAMEMDL-
3bfkE           AQIWDT----------ARAITSAYYRGAVGALLVYDIT---------KKNSFENIEKWLKELRDNADSNI
2atxA           VGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGT
1ajeA           IGGEPYTLGLFDTAGQEDYDRLRPLSYPQT-----DVFLVCFSVVSPS-----SFENVKEKWVPEITHHC
3bfkA           IKAQIWDTAI-------------------TSAYYRGAVGALLVYDITKKNSFENIEKWLKELRDNADSNI
1ds6A           VDSKPVNLGLWDT--------AGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPS
2a78A           LDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVF-SITEMESFAATADFREQILRVKEDENVPFLLV
1aipA           ---KRHYSHVDCPGHADY--------IKNMITGAAQ-MDGAILVVSAADGPMP---QTREHILLARQVGV
2bvnA           DTPTRHYAHVDCPG--HADYV------KNMITGAAQMDGAI-LVVAATDGPMP---QTREHILLGRQVGV
621pA           VIDGETCL------LDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDD
2bvnB           DTPTRHYAHVDCPG--HADYV------KNMITGAAQMDGAILVV----AATDGPMPQTREHILLGRQVGV
2cxxC           IDPGFGFGLPKEVQERIKDEIVHFIEDNAKNIDVAVLVVDGKAAPEIIKRWEKRGEIPIDVEYQFLRELD
2b6hA           NICFTV----------------WDVGRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRD
3bb4A           TMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVLLYVDRLDVYRVDDKQVVIAITQTFGKEIW
3degC           SVTLDYKASDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVD--AGQGVEAQTLANCYTAMEMD--
2dfkB           IGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVHHCPKTPFLLVGTQIDL
1e0sA           NVKFNVWDVGGQDKIRPLWRHYYTG---------TQGLIFVVDCADRDRIDEARQELHRIINDREMRDA-
3bfkC           KNNKIIKAQIWDTAGITSA-------------YYRGAVGALLVYDITKKNSFENIEKWLKELRDNADSNI
1as0A           NTIQSIIAIIRAMGRLK-----------------------------------------------------
2atvA           IDDEVVSMEILDTAGQEDTIQREGHMRWGEG---------FVLVYDITDRG--SFEEVLPLKNILDEIKK
2bmeA           NVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTN-WLTDARMLASQNIVIILC
3conA           VIDGETCL--------LDILDTAGMRTGEG----------FLCVFAINSKSFADINLYREQIKRVKDSDD
3cw2B           CKKPEAYVTEPSCKSCGSDDEPKFLRRISFITMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGV
2c2hB           VNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTK----
2ahjD           HRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGTDGGSVVVDLF----------------------
3eg5A           IGGEPYTLGLFDTAGQEDYDRLRPLSYPQTD--------VFLVCFSVVSPSSFENVKEKWVPEITHHCPK
1bh2A           YSNTIQSAIIRAMGRLK-----------------------------------------------------
521pA           VIDGETCLLDILDTTGQEEYSAMRDQYMRTGEGFLCVFAINNTK---------SFEDIHQYREQIKRVKD
1as2A           NTIQSIIAIIRAMGRLK-----------------------------------------------------
1b23P           ETAKRHYSHVDCPG-HADYIKNMITG--------AAQMDGAILVVSAADGPMP---QTREHILLARQVGV
2ce2X           SYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDD
2efhB           TAGQERYHSLAPMYYRGAA-------------------AAIIVFDVTNQASFERAKKWVQELQAQGNPNM
2bv3A           FWKDHRINIIDAP-----------GHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYK--
2dwqA           PVVPTHVEFVDIAGLV-KGAHKGEGLGNQFLAHIRE-VAAIAHVLRCF----------------------
2al7A           GQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNA------
3cphA           DINGKKVKLQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDME-
1cipA           NTIQSIIAIIRAMGRLKIDFGD------------------------------------------------
1efcA           DTPTRHYAHVDCPGHADY-------VKNMITGAAQMDGAILVVAATDGPM-----PQTREHILLGRQVGV
3chuA           RAWPRRAAVVNKADILD---EWADYDTLVPDYP---LEIVPFAEHPLFL---AAEPHQRQRVLTGMWIGY
2dy1A           LFRGHRVFLLDAPGYGD--------FVGEIRGALEAADAALVAV---SAEAGVQVGTERAWTVAERLGL-
2clsB           TEEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALK--KWRTEILDYCPSTRVLLI
3c5cD           TYSSEETVDHQPVHLRVMDTADL---RNCERYLNWAHAFLVVYSVD-SRQSFDSSSSYLELLALHAKETQ
1eftA           ETAKRHYSHVDCPGHADY--------IKNMITGAAQ-MDGAILVVSAA--DGPMPQTREHILLARQVGVP
3bb1A           SRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKG
1eexA           ----------------------------------------------------------------------
1doaA           I---------------------------------------------------------------------
2bcjQ           YQNIFTAAMIRAMD--------------------------------------------------------
1agrA           TFKDLHFKMFDVGG--------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           APAVAVLNKIDIATEEELEKARAIFAPIGEISTLNCRGTKEVMDYVLQKYYVPAALEKLRAAARGR
3a1tA           KKVILAMTAIDEAKKTGMKIDRYELIPVVFTSSVTGEGLEELKEKIVEYAQKNTILHRM-------
3a1vB           KKVILAMTKKTGMKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQKNTILHRMILDYG--
3defA           CKTLLVLTHAQFSPPDELETFSSKRSDSLLKTIRAGSKMRKQEFEDSAIAVVY-------------
3eg5B           GRLDDIMEMDDFGEVFQINTVKDSKAEPHFLSILQHLLLVRNDYEARPQY--YKLIEEC-------
3a1uB           KKVILAMTAIDEAKKTGMKIDRYELIPVVFTSSVTGEGLEELKEKIVE------------------
3a1vA           -KVILAMTAIDEAKKTGMKIQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQ---------------
2e87A           LPFLVVINKIDVADERLEKFVKEKGLNPIKISALKGTGIDLVKEEIIKTLRPLA------------
3bc1A           PDIVLCGNKSDLEDQRAVKEAEKYGIPYFETSAANGTNISHAIEMLLDL-----------------
3a1sB           EKKVILATAIDEAKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVE------------------
2cxxB           IPTIVAVNKLDKIKNVQEVILSEIDKVFIPISAKFGDNIERLKNRIFEV-----------------
2bkuA           -PIVLCGNKVDIKKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLE---------
2e9sA           GNKTDLADKRQITIEEGEQRAKELSVMFIETSAKTGYNVKQLFRRVASA-----------------
3bfkB           -ILLVGNKSDLINDNDATQYAKKEKLAFIETSALEATNVELAFHQLLNEIYNV-------------
1d5cA           IIALVGNKTDLGKVTYEEGQKAQEYNTFHETSAKAGHNIKVLFKKTASK-----------------
1dpfA           RNDEHTARELAKPAEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRA-----------------
3cbqA           GNKSDLARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQ-----------------
1cluA           VPMVLVGNKCDLASRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVRE-----------------
3dz8A           -----GNKCDMEEERVVPTLAEQLGFDFFEASAKENISVRQAFERLVDA-----------------
2a5fA           AIILIFANKQDIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNY----------------
2dbyA           ------------------------------------------------------------------
3a1uA           ------MTAIDEAKKTGMKIDRYELQPVVFTSSVTGEGLEELKEKIVE------------------
1byuA           IPIVLCGNKVDIKDRKVIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEF--------
2dwqB           ------------------------------------------------------------------
3bc1E           -PDIVLCGNKSVKEEEARELAEKYGIPYFETSAANGTNISHAIEMLLDL-----------------
1a2kE           -PIVLCGNKVDIKKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPAL--
3doeA           ATLLIFANKQDLPGALSSNAIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTADLEH-----
3bh6A           VPVLIFANKQDLLEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKN-----------------
3bbpA           IIMLVGNKTDLADKRQVSIEEGERKAKELETSAKAGYNVKQLFRRVAAA-----------------
2dykA           -PVILVATKVDDPKHEYLGPLYGLFGDPIPTSSEHARGLEELLEAIWER-----------------
1a2kC           IPIVLCGNKVDIKKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLE---------
2dfkD           TPFLLVGTQIDLRDDPSTIARDLKAVKYVECSALTQKGLKNVFDEAILAALEP-------------
3ea5C           IPIVLCGNKVDKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLE---------
2aseA           RDDPSTIEKLATPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILA-----------------
2bnxA           EDFFDLKGRLDDIRFGEVFQIILNTVKDSKAEPHFLSILQHLLLVRNDYEARPQYYKLIEE-----
3cwzA           GNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAA-----------------
221pA           VPMVLVGNKCDVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVRE-----------------
3ea5A           -PIVLCGNKVDIKDRKVKAKSIVFNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEF--------
2efcB           VMALAGNKSDLLDAEDAQTYAQENGLFFMETSAKTATNVKEIFYEIARR-----------------
1an0B           TPFLLVGTQIDLREKLAKNKQKPIAVKYVECSALTQKGLKNVFDEAILAALEE-------------
3a1sA           EKKVILATAIDEAKKTGKIDRYELGIPVVFTSSVTGEGLEELKEKIVEYAQ---------------
3ddcA           VPMVLVGNKCDVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVRE-----------------
1egaA           -PVILAVNKVDNVQHLQFLASQMNFLDIVPISAETGLNVDTIAAIVRKHLPEA-------------
1byuB           IPIVLCGNKVDKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPAL--
3bh7A           VPVLIFANKQDLLTAAPLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKN-----------------
3bb3A           KEIWCVLTHAQFSPPDELETFSSKRSDSLLKTIRAGSKMRKQEFEDSAIA----------------
1cc0A           VPIILVGNKKDLRNDEHTRRELAKAFGYMECSAKTKDGVREVFEMATRAALQA-------------
3e5hA           ETQPLVALVGNKIDLEHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAE-----------------
3c5cA           IPALLLGNKLDMAQYRQVTKAEGVCLFFEVSACLDFEHVQHVFHEAVREAR---------------
1ahjB           ------------------------------------------------------------------
2bmdA           VIILCGNKKDLVTFLEASRFAQENELMFLETSALTGENVEEAFVQCAR--KILNKIESGELDPERM
1e96A           TPIILVGTKLDLRDDKDAMAKEIGAVKYLECSALTQRGLKTVFDEAIRA-----------------
2bcgY           GNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKK
1aipE           PYIVVFMNKVDMVDDPELYEFPGDEVPVIRGSALLALEQMHRNP----------------------
2d7cA           IVILVGNKSDLVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIY---------------
1cf4A           QIDLRDDPSTIEKLAKNKQARDLKAVKYVECSALTQKGLKNVFDEAILA-----------------
3bjiD           -PIILVGTKLDLRDDKKEKKLTPIAVKYLECSALTQRGLKTVFDEAIRA-----------------
1ceeA           PFLLVGTQIDLRDDPSTIEKRDLKAVKYVECSALTQKGLKNVFDEAILAALEP-------------
2ahjB           ------------------------------------------------------------------
2bmeC           VIILCGNKKDLDADREVTFLEASRFLMFLETSALTGENVEEAFVQCARK-----------------
2c2hA           LRDDKDTIERLRDKKGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRA-----------------
2cjwA           IPIILVGNKSDLVRREVSVRAAVVFDKFIETSAAVQHNVKELFEGIVRQ-----------------
2c5lA           DVPMVLVGNKCVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVRE-----------------
1ecrA           TLTVLHDPATLLHRDEVLAQLEKSLKSPRSVAPWTREEWQRKLEREYQDIA---------------
2d74A           KNIIIAQNKIELVDKEKALENYRQI-----------------------------------------
1a2kD           IPIVLCGNKVDKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLE---------
1a4rA           -----VGTQIDLRETAEKLARDLKAVKYVECSALTQKGLKNVFDEAIL--AALEPPEPKKS-----
1egaB           APVILAVNKVDNVQEKADLLPHLQF-----------------------------------------
2bmeB           IVIILCGNKKDLDADREVTFLEASELMFLETSALTGENVEEAFVQCARK-----------------
2ahoA           KNLIIVQNKVDVVSKEEALS----------------------------------------------
1am4D           TPFLLVGTQIDLRDDPSTIERDLKAVKYVECSALTQRGLKNVFDEAILA-----------------
121pA           VPMVLVGNKCDVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVRE-----------------
2cldX           VPMVLVGNKSDLAARTVESRQAQDLARSYETSAKTRQGVEDAFYTLVRE-----------------
2e9sB           VIIMLVGNKTDITIEEGEQRAKELSVMFIETSAKTGYNVKQLFRRVASA-----------------
3ch5A           PIVL-CGNKVDIKDRKVKAKSI--NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLE---------
2bmjA           GLALAVGTQDRGDARARALCADMKRCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQL-------
2a5dA           AIILIFANKQDLPDAMKLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSN-----------------
1an0A           TPFLLVGTQIDLRDDAEKLARDLKAVKYVECSALTQKGLKNVFDEAILA-----------------
3c5cB           IPALLLGNKLDMARQVTKAEGVALAGRFGVSACLDFEHVQHVFHEAVRE-----------------
2aedA           VIILIGNKADLVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKK-----------------
3cb4D           -EVVPVLNKIDLPAAEIEDIVGIDATDAVRCSAKTGVGVQDVLERLV-------------------
3bfkE           VILLVGNKSDLINDNDATQYAKKEKLAFIETSALEATNVELAFHQLLNE-----------------
2atxA           QIDLRDDPKTLARLNDMKEKKEIGACCYVECSALTQKGLKTVFDEAIIAILTP-------------
1ajeA           PPFLLVGTQIDLRDDPSTIERDLKAVKYVECSALTQKGLKNVFDEAILA-----------------
3bfkA           VILLVGNKSDLINDNDATQYAKKEKLAFIETSALEATNVELAFHQLLNE-----------------
1ds6A           TPIILVGTKLDLRDDKDALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCP-------------
2a78A           GNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMRE-----------------
1aipA           PYIVVFMNKVDMVDDPE-------------------------------------------------
2bvnA           PYIIVFLNKCDMVDDEEL------------------------------------------------
621pA           VPMVLVGNKCDLASRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVRE-----------------
2bvnB           PYIIVFLNKCDMVDDEEL------------------------------------------------
2cxxC           IPTIVAVNKLDFLAEKFEVPLSEIDKVFIPISAKFGDNIERLKNRIFEV-----------------
2b6hA           AVLLVFANKQDMPNALGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHE-----------------
3bb4A           CKTLLVLTHAQLSYETFSSKRSDELDSAIAVVYAENSGRCSKNDKDEKEAWIPNLVKAITDVAT--
3degC           LEVVPVLNKIDLPAADP-------------------------------------------------
2dfkB           RDDPSTIEKLATPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEP-------------
1e0sA           -IILIFANKQDLPEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSN-----------------
3bfkC           VILLVGNKSDLKHLRVINDNDATQKLAFIETSALEATNVELAFHQLLNE-----------------
1as0A           ------------------------------------------------------------------
2atvA           PKNVTLIHSRQVSTEEGEKLATELACAFYECSACTGEGNTEIFYELCRE-----------------
2bmeA           GNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARK-----------------
3conA           VPMVLVGNKCDVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVRE-----------------
3cw2B           KNLIIVQNKVDVVSKEEALSQYRQI-----------------------------------------
2c2hB           -LDLRDDKDTITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRA-----------------
2ahjD           ------------------------------------------------------------------
3eg5A           TPFLLVGTQIDLRDDPSTLARDLKAVKYVECSALTQRGLKNVFDEAILA-----------------
1bh2A           ------------------------------------------------------------------
521pA           SDDVPMLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVRE-----------------
1as2A           ------------------------------------------------------------------
1b23P           PYIVVFMNKVDMVDDPE-------------------------------------------------
2ce2X           VPMVLVGNKSDVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVRE-----------------
2efhB           VMALAGNKSDLVTAEDAQTYAQENGLFFMETSAKTATNVKEIFYEIARR-----------------
2bv3A           ------------------------------------------------------------------
2dwqA           ------------------------------------------------------------------
2al7A           ------LDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQH-----------------
3cphA           --------TRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKL-----------------
1cipA           ------------------------------------------------------------------
1efcA           PYIIVFLNKCDMVDDEEL------------------------------------------------
3chuA           NERVIATEQLIAEPAFDLVM----------------------------------------------
2dy1A           -PRMVVVTKLDKGGDYYALLEDLRPIDLPLYEGGKWVGLIDVFHGKAYRYE---------------
2clsB           GCKTDLRTDLSTLMELSHQKQAPIAEIYLEGSAFSEKSIHSIFRTASML-----------------
3c5cD           RSIPALLLGNKLDMAQVALAGRFGCLFFEVSACLDFEHVQHVFHEAVRE-----------------
1eftA           YIVV-FMNKVDMVDDPE-------------------------------------------------
3bb1A           IKAIVALTHAQFSYDEFFSKRSEALLQVVRSGASLKSDIPVVLIENSGRCNKNDSDEKV-------
1eexA           ------------------------------------------------------------------
1doaA           ------------------------------------------------------------------
2bcjQ           ------------------------------------------------------------------
1agrA           ------------------------------------------------------------------