[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for paer1:AAL65069.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2egyC.bssp"
#ERROR : Can't open dsspfile "2douB.bssp"
#ERROR : Can't open dsspfile "2egyD.bssp"
#ERROR : Can't open dsspfile "2egyB.bssp"
#ERROR : Can't open dsspfile "3cbfA.bssp"
#ERROR : Can't open dsspfile "5bj4A.bssp"
#ERROR : Can't open dsspfile "1bjwA.bssp"
#ERROR : Can't open dsspfile "1c8nA.bssp"
#ERROR : Can't open dsspfile "1dtyA.bssp"
#ERROR : Can't open dsspfile "3cq6A.bssp"
#ERROR : Can't open dsspfile "3dydA.bssp"
#ERROR : Can't open dsspfile "3bwoC.bssp"
#ERROR : Can't open dsspfile "3bwnB.bssp"
#ERROR : Can't open dsspfile "2aevA.bssp"
#ERROR : Can't open dsspfile "3d6kA.bssp"
#ERROR : Can't open dsspfile "3d6kB.bssp"
#ERROR : Can't open dsspfile "1bkgA.bssp"
#ERROR : Can't open dsspfile "2cb1A.bssp"
#ERROR : Can't open dsspfile "2douA.bssp"
#ERROR : Can't open dsspfile "1bw0B.bssp"
#ERROR : Can't open dsspfile "5bj3A.bssp"
#ERROR : Can't open dsspfile "2drrA.bssp"
#ERROR : Can't open dsspfile "3ei9B.bssp"
#ERROR : Can't open dsspfile "1b9iA.bssp"
#ERROR : Can't open dsspfile "3d6kC.bssp"
#ERROR : Can't open dsspfile "1b5oA.bssp"
#ERROR : Can't open dsspfile "3dc1B.bssp"
#ERROR : Can't open dsspfile "2cstA.bssp"
#ERROR : Can't open dsspfile "3bwnE.bssp"
#ERROR : Can't open dsspfile "3bwnC.bssp"
#ERROR : Can't open dsspfile "3ei8A.bssp"
#ERROR : Can't open dsspfile "3cq5A.bssp"
#ERROR : Can't open dsspfile "3bmaD.bssp"
#ERROR : Can't open dsspfile "1bqdA.bssp"
#ERROR : Can't open dsspfile "1b5pA.bssp"
#ERROR : Can't open dsspfile "2d5yA.bssp"
#ERROR : Can't open dsspfile "3d6kD.bssp"
#ERROR : Can't open dsspfile "3bwoE.bssp"
#ERROR : Can't open dsspfile "3ei6A.bssp"
#ERROR : Can't open dsspfile "3caeA.bssp"
#ERROR : Can't open dsspfile "2e54A.bssp"
#ERROR : Can't open dsspfile "1dgdA.bssp"
#ERROR : Can't open dsspfile "1b9hA.bssp"
#ERROR : Can't open dsspfile "3bwoA.bssp"
#ERROR : Can't open dsspfile "3dc1D.bssp"
#ERROR : Can't open dsspfile "3bwnF.bssp"
#ERROR : Can't open dsspfile "3eiaB.bssp"
#ERROR : Can't open dsspfile "3cogD.bssp"
#ERROR : Can't open dsspfile "2bwnD.bssp"
#ERROR : Can't open dsspfile "3dxvA.bssp"
#ERROR : Can't open dsspfile "3cq4A.bssp"
#ERROR : Can't open dsspfile "1agxA.bssp"
#ERROR : Can't open dsspfile "2cfbA.bssp"
#ERROR : Can't open dsspfile "1djuA.bssp"
#ERROR : Can't open dsspfile "3dzzB.bssp"
#ERROR : Can't open dsspfile "1ay4A.bssp"
#ERROR : Can't open dsspfile "3cq4B.bssp"
#ERROR : Can't open dsspfile "3bwoD.bssp"
#ERROR : Can't open dsspfile "3drdA.bssp"
#ERROR : Can't open dsspfile "3bs8A.bssp"
#ERROR : Can't open dsspfile "1bw0A.bssp"
#ERROR : Can't open dsspfile "2dkjA.bssp"
#ERROR : Can't open dsspfile "1d7uA.bssp"
#ERROR : Can't open dsspfile "3dydB.bssp"
#ERROR : Can't open dsspfile "1ay4B.bssp"
#ERROR : Can't open dsspfile "3b5oA.bssp"
#ERROR : Can't open dsspfile "3bh1C.bssp"
#ERROR : Can't open dsspfile "3e6gD.bssp"
#ERROR : Can't open dsspfile "3aatA.bssp"
#ERROR : Can't open dsspfile "3bwoF.bssp"
#ERROR : Can't open dsspfile "3dzzA.bssp"
#ERROR : Can't open dsspfile "3eiaA.bssp"
#ERROR : Can't open dsspfile "3ei7B.bssp"
#ERROR : Can't open dsspfile "3e6gA.bssp"
#ERROR : Can't open dsspfile "1czcA.bssp"
#ERROR : Can't open dsspfile "1aiaA.bssp"
#ERROR : Can't open dsspfile "3b46A.bssp"
#ERROR : Can't open dsspfile "2aeuA.bssp"
#ERROR : Can't open dsspfile "3cogB.bssp"
#ERROR : Can't open dsspfile "3e6gB.bssp"
#ERROR : Can't open dsspfile "1bqaA.bssp"
#ERROR : Can't open dsspfile "2d64A.bssp"
#ERROR : Can't open dsspfile "3bwnD.bssp"
#ERROR : Can't open dsspfile "3cq5B.bssp"
#ERROR : Can't open dsspfile "3ei7A.bssp"
#ERROR : Can't open dsspfile "1eg5A.bssp"
#ERROR : Can't open dsspfile "2byjA.bssp"
#ERROR : Can't open dsspfile "2e7uA.bssp"
#ERROR : Can't open dsspfile "2bhxB.bssp"
#ERROR : Can't open dsspfile "1asfA.bssp"
#ERROR : Can't open dsspfile "3ei6B.bssp"
#ERROR : Can't open dsspfile "1arsA.bssp"
#ERROR : Can't open dsspfile "1eghA.bssp"
#ERROR : Can't open dsspfile "1aheA.bssp"
#ERROR : Can't open dsspfile "1akaA.bssp"
#ERROR : Can't open dsspfile "2bwoD.bssp"
#ERROR : Can't open dsspfile "2c7tA.bssp"
#ERROR : Can't open dsspfile "2dgmC.bssp"
#ERROR : Can't open dsspfile "2aatA.bssp"
#ERROR : Can't open dsspfile "1djuB.bssp"
#ERROR : Can't open dsspfile "3ei9A.bssp"
#ERROR : Can't open dsspfile "2btwA.bssp"
#ERROR : Can't open dsspfile "1c7nA.bssp"
#ERROR : Can't open dsspfile "2bwpA.bssp"
#ERROR : Can't open dsspfile "1cs1A.bssp"
#ERROR : Can't open dsspfile "3bwoB.bssp"
#ERROR : Can't open dsspfile "2dgmB.bssp"
#ERROR : Can't open dsspfile "1arhA.bssp"
#ERROR : Can't open dsspfile "3b8xB.bssp"
#ERROR : Can't open dsspfile "2e7jA.bssp"
#ERROR : Can't open dsspfile "1c4kA.bssp"
#ERROR : Can't open dsspfile "3bcaA.bssp"
#ERROR : Can't open dsspfile "1ajsA.bssp"
#ERROR : Can't open dsspfile "3bcbA.bssp"
#ERROR : Can't open dsspfile "3bwnA.bssp"
#ERROR : Can't open dsspfile "3banA.bssp"
#ERROR : Can't open dsspfile "3e2fA.bssp"
#ERROR : Can't open dsspfile "2c81A.bssp"
#ERROR : Can't open dsspfile "7aatA.bssp"
#ERROR : Can't open dsspfile "2btwB.bssp"
#ERROR : Can't open dsspfile "1aamA.bssp"
#ERROR : Can't open dsspfile "1eg5B.bssp"
#ERROR : Can't open dsspfile "1d2fA.bssp"
#ERROR : Can't open dsspfile "3bcxB.bssp"
#ERROR : Can't open dsspfile "3d19E.bssp"
#ERROR : Can't open dsspfile "3dc1A.bssp"
#ERROR : Can't open dsspfile "2bieB.bssp"
#ERROR : Can't open dsspfile "2bkwA.bssp"
#ERROR : Can't open dsspfile "1ariA.bssp"
#ERROR : Can't open dsspfile "1d2fB.bssp"
#ERROR : Can't open dsspfile "2bwoA.bssp"
#ERROR : Can't open dsspfile "3ecdA.bssp"
#ERROR : Can't open dsspfile "1ajrA.bssp"
#ERROR : Can't open dsspfile "3bc8A.bssp"
#ERROR : Can't open dsspfile "3bn1A.bssp"
#ERROR : Can't open dsspfile "2dgmA.bssp"
#ERROR : Can't open dsspfile "2d61A.bssp"
#ERROR : Can't open dsspfile "2ctzA.bssp"
#ERROR : Can't open dsspfile "2eh6A.bssp"
#ERROR : Can't open dsspfile "2dgkC.bssp"
#ERROR : Can't open dsspfile "1b8gB.bssp"
#ERROR : Can't open dsspfile "2bwnE.bssp"
#ERROR : Can't open dsspfile "3ecqA.bssp"
#ERROR : Can't open dsspfile "1ecxA.bssp"
#ERROR : Can't open dsspfile "1asbA.bssp"
#ERROR : Can't open dsspfile "3b8xA.bssp"
#ERROR : Can't open dsspfile "1e5eB.bssp"
#ERROR : Can't open dsspfile "3e2yA.bssp"
#ERROR : Can't open dsspfile "3dr4C.bssp"
#ERROR : Can't open dsspfile "2d66A.bssp"
#ERROR : Can't open dsspfile "3d19A.bssp"
#ERROR : Can't open dsspfile "3dxvB.bssp"
#ERROR : Can't open dsspfile "2cy8A.bssp"
#ERROR : Can't open dsspfile "1b8gA.bssp"
#ERROR : Can't open dsspfile "2bwnA.bssp"
#ERROR : Can't open dsspfile "1ecxB.bssp"
#ERROR : Can't open dsspfile "1bybA.bssp"
#ERROR : Can't open dsspfile "1cl1A.bssp"
#ERROR : Can't open dsspfile "2dr1B.bssp"
#ERROR : Can't open dsspfile "2bwpB.bssp"
#ERROR : Can't open dsspfile "3e9kA.bssp"
#ERROR : Can't open dsspfile "3dr4D.bssp"
#ERROR : Can't open dsspfile "2e3zB.bssp"
#ERROR : Can't open dsspfile "1c7gA.bssp"
#ERROR : Can't open dsspfile "1b4xA.bssp"
#ERROR : Can't open dsspfile "2bfgA.bssp"
#ERROR : Can't open dsspfile "1ejiA.bssp"
#ERROR : Can't open dsspfile "1cj0A.bssp"
#ERROR : Can't open dsspfile "3bb8A.bssp"
#ERROR : Can't open dsspfile "3bzsA.bssp"
#ERROR : Can't open dsspfile "3caiA.bssp"
#ERROR : Can't open dsspfile "1b93B.bssp"
#ERROR : Can't open dsspfile "1eh9A.bssp"
#ERROR : Can't open dsspfile "3bv0B.bssp"
#ERROR : Can't open dsspfile "3ecdD.bssp"
#ERROR : Can't open dsspfile "3cc1B.bssp"
#ERROR : Can't open dsspfile "1a47A.bssp"
#ERROR : Can't open dsspfile "2ckrA.bssp"
#ERROR : Can't open dsspfile "3ecdC.bssp"
#ERROR : Can't open dsspfile "1bs0A.bssp"
#ERROR : Can't open dsspfile "2dr1A.bssp"
#ERROR : Can't open dsspfile "3bcxA.bssp"
#ERROR : Can't open dsspfile "3bn1D.bssp"
#ERROR : Can't open dsspfile "3bh1D.bssp"
#ERROR : Can't open dsspfile "2bhzA.bssp"
#ERROR : Can't open dsspfile "1bjnA.bssp"
#ERROR : Can't open dsspfile "1cguA.bssp"
#ERROR : Can't open dsspfile "3bmvA.bssp"
#ERROR : Can't open dsspfile "2dgmE.bssp"
#ERROR : Can't open dsspfile "1ei7A.bssp"

## Summary of PDB Search
:315
    8e-16  18%  2egyC  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    6e-15  23%  2douB  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    3e-14  14%  2egyD  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    8e-14  19%  2egyB  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    2e-13  17%  3cbfA  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    3e-13  22%  5bj4A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    8e-13  21%  1bjwA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-12  10%  1c8nA  [b.121.4] COAT PROTEIN
    2e-12  12%  1dtyA  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    3e-12  16%  3cq6A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    5e-12  19%  3dydA  [x.x.x] TYROSINE AMINOTRANSFERASE
    5e-12  16%  3bwoC  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    8e-12  16%  3bwnB  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    9e-12  13%  2aevA  [x.x.x] HYPOTHETICAL PROTEIN MJ0158
    2e-11  14%  3d6kA  [x.x.x] PUTATIVE AMINOTRANSFERASE
    3e-11  13%  3d6kB  [x.x.x] PUTATIVE AMINOTRANSFERASE
    3e-11  21%  1bkgA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    4e-11  20%  2cb1A  [x.x.x] O-ACETYL HOMOSERINE SULFHYDRYLASE
    4e-11  24%  2douA  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    5e-11  17%  1bw0B  [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    1e-10  21%  5bj3A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    1e-10   8%  2drrA  [x.x.x] XYLANASE Y
    1e-10  19%  3ei9B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    1e-10  17%  1b9iA  [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    2e-10  13%  3d6kC  [x.x.x] PUTATIVE AMINOTRANSFERASE
    2e-10  23%  1b5oA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    4e-10  19%  3dc1B  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    4e-10  12%  2cstA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    5e-10  15%  3bwnE  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    5e-10  15%  3bwnC  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    5e-10  19%  3ei8A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    6e-10  15%  3cq5A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    7e-10   9%  3bmaD  [x.x.x] D-ALANYL-LIPOTEICHOIC ACID SYNTHETASE
    8e-10  15%  1bqdA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    8e-10  21%  1b5pA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    1e-09  12%  2d5yA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    1e-09  14%  3d6kD  [x.x.x] PUTATIVE AMINOTRANSFERASE
    1e-09  17%  3bwoE  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    1e-09  15%  3ei6A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-09  11%  3caeA  [x.x.x] ENDODEOXYRIBONUCLEASE 1
    2e-09  12%  2e54A  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    3e-09  13%  1dgdA  [x.x.x] DIALKYLGLYCINE DECARBOXYLASE
    3e-09  17%  1b9hA  [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    4e-09  15%  3bwoA  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    4e-09  19%  3dc1D  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    4e-09  16%  3bwnF  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    4e-09  17%  3eiaB  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    4e-09   9%  3cogD  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    4e-09  12%  2bwnD  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    4e-09  12%  3dxvA  [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
    4e-09  15%  3cq4A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    5e-09  10%  1agxA  [x.x.x] GLUTAMINASE-ASPARAGINASE
    6e-09  15%  2cfbA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    7e-09  19%  1djuA  [c.67.1] AROMATIC AMINOTRANSFERASE
    7e-09  14%  3dzzB  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    7e-09  14%  1ay4A  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    8e-09  14%  3cq4B  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    9e-09  17%  3bwoD  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    9e-09  12%  3drdA  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    1e-08  11%  3bs8A  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    1e-08  16%  1bw0A  [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    1e-08  11%  2dkjA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE
    1e-08  14%  1d7uA  [c.67.1] PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE
    2e-08  20%  3dydB  [x.x.x] TYROSINE AMINOTRANSFERASE
    2e-08  14%  1ay4B  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    2e-08  10%  3b5oA  [x.x.x] CADD-LIKE PROTEIN OF UNKNOWN FUNCTION
    2e-08  10%  3bh1C  [x.x.x] UPF0371 PROTEIN DIP2346
    2e-08  18%  3e6gD  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    3e-08  13%  3aatA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    3e-08  17%  3bwoF  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    3e-08  14%  3dzzA  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    3e-08  16%  3eiaA  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    3e-08  20%  3ei7B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    3e-08  24%  3e6gA  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    4e-08  16%  1czcA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    4e-08  14%  1aiaA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    6e-08  15%  3b46A  [x.x.x] AMINOTRANSFERASE BNA3
    6e-08  16%  2aeuA  [x.x.x] HYPOTHETICAL PROTEIN MJ0158
    6e-08  10%  3cogB  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    7e-08  17%  3e6gB  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    7e-08  15%  1bqaA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    7e-08  14%  2d64A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    7e-08  16%  3bwnD  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    8e-08  15%  3cq5B  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    8e-08  20%  3ei7A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    8e-08  12%  1eg5A  [c.67.1] AMINOTRANSFERASE
    1e-07  11%  2byjA  [x.x.x] ORNITHINE AMINOTRANSFERASE
    1e-07  15%  2e7uA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    1e-07   8%  2bhxB  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    1e-07  16%  1asfA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    1e-07  16%  3ei6B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-07  14%  1arsA  [c.67.1 (1argA)] ASPARTATE AMINOTRANSFERASE
    2e-07   9%  1eghA  [c.24.1] METHYLGLYOXAL SYNTHASE
    2e-07  16%  1aheA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-07  12%  1akaA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    3e-07  12%  2bwoD  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    3e-07  12%  2c7tA  [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
    4e-07  15%  2dgmC  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    4e-07  15%  2aatA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    4e-07  21%  1djuB  [c.67.1] AROMATIC AMINOTRANSFERASE
    4e-07  17%  3ei9A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    4e-07  13%  2btwA  [x.x.x] ALR0975 PROTEIN
    5e-07  14%  1c7nA  [c.67.1] CYSTALYSIN
    5e-07  12%  2bwpA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    5e-07  16%  1cs1A  [c.67.1] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
    5e-07  16%  3bwoB  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    6e-07  15%  2dgmB  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    6e-07  13%  1arhA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    6e-07  17%  3b8xB  [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
    7e-07   9%  2e7jA  [x.x.x] SEP-TRNA:CYS-TRNA SYNTHASE
    8e-07   9%  1c4kA  [c.23.1 - c.67.1 - d.125.1] PROTEIN (ORNITHINE DECARBOXYLASE)
    8e-07  10%  3bcaA  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    1e-06  12%  1ajsA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    1e-06  11%  3bcbA  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    1e-06  15%  3bwnA  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    1e-06  14%  3banA  [x.x.x] D-MANNONATE DEHYDRATASE
    1e-06  13%  3e2fA  [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
    1e-06  10%  2c81A  [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
    1e-06  12%  7aatA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-06  12%  2btwB  [x.x.x] ALR0975 PROTEIN
    2e-06  14%  1aamA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    2e-06  11%  1eg5B  [c.67.1] AMINOTRANSFERASE
    2e-06  16%  1d2fA  [c.67.1] MALY PROTEIN
    2e-06  21%  3bcxB  [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
    3e-06  10%  3d19E  [x.x.x] CONSERVED METALLOPROTEIN
    3e-06  17%  3dc1A  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    3e-06   8%  2bieB  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    3e-06   8%  2bkwA  [x.x.x] ALANINE-GLYOXYLATE AMINOTRANSFERASE 1
    3e-06  17%  1ariA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    3e-06  18%  1d2fB  [c.67.1] MALY PROTEIN
    3e-06  11%  2bwoA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    3e-06  14%  3ecdA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    4e-06  10%  1ajrA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    4e-06  11%  3bc8A  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    4e-06  18%  3bn1A  [x.x.x] PEROSAMINE SYNTHETASE
    9e-06  15%  2dgmA  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    9e-06  14%  2d61A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    1e-05  22%  2ctzA  [x.x.x] O-ACETYL-L-HOMOSERINE SULFHYDRYLASE
    1e-05  11%  2eh6A  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    1e-05  15%  2dgkC  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    1e-05  15%  1b8gB  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    1e-05  11%  2bwnE  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    1e-05  16%  3ecqA  [x.x.x] ENDO-ALPHA-N-ACETYLGALACTOSAMINIDASE
    1e-05  13%  1ecxA  [c.67.1] AMINOTRANSFERASE
    2e-05  15%  1asbA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    2e-05  16%  3b8xA  [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
    2e-05  18%  1e5eB  [c.67.1] METHIONINE GAMMA-LYASE
    2e-05  20%  3e2yA  [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
    2e-05  16%  3dr4C  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    2e-05  15%  2d66A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    2e-05   9%  3d19A  [x.x.x] CONSERVED METALLOPROTEIN
    2e-05  14%  3dxvB  [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
    3e-05  20%  2cy8A  [x.x.x] D-PHENYLGLYCINE AMINOTRANSFERASE
    3e-05  14%  1b8gA  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    4e-05  12%  2bwnA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    4e-05  12%  1ecxB  [c.67.1] AMINOTRANSFERASE
    5e-05  10%  1bybA  [x.x.x] BETA-AMYLASE
    5e-05   9%  1cl1A  [c.67.1] CYSTATHIONINE BETA-LYASE
    5e-05  13%  2dr1B  [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE
    5e-05  13%  2bwpB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    6e-05  14%  3e9kA  [x.x.x] KYNURENINASE
    8e-05  10%  3dr4D  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    8e-05  17%  2e3zB  [x.x.x] BETA-GLUCOSIDASE
    1e-04   7%  1c7gA  [c.67.1] TYROSINE PHENOL-LYASE
    1e-04  18%  1b4xA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    1e-04   7%  2bfgA  [x.x.x] BETA-XYLOSIDASE
    1e-04  18%  1ejiA  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    1e-04  18%  1cj0A  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    1e-04  12%  3bb8A  [x.x.x] CDP-4-KETO-6-DEOXY-D-GLUCOSE-3-DEHYDRASE
    1e-04  15%  3bzsA  [x.x.x] ESCU
    1e-04  11%  3caiA  [x.x.x] POSSIBLE AMINOTRANSFERASE
    2e-04   8%  1b93B  [c.24.1] PROTEIN (METHYLGLYOXAL SYNTHASE)
    2e-04  16%  1eh9A  [b.1.18 - c.1.8 - b.71.1] GLYCOSYLTREHALOSE TREHALOHYDROLASE
    2e-04  12%  3bv0B  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-04  14%  3ecdD  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    2e-04  12%  3cc1B  [x.x.x] PUTATIVE ALPHA-N-ACETYLGALACTOSAMINIDASE
    3e-04  12%  1a47A  [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE
    3e-04  10%  2ckrA  [x.x.x] ENDOGLUCANASE E-5
    3e-04  14%  3ecdC  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    4e-04  14%  1bs0A  [c.67.1] PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)
    4e-04  14%  2dr1A  [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE
    4e-04  11%  3bcxA  [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
    4e-04  13%  3bn1D  [x.x.x] PEROSAMINE SYNTHETASE
    4e-04  13%  3bh1D  [x.x.x] UPF0371 PROTEIN DIP2346
    4e-04  23%  2bhzA  [x.x.x] MALTOOLIGOSYLTREHALOSE TREHALOHYDROLASE
    5e-04   8%  1bjnA  [c.67.1] PHOSPHOSERINE AMINOTRANSFERASE
    6e-04  12%  1cguA  [x.x.x] CYCLODEXTRIN GLYCOSYL-TRANSFERASE
    8e-04  10%  3bmvA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    8e-04  13%  2dgmE  [c.67.1 (1pmmA)] GLUTAMATE DECARBOXYLASE BETA
    9e-04  18%  1ei7A  [a.24.5] COAT PROTEIN
:315

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVLIELYDIPRQNLAIVSGAQEGNFLAFLAVK
2egyC           ----------------------------------------VAEWIGVRPEEVLITTGSQQALDLVGKVFL
2douB           --------------------------------------------------EALALIGSQEGLAHLLLALT
2egyD           ----------------------------------------VAEWIGVRPEEVLITTGSQQALDLVGKVFL
2egyB           ----------------------------------------VAEWIGVRPEEVLITTGSQQALDLVGKVFL
3cbfA           ----------------------------------------VAEWIGVRPEEVLITTGSQQALDLVGFLDE
5bj4A           ----------------------------------------------VTPEETIVTVGGSQALFNLFQAIP
1bjwA           ---------------------------------------------------TIVTVGGKQALFNLFQAIL
1c8nA           --------------------------------------------------NLTPIALAYTVQSLPLIATQ
1dtyA           --------------------------------------------KGEARDRFLTFRNGYHGDTFGAMSVP
3cq6A           --------------------------------------------VAVTRDNLWAANGSNEILQQLLQAFG
3dydA           ----------------------------------------------LEAKDVILTSGCSQAIDLCLAVLA
3bwoC           --------------------------------------------AATEDRYIVVGTGSTQLCQAAVHALS
3bwnB           --------------------------------------------AATEDRYIVVGTGSTQLCQAAVHALS
2aevA           ------------------------------------------HLGGDENDKCVGFNRTSSAILATILALK
3d6kA           ----------------------------------------------------------------------
3d6kB           -------------------------------------------------FDLISWSYTWGNNDSSRPWSE
1bkgA           ---------------------------------------------SVTPEETIVTVGGKQALFNLFILDP
2cb1A           -----------------------------------------------------VLASGQAATFAALLALR
2douA           -----------------------------------------------PRREALALIGSQEGLAHLLLALT
1bw0B           --------------------------------------------------NVVLCSGGSHGILMAIICDA
5bj3A           -----------------------------------------------------VTVGGSQALFNLFILDP
2drrA           --------------------------------------------HRWGDGDEQPFNYSEQARKLLHTCVH
3ei9B           ----------------------------------------------------------------------
1b9iA           ---------------------------------------------------LAVTNGTHALELALQVMGV
3d6kC           ----------------------------------------------------------------------
1b5oA           -----------------------------------------------------VTVGGSQALFNLFQAIP
3dc1B           ----------------------------------------------------------------------
2cstA           ----------------------------------------------------------------------
3bwnE           --------------------------------------------AATEDRYIVVGTGSTQLCQAAVHALS
3bwnC           --------------------------------------------AATEDRYIVVGTGSTQLCQAAVHALQ
3ei8A           ----------------------------------------------------------------------
3cq5A           --------------------------------------------VAVTRDNLWAANGSNEILQQLLQAFG
3bmaD           ------------------------------------------EKYNRSYRPYLLGQGGAASLNQYFGMLE
1bqdA           ----------------------------------------------------------------------
1b5pA           -----------------------------------------------------VTVGGSQALFNLFILDP
2d5yA           -----------------------------------------------SVKRVWVSNPSWPNHKSVFNSAG
3d6kD           ---------------------------------------------------------------RPWSAEE
3bwoE           --------------------------------------------AATEDRYIVVGTGSTQLCQAAVHALS
3ei6A           ----------------------------------------FYGGLGIGDDDVFVSDGAKCDISRLQVMFG
3caeA           ---------------------------------------------EDKVSKQLESKGIKFEYEEWKVPYS
2e54A           -----------------------------------------------------FANTGTEANEAAIKIAK
1dgdA           ----------------------------------------------------------------------
1b9hA           ---------------------------------------------------LAVTNGTHALELALQVMGV
3bwoA           ---------------------------------------------ATEDRYIVVGTGSTQLCQAAVHALS
3dc1D           ----------------------------------------------------------------------
3bwnF           ---------------------------------------------ATEDRYIVVGTGSTQLCQAAVHALQ
3eiaB           ----------------------------------------FYGGLGIGDDDVFVSDGAKCDISRLQVMFG
3cogD           ----------------------------------------------------CLAFASGLAATVTITHLA
2bwnD           -----------------------------------------------------VFSSAYNANDATLLRVL
3dxvA           ------------------------------------------SFPGEGTHKIWFGHSGSDANEAAYRAIG
3cq4A           --------------------------------------------VAVTRDNLWAANGSNEILQQLLQAFP
1agxA           ----------------------------------------------------------------------
2cfbA           -------------------------------------------------------NSGTEACMAVLLMRA
1djuA           ----------------------------------------QNGIEADPKTEIMVLLGANQAFLMGLSAFL
3dzzB           --------------------------------------------ARPKEDWCVFASGVVPAISAVRQFTS
1ay4A           ------------------------------------------------------------RQALELARMP
3cq4B           --------------------------------------------VAVTRDNLWAANGSNEILQQLLQAFG
3bwoD           --------------------------------------------AATEDRYIVVGTGSTQLCQAAVHALS
3drdA           ----------------------------------------------------------------------
3bs8A           ----------------------------------------------------------------------
1bw0A           -------------------------------------------------DNVVLCSGGSHGILMAITAIC
2dkjA           ------------------------------------------------AWANVQPHSGSQANMAVYMALP
1d7uA           ----------------------------------------------------------------------
3dydB           ----------------------------------------------LEAKDVILTSGCSQAIDLCLLANP
1ay4B           ----------------------------------------------------------------------
3b5oA           --------------------------------------------YSIFPKELVGFTERRKALGAGWNGVA
3bh1C           ----------------------------------------------------------------------
3e6gD           -----------------------------------------------------AFASGMAATSTVMELLD
3aatA           ----------------------------------------GSALINDKRARTAQTPGGTGALRVAADFLA
3bwoF           --------------------------------------------AATEDRYIVVGTGSTQLCQAAVHALQ
3dzzA           --------------------------------------------------WCVFASGVVPAISAVRQFTS
3eiaA           ----------------------------------------FYGGLGIGDDDVFVSDGAKCDISRLQVMFG
3ei7B           ----------------------------------------------------------------------
3e6gA           ----------------------------------------------------------------------
1czcA           ------------------------------------------ALINDKRARTAQTPGGTGALRVAADFLA
1aiaA           -------------------------------------------LINDKRARTAQTPGGTGALRVAADFLA
3b46A           ----------------------------------------------------------------------
2aeuA           ---------------------------------------GLKHLGGDENDKCVGFNRTSSAILATILALK
3cogB           --------------------------------------------------KYCLAFASGLAATVTITHLL
3e6gB           -----------------------------------------------------AFASGMAATSTVMELLD
1bqaA           ----------------------------------------------------------------------
2d64A           ----------------------------------------------------------------------
3bwnD           ---------------------------------------------ATEDRYIVVGTGSTQLCQAAVHALQ
3cq5B           --------------------------------------------VAVTRDNLWAANGSNEILQQLLQAFG
3ei7A           ----------------------------------------------------------------------
1eg5A           ----------------------------------------VAKVLGVSPSEIFFTSCATESINWILKTVR
2byjA           ----------------------------------------------------------------------
2e7uA           ----------------------------------------------------------------------
2bhxB           -----------------------------------------------------LQGGASLQFTMLPLLTK
1asfA           ----------------------------------------------------------------------
3ei6B           ----------------------------------------FYGGLGIGDDDVFVSDGAKCDISRLQVMFG
1arsA           ------------------------------------------------VKRVWVSNPSWPNHKSVFNSAG
1eghA           --------------------------------------------RTLPARKHIALVAH-DHCKQMLMSVE
1aheA           ----------------------------------------GSALINDKRARTAQTPGGSGALRVAADFLA
1akaA           ----------------------------------------------------------------------
2bwoD           -----------------------------------------------------VFSSAYNANDATLSTLL
2c7tA           ------------------------------------------DFNGVPYC-VPTTSGSTALMLALEALGI
2dgmC           ----------------------------------------------------------------------
2aatA           ----------------------------------------------------------------------
1djuB           -----------------------------------------------PKTEIMVLLGANQAFLMGLSAFL
3ei9A           ----------------------------------------------------------------------
2btwA           ----------------------------------------------------LIGFNSNEGEKLL---LT
1c7nA           -----------------------------------------------------NTAGVVPAVFNAVREFT
2bwpA           -----------------------------------------------------VFSSAYNANDATLSTLL
1cs1A           -----------------------------------------------------LTNTGMSAIHLVTTVLK
3bwoB           ---------------------------------------------ATEDRYIVVGTGSTQLCQAAVHALS
2dgmB           ----------------------------------------------------------------------
1arhA           ----------------------------------------------------------------------
3b8xB           ----------------------------------------------------------------------
2e7jA           ----------------------------------------------------------------------
1c4kA           ----------------------------------------------------------------------
3bcaA           ----------------------------------------------------------------------
1ajsA           ------------------------------------------------------LRIGAEFLARWYNGTN
3bcbA           ----------------------------------------------------------------------
3bwnA           ---------------------------------------------ATEDRYIVVGTGSTQLCQAAVHALS
3banA           ----------------------------------------------------------------------
3e2fA           -----------------------------------------------PNEEILVAVGAYGSLFNSIQGLV
2c81A           ---------------------------------------------------VPTTSGSTALMLALEALGI
7aatA           ----------------------------------------------------------------------
2btwB           ----------------------------------------------------LIGFNSNEG---EKLLLT
1aamA           --------------------------------------------INDKRARTAQTPGGTGALRVAADFLS
1eg5B           ----------------------------------------------------------------------
1d2fA           -----------------------------------------------------YGPSVIYMVSELIRQWS
3bcxB           ---------------------------------------------------------------LGVRALK
3d19E           ---------------------------------------------------FWSRIMKEHSFFLRLGFRC
3dc1A           ----------------------------------------------------------------------
2bieB           -----------------------------------------------------LQGGASLQFTMLPMNLL
2bkwA           ------------------------------------------SAAASKSQPFVLAGSGTLGWDIFASNFP
1ariA           ----------------------------------------------------------------------
1d2fB           ----------------------------------------------------------------------
2bwoA           -----------------------------------------------------VFSSAYNANDATLSTLR
3ecdA           ----------------------------------------------------------------------
1ajrA           ----------------------------------------------------------------------
3bc8A           ----------------------------------------------------------------------
3bn1A           ------------------------------------------------KHAIACNNGTTALHLALVAMGI
2dgmA           ----------------------------------------------------------------------
2d61A           ----------------------------------------GSALINDKRARTAQTPGGTGALRVAADFLA
2ctzA           -------------------------------------------------------ASGHAAQFLALLAQA
2eh6A           ----------------------------------------------------------------------
2dgkC           ----------------------------------------------------GGMAMKWRWRKRMEAAGK
1b8gB           ------------------------------------------NKVTFDPNHLVLTAGATSANETFIFCLP
2bwnE           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
1ecxA           ----------------------------------------VAKVLGVSPSEIFFTSCATESINWILKTVR
1asbA           ----------------------------------------------------------------------
3b8xA           ----------------------------------------------------------------------
1e5eB           ----------------------------------------------------------------------
3e2yA           ----------------------------------------------------------------------
3dr4C           ------------------------------------------------KHAIACNNGTTALHLALVAMGP
2d66A           ----------------------------------------------------------------------
3d19A           -------------------------------------------------IRFWSRIMKEHSFFLRLGFRC
3dxvB           -----------------------------------------------GRSGVIAFAGAYHGCTVGSMAFH
2cy8A           ----------------------------------------------------------------------
1b8gA           ------------------------------------------NKVTFDPNHLVLTAGATSANETFIFCLA
2bwnA           ----------------------------------------------------------------------
1ecxB           ----------------------------------------VAKVLGVSPSEIFFTSCATESINWILKTVR
1bybA           ------------------------------------------------AYRSLFQLVQECGLTLQAIMSF
1cl1A           -----------------------------------------------------LFPCGAAAVANSILAFQ
2dr1B           -----------------------------------------------------VPSSGTGIMEASIRNGK
2bwpB           -----------------------------------------------------VFSSAYNANDATLSTLF
3e9kA           ----------------------------------------MKDIVGANEKEIALMNALTVNLHLLMLSFK
3dr4D           ----------------------------------------------------------------------
2e3zB           ----------------------------------------------------------------------
1c7gA           ----------------------------------------------------------------------
1b4xA           ----------------------------------------GSALINDKRARTAQTPGGTGALRVAADKNT
2bfgA           ----------------------------------------------------------------------
1ejiA           ----------------------------------------------------------------------
1cj0A           ----------------------------------------------------------------------
3bb8A           ----------------------------------------------------------------------
3bzsA           ----------------------------------------------------------------------
3caiA           ----------------------------------------------------------------------
1b93B           ----------------------------------------------------------------------
1eh9A           ----------------------------------------------------------------------
3bv0B           ----------------------------------------------------------------------
3ecdD           -------------------------------------------------------HSGAQANGAVMLALA
3cc1B           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
2ckrA           ----------------------------------------------------------------------
3ecdC           ----------------------------------------RVKRLFNAGHANVQPHSGAQANGALALAKP
1bs0A           ----------------------------------------------------------------------
2dr1A           ------------------------------------------EFLEVEKGEVLLVPSGTGIMEASIRNGK
3bcxA           ----------------------------------------------------------------------
3bn1D           ---------------------------------------------------IACNNGTTALHLALVAMGI
3bh1D           ----------------------------------------------------------------------
2bhzA           ----------------------------------------------------------------------
1bjnA           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2dgmE           ----------------------------------------------------------------------
1ei7A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PEYAVITVPEYEPIIKLPSSLGVRHVKVWDVWEAPIKPGGVLIFSNPNNPTGRYLEKRELAELADEARRK
2egyC           DEGSLLEAPSYMGAIQAFRLQGPRFLTVLEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMER
2douB           EPEDLLLLPEYPSYFGAARVASLRTFLIPKAVPEGVWREKVLLLNYPNNPTGAVADWGYFEEALGLARKH
2egyD           DEGSPVLLEAPSYAIQAFRLQGPRFLTVPAGEEKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMER
2egyB           DEGSPVLLPSYMGAIQAFRLQGPRFLTVPAGEEGPDRPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMER
3cbfA           GSPVLLEAPSYMGAIQAFRLQGPRFLTVPAGEEKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMER
5bj4A           GDEVIVLSPYWVSYPEMVRFAGGVVVEVERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEH
1bjwA           DPGDEVLSPYWVSYPEMVRFAGGVVVEVERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEH
1c8nA           PAWLGTIADNYSKWRWVSLRIIYSPKCPLSYDRNDVAPGRVQLSQTYKAINFPPYAGYDGAAILNTDVTP
1dtyA           DNSMHSLWKGYLPENLFAPAPQSRMDGEFARLMAAHRHEIAVIIEPIVQGAGRMYHPEWLKRIRKICDRE
3cq6A           GPGRTALGPSYSMHPILAKGTHTEFIAVSVALEEIRAKQPDIVFTTPNNPTGDVTSLDDVERIINV---A
3dydA           NQNILVPRPGFSLYKTLAESMGIEVKLYNQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQ
3bwoC           SLAVVAAAPFYSTYVEETTYVRSGMYKWEGDAWGFDKKGPYIELTSPNNPDGTIRETVVAKVIHDFAYYW
3bwnB           SLARSAAAPFYSTYVEETTYVRSGMYKWEGDAWGFDKKGPYILVTSPNNPDGTIRET-----VVNRPDDD
2aevA           PKKVIHYLPELPGIERSCKIVNAKYFESDKVGEILNKIDKTLVIITGSTMDLKVIELENFKKVINTAKNK
3d6kA           ----------------------------VVRELVKDPQVKGWTVPVFGNPTGVTFSEQTCRELAESTAAP
3d6kB           KVKWLCPVPGYDRHFTITEHFGFEINVPTVRELVKDPQVKGWTVPVFGNPTGVTFSEQTCRELAESTAAP
1bkgA           GDEVIVLSPYWVSYPEMVRFAGGVVVEPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEH
2cb1A           PGDEVVAAGLFGQTIGLFGQVLSLGVTVPEAVREALSAKRAVFVETVANPALLVPDLEALATLAEEA---
2douA           EPEDLLLLPEYPSYFGAARVASLRTFLIPLREDGLAREAKVLLLNYPNNPTGAVADWGYFEEALGLARKH
1bw0B           GDYALVPQPGFPHYETVCKAYGIGMHFYNEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEEL
5bj3A           GDEVIVLSPYWVSYPEMVRFAGGVVVEVERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEH
2drrA           NGGPGHPMWNRDNKLIKFIPEVEFSDPSRVFWKEAAEASREYLKIACHPETGLAPEYAYYDGTPNDEKGY
3ei9B           ----------------------------------------IIFFCSPNNPTGAAATREQLTQLVEFAKKN
1b9iA           GPGTEVIVFTFISSSQAAQRLGAVTVPVPEAVAAAVTPRTKVI--MPVHMAGLMADMDALAKIS---ADT
3d6kC           ----------------------------VVRELVKDPQVKGWTVPVFGNPTGVTFSEQTCRELAESTAAP
1b5oA           GDEVIVLSPYWVSYPEMVRFAGGVVVEVEERVRRAITPRTALVVNSPNNPTGAVYPKEVLEALARLAVEH
3dc1B           --------------------------------PQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKY
2cstA           ----YVSSPTWENHNSVFMDAGFKDIRTYRYWEKAPEFSIFILHACAHNPTGTDPTPDEWKQIAAVMKRR
3bwnE           SLARVAAAPFYSTYVEETTYVRSGMYKWEGDAWFDKKGPYIELVTSPNNPDGTIRETVVEAK--------
3bwnC           PVSVVAAAPFYSTYVEETTYVRSGMYKWEGDAWGFDKKGPYIELTSPNNPDGTIRETVVAKVIHDFAYYW
3ei8A           ----------------------------------------IIFFCSPNNPTGAAATREQLTQLVEFAKKN
3cq5A           GPTALGFQPSYSMHPILAKGTHTEFIAVDVALEEIRAKQPDIVF--VTTPNNPTGDVTSLDDVERIINVA
3bmaD           NKQVVVISPQWFSKNGYDPAAFQQYFNGDSGDQASQYAATRLLQFPNVAMKDLVQKLASKEELSTADNLA
1bqdA           ---------------------------LINSLNEAQAGDVVLFHGCCHNATGIDPTLEQWQTLAQLSVEK
1b5pA           GDEVIVLSPYWVSYPEMVRFAGGVVVEVEERVRRAITPRKALVVNSPNNPTGAVYPKEVLEALARLAVEH
2d5yA           LEVREYAYYD-------AENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK
3d6kD           KVKWLCPVPGYDRHFTITEHFGFEINVPVVRELVKDPQVKGWTVPVFGNPTGVTFSEQTCRELAESTAAP
3bwoE           SLAVVAAAPFYSTYVEETTYVRSGMYKWEGDAWGFDKKGPYIELTSPNNPDGTIRETVVAKVIHDFAYYW
3ei6A           SNVTIAVQPSYPAYVDSSVIMGQTGQFNGFFPDLSTVGRTDIFFCSPNNPTGAAATREQLTQLVEFAKKN
3caeA           NNQQNYSSHTYTPDFLLPNGIFVETKGLWLIREQHPELDIRIVFSSSRTKLYK----GSPTSYGEFCEKH
2e54A           KYRILSAHNSFHGRTLGSLTATGQPKYQVEDLRRKMSEDCAVFLEPIQGESGIVPATKEFLEARKLCDEY
1dgdA           ----GPAAVGSFAIPAPFTYRPRFERNGLDYAFDLIDLAAFIAEPILSSGGIIELPDGYMAALKRKCEAR
1b9hA           GTEVIVPAFTFISSSQAAQRLGAVTVPVPEAVAAAVTPRTKVI--MPVHMAGLMADMDALAKIS---ADT
3bwoA           SLARVAAAPFYSTYVEETTYVRSGMYKWEGDAWGFDKKGPYIELTSPNNPDGTIRETVVAKVIHDFAYYW
3dc1D           --------------------------------PQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKY
3bwnF           PVSVVAAAPFYSTYVEETTYVRSGMYKWEGDAWGFDKKGPYIELTSPNNPDGTIRETVVAKVIHDFAYYW
3eiaB           SNVTIAVQPSYPAYVDSSVIMGQTGQFNTENGFFPDLRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKN
3cogD           GDQIICMDDVYGGTNRYFRQVASEFGLKILLEAAITPETKLVWIETPTNPTQKVIDIEGCAHI--VHKHG
2bwnD           FPGLIIYSDSLNHASMIEGIKRNAGPKRIELIAADDPAAKLIAFESVYSMDGDFGPIKEICDI---AEEF
3dxvA           RSGVIAFAGAYHGCTVGSMAFSGLILLPYEKLAAVPAGSAAFIEPIQSDGGLIVPPDGFLRKFADICRAH
3cq4A           GRTALGFQPSYSMHPILAKGTHTEFIAVSRGADFRIKQPDIVFVTTPNNPTGDVTSLDDVERIINV---A
1agxA           --------NSEFNIEKIQGDALPGNMMPDAYQAFAKAGVKAIIHAGTGNGSMANYLVPEVRKL---HDEQ
2cfbA           YTQREKVIKFEGCYHGHAATLTAPYNDLEAVLFEQYPNDAGVILEPVVGNAGFIPPDAGLEGLRELTKQY
1djuA           KDGEEIPTPAFVSYAPAVILAGGKPVEVPELKKYVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEH
3dzzB           PGDQILVQEPVYNFYSVIEGNGRRVISSWADLEEKLATPSVRVFCNPHNPIGYAWSEEEVKRIAELCAKH
1ay4A           DLRVFVSDPTWPNHVSIMNFMGLPVQTYRADLAAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKT
3cq4B           GPGRLGFQPSYSMHPILAKGTHTEFIAVDVALEEIRAKQPDIVF--VTTPNNPTGDVTSLDDVERIINVA
3bwoD           SLAVVAAAPFYSTYVEETTYVRSGMYKWEDAWGFDKKGPYIELVTSPNNPDGTIRETVVAKVIHDFAYYW
3drdA           ----------------------------------------SIESMVQGASGMIVMPEGYLAGVRELCTTY
3bs8A           ----------------------------------------VIVEPVAGNMGVVPPQEGFLQGLRDITEQY
1bw0A           DAGDYAPQPGFPHYETVCKAYGIGMHFLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEEL
2dkjA           GDTLMGMDLAAGGHLTHGSRVNFSGKLYKIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEV
1d7uA           ------------------------------------NLAAFIAEPILSSGGIIELPDGYMAALKRKCEAR
3dydB           GQNILVPRPGFSLYKTLAESMGIEVKLYNQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQ
1ay4B           -----------------AETRGVDFEGMKADLAAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKT
3b5oA           QELQENIDGSTTGGISHYTLLADGLEEGLGVAVKLLRTVLSLFDRQVDYVLGATYAIEATSIPELTLIVK
3bh1C           ----------------------------PESIEPIQTLKVHLGSSNPRLHTDEVLIALSVSAA---TDSN
3e6gD           AGSHVVTFRLFERVRRRTAGLDFSFVDLTDPFKAAIRADTKMVWETPTNPMLKLVDIAAIAVI---ARKH
3aatA           KNTSWVSNPSWPNHKSVFNSAGLEVREYANSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK
3bwoF           PVSVVAAAPFYSTYVEETTYVRSGMYKWEDAWGFDKKGPYIELVTSPNNPDGTIRETVVAKVIHDFAYYW
3dzzA           PGDQILVQEPVYNFYSVIEGNGRRVISSDADLEEKLATPSVRVFCNPHNPIGYAWSEEEVKRIAELCAKH
3eiaA           SNVTIAQDPSYPAYVDSSVIMGQTGQFNTFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKN
3ei7B           ------------------------------------------FFCSPNNPTGAAATREQLTQLVEFAKKN
3e6gA           ----------FERVRRRTAGLDFSFVDLTDPFKAAIRADTKMVWETPTNPMLKLV---DIAAIAVIARKH
1czcA           KNTSVRRVWVSNPAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK
1aiaA           KKRVWVSNPSWPNHKSVFNSAGLEVREYANSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK
3b46A           ----------------------------FEQFEKAITSKTKAVINTPHNPIGKVFTREELTTLGNICVKH
2aeuA           PKKVIHYPELPGHPSIERSCKIVNAKYFEGEILNKIDKDTLVIIT-GSTMDLKVIELENFKKVINTAKNK
3cogB           GDQIICMDDVYGGTNRYFRQVASEFGLKILLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVH--KHG
3e6gB           AGSHVVAMDDLYGVRRRTAGLDFSFVDLTDPFKAAIRADTKMVWETPTNPMLKLVDIAAIAVI---ARKH
1bqaA           ---------------------------LINSLNEAQAGDVVLFHGCCHNATGIDPTLEQWQTLAQLSVEK
2d64A           ---------------------------LINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK
3bwnD           PVSVVAAAPFYSTYVEETTYVRSGMYKWGDAWGFDKKGPYIELVTSPNNPDGTIRE-----------TVV
3cq5B           GPTALGFQPSYSMHPILAKGTHTEFIAVSVALEEIRAKQPDIVF--VTTPNNPTGDVTSLDDVERIINVA
3ei7A           ----------------------------------------IIFFCSPNNPTGAAATREQLTQLVEFAKKN
1eg5A           KRTIITTPIEHKAVLETKYLSKGFKVKYVPVDSRGVDEDTFLVSIAANNEVGTIQ---PVEDVTRIVKKK
2byjA           ----------------MPGFDIIPYNDLPALERADPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRH
2e7uA           --------------------------------------IAAIIFEPVVGNAGVLVPTEDFLKALHEAKAY
2bhxB           GTIGNYVLTGSWSEKALKEAKLLGETHIANSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFPEIN
1asfA           -----------------AENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK
3ei6B           SNVTIAVQPSYPAYVDSSVIMGQTGQFNGNIEYMRCTPENGFFFCSPNNPTGAAATREQLTQLVEFAKKN
1arsA           LEVREYAYYDAEN-------HTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK
1eghA           RHQPLLEQHVLYATGTTGNLITGMNVNAQQVGALISEGKIDVLIWDPLNAVPHDPDVKALLRL---ATVW
1aheA           VKRVWVSNPSWPNHKSVFNSAGLEVREYANSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK
1akaA           -----------------------------EDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKR
2bwoD           FPGLIIYSDSLNHASMIEGIKRNAGPKRIELIAADDPAAKLIAFESVYSMDGDFGP---IKEICDIAEEF
2c7tA           GDEVIVPSLTWIATATAVLNVNALPVFVIDPQLIKSAITDKTKAIIPVHLFGSM---ANMDEINEIAQEH
2dgmC           ------------ELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEPLHDALDKFQADTGI
2aatA           ---------------------TLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK
1djuB           KDGEEVLIPAFVSYAPAVILAGGKPVEVPTYEEDEFDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEH
3ei9A           -----------------------------------------IFFCSPNNPTGAAATREQLTQLVEFAKKN
2btwA           SRSREDFFLSQFVTQVNQAYCGVASIIVLNSLGINAPETAKTKAVIAPEVVARQGT---LDELGRLIASY
1c7nA           KPGDGVITPVYYPFFMAIKNQERKIIECELLEKDGYKNNKALLFCSPHNPVGRVWKKDELQKIKDIVLKS
2bwpA           FPGLIIYSDSLNHASMIEGIKRNAGPKRRELIAADDPAAPKLIAESVYSMDGDFGPIKEICDI---AEEF
1cs1A           PGDLLVAPDCYGGSYRLFDSLAKRGCYRVALRAALAEKPKLVLVESPSNPLLRV---VDIAKICHLAREV
3bwoB           SLAVVAAAPFYSTYVEETTYVRSGMYKWEDAWGFDKKGPYIELVTSPNNPDGTIRETVVAKVIHDFAYYW
2dgmB           ------------ELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPHDALDKFQADTGI
1arhA           -----------------AENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK
3b8xB           ------------------------------------------KAILTVNLLGNPNNFDEINKIIGG---R
2e7jA           ------------------------------------KKRGEVVLALITYPDGNYGNLPDVKKIAKVCSEY
1c4kA           ----------------------------KVDPERAKWKRFRLAVIQLGTYDGTIYNAHEVVKRI---GHL
3bcaA           -----------------------------AKIQELGPEHILCLH--STTACFAPRVPDRLEELAVICANY
1ajsA           NKDTPVYVSSWENHNGVFTTAGFKDIRSYRYWDTEPEFSIFVLHACAHNPTGTDPTPEQWKQIASVMKRR
3bcbA           ------------------------------------LGPEHILCLHSTTACFAPRVPDRLEELAVICANY
3bwnA           SLARSQPVPFYSTYVEETTYVRSGMYKWEGDAWGFDKKGPYILVTSPNNPDGTIRETVVDEAK---VIHD
3banA           -----------------------------TLEEIKAIPGMQGIVTAYDVPVGQAWPLENILELKKMVEEA
3e2fA           DPGDEVIIPFYDCYEPMVRMAGAVPVFIPLRSKPTDSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKH
2c81A           GDEVIVPSLTWIATATAVLNVNALPVFCIDPQLIKSAITDKTKAIIPVHLFGSM---ANMDEINEIAQEH
7aatA           -----------------------------EDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKR
2btwB           SRSREDFFLSQFVTQVNQAYCGVASIIVLVFTQDNFFSNEKTKAVIAPEVVAKQGTLDELGRLI---ASY
1aamA           VKRVWVSNPSWPNHKSVFNSAGLEVREYANSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK
1eg5B           -----------------------------------------LVSIAANNEVGTI---QPVEDVTRIVKKK
1d2fA           ETGEGVVIPAYDAFYKAIEGNQRTVMPVALEKQADGPECKIMLLCSPQNPTGKVWTCDELEIMADLCERH
3bcxB           PGDEVITVAAGFPTVNPTIQNGLIPVFVDSLIEAAVSDKTKAIMAHTLGNLFD------LAEVRRVADKY
3d19E           EDTQLIEEANYRLFEHIEQIAHTNETDPEQIFNAEVQQAATNIW----GFKRKILGLILTCKLP---GQN
3dc1A           --------------------------------PQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKY
2bieB           TKGGNYVLTGSWSEKALKEAKLIAASTKANSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFPEIN
2bkwA           NKNVLVVSTGTFSDRDCLRSYGAQVDVVELITEKLSQNSYGAVTTHVDTSTAVLSDLKAISQAIK-QTSP
1ariA           ---------------------------LINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK
1d2fB           -------------------------------------ECKIMLLCSPQNPTGKVWTCDELEIMADLCERH
2bwoA           VLFPIIYSDSLNHASMIEGIKRNAGPKRILIAADDPAAPKLIAFESVYSMDGDFGP---IKEICDIAEEF
3ecdA           ---------------------VSRDTMLIDYDQALAQQHKPSLIIAGFSAYPRKL---DFARFRAIADSV
1ajrA           ------------------------------------EFSIFVLHACAHNPTGTDPTPEQWKQIASVMKRR
3bc8A           ------------------------------------LGPEHILCLHSTTACFAPRVPDRLEELAVICANY
3bn1A           GPGDEVIVPSYIASANSVTYCGATPVLVDAKLEALITPRTKAIM--PVHLYGQICDMDPILEVA---RRH
2dgmA           ------------ELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEPLHDALDKFQADTGI
2d61A           KNTSWVSNPSWPNHKSVFNSAGLEVREYANSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK
2ctzA           GDNIVSTPNLYGGTFNQFKVTLKRLGIEVEEFLALTDEKTRAWVESIGNPALNIPDLEALAQAAR---EK
2eh6A           ------------------------------------ETAGIIIEVIQGEGGVNEASEDFLSKLQEICKEK
2dgkC           PTDKPNLVPVQICWHKFARYWDVELREIKRMIEACDENTIGVVPTFGVTYTGNYEPLHDALDKFQADTGI
1b8gB           GEAVLIPTPYYPGFDRDLKWRTGVEIVPIQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDK
2bwnE           ------------------------------------------AFESVYSMDGDFGPIKEICDIA---EEF
3ecqA           ------------DGIKKIHTDGLGQGVLLKGYGSEGHDSGHLNYADIGKRIGG---VEDFKTLIEKAKKY
1ecxA           KRTIITTPIEHKAVL---ETMKYLSMKGFKVKYVPVDSRGVVSIMAANNEVGTI---QPVEDVTRIVKKK
1asbA           ---------------------------LINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK
3b8xA           ------------------------------------------KAILTVNLLGNPNNFDEINKIIGG---R
1e5eB           ----------------------------PGEVKKHMKPNKIVYFETPANPTLKIIDMERVCKD--AHSQE
3e2yA           ----------------------------------------AIILNTPHNPLGKVYTRQELQVIADLCVKH
3dr4C           GDEVIVPSLTYIASANSVTYCGATPVLVDAKLEALITPRTKAIM--PVHLYGQICDMDPILEVA---RRH
2d66A           -----------------AENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK
3d19A           EDTQLIEEANQFYFEHIEQIAHSYTNETIKRFNAEVQQAATNIW----GFKRKILGLILTCKLP---GQN
3dxvB           SVQADAAKADGLILLPYPDPYILTLLTEKLAAVPAGSIGAAFIEPIQSDGGLIVPPDGFLRKFADICRAH
2cy8A           ----------------------------MREVFANHGSDIAAFIAEPSHFGVTPVSDSFLREGAELARQY
1b8gA           DPGVLIPTPYYPGFDRDLKWRTGVEIVPIHCTEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDK
2bwnA           ----------------------------------------LIAFESVYSMDGDFGPIKEICDIA---EEF
1ecxB           KRTIITTPIEHKAVLETMKYLSVKYVPVDSRGVVKLEELFLVSIMAANNEVGTIQPVEDVTRIVKKKNK-
1bybA           HQCGGN--VGDIVNIPIPQWVLDIGESNHDIRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDF
1cl1A           GDHVLMTNTAYEPSQDFCSKILSKLGVTADIVKHLQPNTKIVFLESPGSITMEVHDVPAIVAAVRSVVPD
2dr1B           GGKVLVTIIGAFGKRYKEVVESNGRKAVPEDLDDALRKNPAVTITYNETSTGVLNPLPELAKVA---KEH
2bwpB           PGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNADDPAAPKLIAFESVYSMDGDFGPIKEICDIA---EEF
3e9kA           RYKILLEAKAFPSDHYAIESQLQLHGLNIEDILEVIEKEGVILFSGVHFYTGQHFN---IPAITKAGQAK
3dr4D           -----------------------------------------TKAIMPVHLYGQICDMDPILEVARRHNL-
2e3zB           ----------WREDVQLLKSYGVKAYRFSLSWSRIIPKGGRSDPVNGAGI-------KHYRTLIEELVKE
1c7gA           ----------------------------------------YICLAVTVNLAGGQPVSMANRAVHEMASTY
1b4xA           SVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTDVVLFHGSCHNPTGIDPTLEQWQTLAQLSVEK
2bfgA           ----------LDHLKLVQEKIGFRYIRGHGLLSDDVGIYREVEIDGEMKPFYNF---TYIDRIVDSYLAL
1ejiA           ----------------------------YDQLEENASLFHPKLIIAGTSCYSRNLDYARLRKIADDN---
1cj0A           -----------------------------RLEENARLFHPKLIIAGTSCYSRNL----DYGRLRKIADEN
3bb8A           -----------------------------NASLIEAAVSDKTKAIMIAHTLGNLFDLAEVRRV---ADKY
3bzsA           -----------------------------------------VIVKDPTHIAICLYYKLGETQIIKLAELY
3caiA           ----------------AEVDIETGELPTWQWESLISKSTRLVAVNSASGTLGGVTDLRAMTKLV---HDV
1b93B           ---------------------NAMLSGPMQVGALISEGKIDVLIFFWLNAVPHDPDVKALLRLA---TVW
1eh9A           -------------------DLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKK
3bv0B           ----------------------------------------VVVEPVVQGAGGMRFHDPRYHDLRDICRRY
3ecdD           KPGDTVLGMSLFNALQYGVSRDTMLIDYDQVEALAQQHKPS-LIIAGFSAYPRKLDFARFRAI---ADSV
3cc1B           -------------------KYGWEYIVVDIQWYEPTANNPYGRLLPATNRFPSAKNGAGFKPLSDAIHDL
1a47A           --WQGIINKINDGYLT---GMGVTAIWISQPVENIYAVLPDSTFGGSTSTNPYFGSFTDFQNLINTAHAH
2ckrA           ----------DSSLDALAYDWKADIIRLSMYIQED--------GYETNPRGFTD----RMHQLIDMATAR
3ecdC           GDTVLGMSLFNALQYGVSRDTMLIDY---DQVEALAQQHKPSLIIAGFSAYPRKLDFARFRAIA---DSV
1bs0A           -----------------PSQLRRAHNDVTHLLLASPCPGQQMVVTEGVFSMDGDSA--PLAEIQQVTQQH
2dr1A           GGKVLVTIIGAFGKRYKEVVESNGRKAVVLEYERKNPDVEAVTITYNETSTGVLNPLPELAKVAKE---H
3bcxA           ----------------------------VNASLIEAAVSDKTKAIMIAHTLGNLFDLAEVRRVADKY---
3bn1D           GPGDEVIVPSYIASANSVTYCGATPVLVNLDAAKLEALITPRTKAMPVHLYGQICDMDPILEVA---RRH
3bh1D           ----------------------------PESIEPIQTLKTVHLGSNPRLHTDEVLIALSVSAATDS---N
2bhzA           -------------------ELGVTAIQVPLAAFDGQRGWGYAAFYAPYAPYGR----PEDLALVDAAHRL
1bjnA           ------------------------------------------HYCPNETIDG-------IAIDETPDFGA
1cguA           --WQGLINKINDNYFS---DLGVTALWISQPVENIFATINYSGVTNTAYTNPYFGTMADFQNLITTAHAK
3bmvA           --WQGIINKINDGYLT---GMGVTAIWIPQPVENIYAVLPDSTFRDFKRTNPYFGSFTDFQNLINTAHAH
2dgmE           --------PVQICWHKFARYWDVELREIPMRPIEACDENTIGVVTFGVTYTGNYEPLHDALDKFQADTGI
1ei7A           --------KPSPQVTVR---FPDSDFKVYALLGAFDTRNRIIEVENQANPTTATLDATRRVDDATVAIRS


                         +         .         .         .         .         *         .:210
query           GAYLIIDIIFSDFVTDDLRGFPLENVAYSHSTDKFYTHDLRAGWVFGDEEIVRRVKYLKDLANPGPXXXX
2egyC           GLVVVEDDAYRELYFGEAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTMLVH
2douB           GLWLIHDNPYVDQVYELALPGAKERVVELFSLSKSYNAGFRLGFALGSEEALARLERVKGVIDFNQYAGV
2egyD           GLVVVEDDAYRELYFGELAREAGYPGVIYLGSFSKVLSGLRVAFAVAHPEALQKLVQAKQGADLHTPMLN
2egyB           GLVVVEDDAYRELYFGEAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQTPMLNQMLVH
3cbfA           GLVVVEDDAYRELYFGEARLPSLFEVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLN
5bj4A           DFYLVSDEIYEHLLYEG-EHFSPGTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSRQSTTSPDTIA
1bjwA           DFYLVSDEIYEHLLYEGEHFSPGRVTLTVNGAAAFAMTGWRIGYACGPKEVIKAMASVSTTSPDTIAQWA
1c8nA           TSAIYVDVDVTRFDKAWYSTIGTAFDQNQFCPCTVHISDGGPAVAVPPGDIFFKY---------------
1dtyA           GILLIADEIATGFGRTGKLFACEEIAPDILCLGKLTGGTMTLSATLTTREVAEDGEAGCFMHGPTFMGNP
3cq6A           PGIVIVDEAYAEFSPSPSATTLLEKLVVSRTMSAFDFAGGRLGYFVANPAFIDAVMLVRLPYHLSALSQA
3dydA           CVPILADEIYGDMVFSDATLSTDVPILSCGGLAKWLVPGWRLGWILIHDRRDIFGNEIRDGLVKLSQRIL
3bwoC           PHYTPITRRQ-------------DHDIMLFTFSITGHAGSRIGWALVDKEVAKKMVEYIIVNSIGVILNV
3bwnB           EAKVIHDFAYYWPHYTP-ITRRQDHDIMLFTFSKITGAGSRIGWALKDKEVAKKMVEYIIVNSIGVSKES
2aevA           EAIVFVDDASGARVRLLFNQPPALKLGADLVVTSTDMEGPRGGLLAGKKELVDKIYIEGTPLLAGIYRAL
3d6kA           DFRIVWDNAYALHTLSDAQAAGNPNRFWFSSTSKITHAGSGVSFFASSKENIEWYASHANVRGIGPNKLN
3d6kB           DFRIVWDNAYALHTLSDAQAAGNPNRFWFSSTSKITHAGSGVSFFASSKENIEWYASHANVIGPNKLNQL
1bkgA           DFYLVSDEIYEHLLYEGGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVMASVSSQSTTSPDTIAQWA
2cb1A           GVALVVDNTFGAAGALC-RPLAWGAHVVVESLTWSGHGSVLGGAVLSRETELWRNYPQF-----------
2douA           GLWLIHDNPYVDQVYEGEAPSPLERVVELFSLSKSYNAGFRLGFALGSEEALARLERVKGVIDFNQYAGV
1bw0B           RLPLFSDEIYAGMVFKSVADFETTVPRVILGGTANLVPGWRLGWLLYVDPHGNGPSFLEGLKRGPCTVVQ
5bj3A           DFYLVSDEIYEHLLYEPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSTTSPDTIAQWA
2drrA           --GHFFSNSYRVAANIGLDAEWFEEINKIQAFFADKPEDYRRYKIDGEPFEEKSLHPVGLIATNAM----
3ei9B           GSIIVYDSAYAMYMSDDEIPGAEEVAMETASFSNAGFTGVRLGWTVIPKKLLYSDGFPVACFNGASNISQ
1b9iA           GVPLLQDAAHAHGARWQGKRVGELDATFSFQNGKLMTAGEGGAVVFPDGETEKYETAFLRHSCGRP----
3d6kC           DFRIVWDNAYALHTLSDAQAAGNPNRFWFSSTSKITHAGSGVSFFASSKENIEWYASHANVRGPNKLNQL
1b5oA           DFYLVSDEIYEHLLYEGEHFSPGRVAPEHTLTVNGAAKAFRIGYACGPKEVIKAMASVSSQSTTSPALTN
3dc1B           DFLIIEDDPYYFLQFNKFLSMDVDGRVIRADSFSIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSQLL
2cstA           CLFPFFDSAYQGFASGSLDKDAGFELFCAQSFSKFGLYNERVGNLSVVGKDEDNVQRVLSRTTWSNPPSQ
3bwnE           ---VIHDFAYYWPHYTPITRRQ-DHDIMLFTFSKITGAGSRIGWALKDKEVAKKMVEYIIVNSIGVSKES
3bwnC           PHYTPITRRQDHDI-------------MLFTFSITGHAGSRIGWALVDKEVAKKMVEYIILNVLKETCKS
3ei8A           GSIIVYDSAYAMYMSDDNPRSIFEVAMETASFSNYAGTGVRLGWTVIPKKLLYSDGFPVAKDNGASNISQ
3cq5A           PGIVIVDEAYAEFSPSPLLEKYPTKLVVSRTMSKAFDAGGRLGYFVANPAFIDAVMLVRLPYHLSALSQA
3bmaD           RFNERQASFFGQFGYV---NYDKHVAKYLKILPDQFSQAIEDVVK-------------------------
1bqdA           GWLPLFDFAYQGFAGLEEDAEGLRAFIVASSYSNFGLYNERVGACTLVAADSETVDRAFSYSNPPAHGAS
1b5pA           DFYLVSDEIYEHLLYEGPGRVAPEHTLTVNGAAKAFAMTWRIGYACGPKEVIKAMASVSTTSPDTIAQWA
2d5yA           GWLPLFDFAYQGFARGLEEDAEGKELIVASSYSKNFGLNERVGACTLVAADSETVDRAFSQMKAAIRVNY
3d6kD           DFRIVWDNAYALHTLSDAQAAGNPNRFWFSSTSKITHAGSGVSFFASSKENIEWYASHANVRGIGPNKLN
3bwoE           PHYTPIT-------------RRQDHDIMLFTFSITGHAGSRIGWALVDKEVAKKMVEYIIVNSIGVKSES
3ei6A           GSIIVYDSAYAMYMSDDNPRSIFEVAMETASFSKYAGTGVRLGWTVIPKKLLPVAKDFNRIICTCFNGAS
3caeA           GIKFADKLIPAEWIKEP-----------------------------------------------------
2e54A           DALLVFDEVQCGMGRTGFAYQKYGVVPDVLTTAKGLGGGVPIGAVIVNERANVLEPGDHGTTFGGN---P
1dgdA           GMLLILDEAQTGVGRTMFACQRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHELDVVQRDGLVARA
1b9hA           GVPLLQDAAHAHGARWQGKRVGELDATFSFQNGKLMTAGEGGAVVFPDGETEKYETAF------------
3bwoA           PHYTPIT-------------RRQDHDIMLFTFSITGHAGSRIGWALVDKEVAKKMVEYIIVNSIGVTCKS
3dc1D           DFLIIEDDPYYFLQFNKFLSMDVDGRVIRADSFSIISSGLRIGFLTGPKPLIERVILHIQVLHPSTFNQL
3bwnF           PHYTPITRRQ-------------DHDIMLFTFSKITGAGSRIGWALVDKEVAKKMVEYIIAKILNVLKET
3eiaB           GSIIVYDSAYAMYMSDDEIPGAEEVAMETASFSQYAGTGVRLGWTVIPKKLLYSDGFPVACFNGASNISQ
3cogD           DIILVVDNTFMSPYFQRPLAL--GADISMYSATKYMGHSDVVMGLVSVNCESLHNRLRFLQNSLGAHFKN
2bwnD           GALTYIDEVHAVGMYGPGVAERDGLMHRIDIFNGTLAYGVFGGYIAASADAVRSYAPGFIFSTSLPPAIA
3dxvA           GILVVCDEVKVGLARSGRLFEHEGFVPDILVLGKGLGGGLPLSAVIAPAEILDCASAFAMQTLHGNTIDR
3cq4A           PGIVIVDEAYAEFSPSP-SATTLLEKYPTKLVVSRTMSGGRLGYFVANPAFIDAVMLVRLPYHLSALSQA
1agxA           GLQIVRSSRVAQGFVLRNAEQPDDKYGWIAAHDLNPQKARALTKTNDAKEIQNMFW--------------
2cfbA           GALLVFDEVMTGFRIAYGGAQEKFGVTPDLTTLGKVIGGLPVGAYGGRAEIM------------------
1djuA           DLIVISDEVYEHFIYDDARHYSIARTITVNGFSKTFATGWRLGFVAAPSWIIERMVKFQMATCPVTFIQY
3dzzB           QVLLISDEIHGDLVLTDEDITPAFTVDWDASPSTFNLAALHAACAIIPNPDLRARAEESFFLIGEPNLLA
1ay4A           GALPLIDLAYQGFGDGLLIASRIPEVLIAASCSKNFGYRERTGCLLALCADAATRELAQGAMAFLNRQTY
3cq4B           PGIVIVDEAYAEFSPSPLLEKYPTKLVVSRTMSKFDFAGGRLGYFVANPAFIDAVML---VRLPYHLSAL
3bwoD           PHYTPIT-------------RRQDHDIMLFTFSITGHAGSRIGWALVKDKEVAKAKILNVLKETCKSESE
3drdA           DVLMIVDEVATGFGRTGKMFACENVQPDLMAAGKGITGYLPIAVTFATEDIYKAFYDDYENLKTF-----
3bs8A           GSLLIFDEVMTGFRDYNCAQGYFGVTPDLTCLGKVIGGGLPVGAYGGKAEIMEQIAPSGPIYQAGTLSGN
1bw0A           RLPLFSDEIYAGMVFKSVADFETTVPRVILGGTANLVPGWRLGWLLYVDPHGNGPSFLEGLKRGPCTVVQ
2dkjA           GAYLVVDMAHFAGLVAAHPNPLPYAHVVTSTTHKTLRGPRGGLILSNDPELGKR----------------
1d7uA           GMLLILDEAQTGVGRTGFACQRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHELDVVQRDGLVARA
3dydB           CVPILADEIYGDMVFSDCKYEPLVPILSCGGLAKRWLPGWRLGWILIHDRRDIFGNEIRDGLVKLSQRIL
1ay4B           GALPLIDLAYQGFGDGLEEDAAIPEVLIAASCSKNFGYRERTGCLLALCADAATRELAQGASFPPFHGAK
3b5oA           LVEWLHGAIPKDLQYFFSKHLDAAAYIQPEEFGEFAAGFAIDAQV-WWQELAQEAISSEVV---------
3bh1C           AQKALDQLKNLRGCD--------VHTTTILGSVDEGIFR-NLGVLVTSDPKFQK----------------
3e6gD           GLLTVVDNTFASPMLQ--RPLSLGADLVVHSATKYLNHSDMVGGIADNAELAEQMAFLQNSIGGVQGPFD
3aatA           GWLPLFDFAYQGFARGLEEDAEGLRAFAAMHSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANY
3bwoF           PHYTPIT-------------RRQDHDIMLFTFSITGHAGSRIGWLVKDKEVAKKMVEYIIVNSIGVSKES
3dzzA           QVLLISDEIHGDLVLTDTVDWDAKNWVVSLISPSTFNAALHAACAIIPNPDLRARAEESFFLAGEPNLLA
3eiaA           GSIIVYDSAYAMYMSDDEIPGAEEVAMETASFSQYAGTGVRLGWTVIPKKLLYSDGFPVAKDFNRIICTC
3ei7B           GSIIVYDSAYAMYMSDDEIPGAEEVAMETASFSKAGFTGVRLGWTVIPKKLLYSDGFPVAKDNGASNISQ
3e6gA           GLLTVVDNTFASPMLQR----PLSLGAVVHSATKYLNSDMVGGVVGDNAELAEQMAFLQN----------
1czcA           GWLPLFDFAYQGFARGLEEDAEGKELIVASSYSKFGLYNERVGTCTLVAADSET----------------
1aiaA           GWLPLFDFAYQGFARGLEEDAEGKELIVASSYSHNFGLNERVGACTLVAADSETVDRAFSQMKAAIRANY
3b46A           NVVIISDEVYEHLYFTDTLSPEIGQLTLTVGSAGSFTGWRIGWVLSLNAELLSYAAKAHCFASPSPLQEA
2aeuA           EAIVFVDDASGARVRLLFNQPPALADLVVTSTDKLMEG-PRGGLLAGKKELVDKIYIEG-----------
3cogB           DIILVVDNTFMSPYFQRPL--ALGADISMYSATKYMGHSDVVMGLVSVNCESLHNRLRFLQNSLGAHFKN
3e6gB           GLLTVVDNTFASPMLQ--RPLSLGADLVVHSATKYLNHSDMVGGIADNAELAEQMAFLQNSIGGVQGPFD
1bqaA           GWLPLFDFAYQGFARGLEEDAEGHKELIVASSYSNFLYNERVGACTLVAADSETVDRAF-----------
2d64A           GWLPLFDFAYQGFAGLEEDAEGLKELIVASSYSKFGLYNERVGACTLVAADSETVDRAFSQMKAAIRVNY
3bwnD           NAKVIHDFAYYWPHYTP-ITRRQDHDIMLFTFSKITGAGSRIGWLVKDKEVAKKMVEYIIAKILNVLKET
3cq5B           PGIVIVDEAYAEFSPSPLLEKYPTKLVVSRTMSKAFDFAGRLGYFVANPAFIDAVMLVRLPYHLSALSQA
3ei7A           GSIIVYDSAYAMYMSDDNPRSIFEVAMETASFSKYAGTGVRLGWTVIPKKLLYSDGFPVACFNGASNISQ
1eg5A           NKETLVHVDAVQTIGKPFSLEKLEVDYASFSAHKFHGPGVGITYIRKGVPIRPLIHGGGQERGLRSGTQN
2byjA           QVLFIADEIQTGLARTWLAVDYENVRPDIVLLGKALSGLYPVSAVLCDDDIMLT----------------
2e7uA           GVLLIADEVMTGFRAFGGATELLGLKPDLVTLGKILGGGLPAAAYAGRREIMEKVAPLGPVYQAGTLSGN
2bhxB           HAPLIADMSSDILSRPGMIYAGAQKNLGPSGVTVVIVKDLLVEQVPTMLQYATHIKSDSLYNTPPTFSIY
1asfA           GWLPLFDFAFQGFARGLEEDAEGKELIVASSYSKNFGLNERVGACTLVAADSET----------------
3ei6B           GSIIVYDSAYAMYMSDDEIPGAEEVAMETASFSKYAGTGVRLGWTVIPKKLLYSDKDFNRIICTCFNGAS
1arsA           GWLPLFDFAYQGFARGLEEDAEGKELIVASSYSKFGLYNERVGACTLVAADSET----------------
1eghA           NIPVATNVATADFIIQSPHFND-AVDILIPDYQRYL----------------------------------
1aheA           GWLPLFDFAYQGFARGLEEDAEGKELIVASSYSKFGLYNERVGACTLVAADSET----------------
1akaA           NLLAYFDMAYQGFASGDINRDAWIDVVLSQSYAHMGLYGERAGAFTVICRDAEEAKRVESQLKILIRPMY
2bwoD           GALTYIDEVHAVGMYGPRGAGVAEIDIFNGTLAKYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIA
2c7tA           NLFVIEDCAQSHGSVWNNQRAGTIGGAFSCQQGKVLTAGEGGIIVTKNPRLFELIQQL------------
2dgmC           DIDMHIDAASGGFLAPFVAPDIVRVKSISASGHKFGLPLGCGWVIWRDEEALPQ----------------
2aatA           GWLPLFDFAYQGFARGLEEDAEGKELIVASSYSANFGYNERVGACTLVAADSETVDRAF-----------
1djuB           DLIVISDEVYEHFIYDDARHYSIERTITVNGFSKFAMTGWRLGFVAAPSWIIERMVKFQMATCPVTFIQY
3ei9A           GSIIVYDSAYAMYMSDDEIPGAEEVAMETASFSNYAGTGVRLGWTVIPKKLLYSDKDFNRIICTCFNGAS
2btwA           GVKVKVNHASDTNIEDF-RKQVAENLKIVNYLRKEIGQERGGHISPLAAYNEQTDRFLIDV---------
1c7nA           DLMLWSDEIHFDLIMPGIDEQLADKTITFTAPSKTFNAGMGMSNIIIKNPDIRERFTKS--RDATSGMPF
2bwpA           GALTYIDEVHAVGMYGPRGAGVAEIDIFNGTLAKYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIA
1cs1A           GAVSVVDNTFLSPALQNPLALGADLVLHSCTYLNGHSDVVAGVVIAKDPDVVTELAWWANNIGVTG----
3bwoB           PHYTPIT-------------RRQDHDIMLFTFSITGHAGSRIGWALVDKEVAKKMVEYIIVNSIGVSKES
2dgmB           DIDMHIDAASGGFLAPFVAPDIVRVKSISASGHKFGAPLGCGWVIWRDEEALPQ----------------
1arhA           GWLPLFDFARQGFARGLEEDAEGLRAFAAMHKELIVASSYRVGACTLVAADSET----------------
3b8xB           DIILLEDNCESMGATFNCAGTFGLMGTFSSFYSNHIATMEGGCIVTDDEEIYHILLCI------------
2e7jA           DVPLLVNGAYAIGRMPV-SLKEIGADFIVGSGHKSMAASGPIGVMGMKEEWAEIVLRRSVELLGCTARGA
1c4kA           CDYIEFDSAWVGYEQFIDLGPEDPGIIVVQSVHKQQAGFSQTSQIHKKDSHIKGQLRYCDHKHFNNSFNL
3bcaA           DIPHVVNNAYGLQSSKCQGARVGRIDAFVQSLDNFMVPVGGAIIAGFNEPFIQDISKMY-----------
1ajsA           FLFPFFDSAYQGFASGNLEKDAWFELFCAQSFSKNFGYNERVGNLTVVAKEPDSILRVLSQSNPPAQGAR
3bcbA           DIPHVVNNAYGLQSSKQQGARVGRIDAFVQSLDNFMVPVGGAIIAGFNEPFIQD----------------
3bwnA           FAYYWPH--------YTPITRRQDHDIMLFTFSKITGAGSRIGWALVDKEVAKKMVEYIIVNSIGVILNV
3banA           GLEITVIESIPVHEDIKQGKPNR-----------------------------------------------
3e2fA           DTLCISDEVYEWLVYTGTLPGMWERTITIGSAGTFSVTGWKLGWSIGPAHLIKHLQTVQQNSFYTALAEA
2c81A           NLFVIEDCAQSHGSVWNNQRAGTIGDIFSCQQGKVLTAGEGGIIVTKNPRLFELIQQLRADSRVYCDDSS
7aatA           NLLAYFDMAYQGFASGDINRDAGIDVVLSQSYAKNMLYGERAGAFTVICRDAEEAKRVESQLKILIRPMY
2btwB           GVKVKVNHASDTNIEDFENLKQDGNFVIVNYLRKEIG-QERGGHISPAAYNEQTDRFLI-----------
1aamA           GWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVAYNERVGACTLVAADSET----------------
1eg5B           NKETLVHVDAVQTIGKPFSLEKLEVDYASFSAHKFHGKGVGITYIRKGVPIRPLIHGGGQERGLRSGTQN
1d2fA           GVRVISDEIHMDMVWGEWSNVARGDWALLTSGSKSFIPALTGAYGIIENSSSRDAYLSARDGLSSPSVLA
3bcxB           NLWLIEDCCDALGSTYDGKMAGTFGGTVSFYPAHHITMGEGGAVFTQSAELKSIIESF------------
3d19E           NFPLLVDHTSREADYFNEGKLDALPDAIIKENVFFLRIMADHAKFIGHLLDPSE----------------
3dc1A           DFLIIEDDPYYFLQFNK-FRVPTFLSMDVDGRVIRADSGLRIGFLTGPKPLIERVILHIQSTLHPSTFNQ
2bieB           HAPLIADMSSDILSRPGMIYAGAQKNLGPSGVTVVIVKDLLVEQVPTMLQYATHIKSDSLYNTPPTFSIY
2bkwA           ETFFVVDAVCSIGCE-EFEFDEWGVDFALTASQAIGAPA-GLSISLCSSRFDYALNDSKNGHVHGYFSSL
1ariA           GWLPLFDFAYQGFARGLEEDAEGKELIVASSYSKNFGYNERVGACTLVAADSETVDRAF-----------
1d2fB           GVRVISDEIHMDMVWGEQPHIPWSWALLTSGSKSFNIPALTGAYGIIENSSSRDAYLSARDGLSSPSVLA
2bwoA           GALTYIDEVHAVGMGPRGAGVADGLMHRIDIFNGTLAAGVFGGYIAASARMVDAVRSYAIFSTSLPPAIA
3ecdA           GAKLMVDMAHIAGVIAAGRHANPVEHVVTSTTHKTLRGPRGGFVLTNDEEIAKKINSAVFGPLMHVIAGK
1ajrA           FLFPFFDSAYQGFASGNRYFVSEGFELFCAQSFNFGLYNERVGNLTVVAKEPDSILRVLTWSNPPAQGAR
3bc8A           DIPHVVNNAYGLQSSKCQGARVGRIDAFVQSLDNFMVPVGGAIIAGFNEPFIQDISKMY-----------
3bn1A           NLLVIEDAAEAVGATYRGKKSGSLGDCATFSFFGNIITTGEGGMITNDDDLAAKMRLLRG----------
2dgmA           DIDMHIDAASGGFLAPFVAPDIVRVKSISASGHKFGLPLGCGWVIWRDEEALPQ----------------
2d61A           GWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYRVGACTLVAADSET----------------
2ctzA           GVALIVDNTFGMGG-YLLRPLAWGAALVTHSLTKW-----------------------------------
2eh6A           DVLLIIDEVQTGIGRTGEFYAYFNLKPDVIALAKGLGGGVPIGAILAREEVAQSFTPGSHGSTFGGNPLA
2dgkC           DIDMHIDAASGGFLAPFVAPDIVRVKSISASGHKFGAPLGCGWVIWRDEEALPQ----------------
1b8gB           GIHLISDEIYSGTASSPSFISVMEVLKDRNCDENSEVWQFRVGAIYSNDDMVVAAATKMSSFVSSQTQHL
2bwnE           GALTYIDEVHAVGMYGPGVAERDGLMHRIDIFNGTLAYGVFGGYIAASARMVDAVRSYAIFSTSLPPAIA
3ecqA           GAHLGIHVNASET-YPESKYFNEKILRKNPDGSYSYGWNWLDQGINID----------------------
1ecxA           NKETLVHVDAVQTIKIPFSLEKLEVDYASFSAHKFHGPKVGITYIRKGVPIRHGGGQERGLRSGTQNVPG
1asbA           GWLPLFAFAYQGFARGLAAMHKELIVASSYSKNFGLYN-ERVGACTLVAADSETVDRAFSQMKAAIRANY
3b8xA           DIILLEDNCESMGATFNNKCAGTFGLMFSSFYSNHIATMEGGCIVTDDEEIYHILLCI------------
1e5eB           GVLVIADNTFCSPMITNPVDFGVDVVVHSATKYINGHTDVVAGLICGKADLLQQIRMV------------
3e2yA           DTLCISDEVYEWLVYTGHTHVKIERTITIGSAGKTFSVTWKLGWSIGPAHLIKHLQTVQ-----------
3dr4C           NLLVIEDAAEAVATYRGKKSGSLGDCTFSFFGNAIITTGEGGMITTNDDDLAAKMRLLRG----------
2d66A           GWLPLFDFAYQGFARGLEEDAEGKELIVASSYSKNFGLNERVGACTLVAADSET----------------
3d19A           NFPLLVDHTSREADYFREGKLDALPDAIIKENVFFLRIMADHAKFIGHLLDPS-----------------
3dxvB           GILVVCDEVKVGLARSGRLFEHEGFVPDILVLGKGLGGGLPLSAVIAPAEILDCASAFAHGNPISAAAGL
2cy8A           GALFILDEVISGFRVNHGMQALLDVQPDLTCLAKASAGGLPGGILGGREDVMGV----------------
1b8gA           GIHLISDEIYSGTASSPSFISVMEVLKDRNCSKDLGLPGFRVGAIYSNDDMVVAAATKMSGLVSSQTQHL
2bwnA           GALTYIDEVHAVGMYGPGVAERDGLMHRIDIFNGTLAYGVFGGYIAASARMVDAVRSYAIFSTSLPPAIA
1ecxB           --ETLVHVDAVQTIKIPFSLEKLEVDYASFSAHKFHGPGVGITYIRKGVPIRPLIHGGGQLRSGTQNVPG
1bybA           LESGLIIDIEVGL---------------------------------------------------------
1cl1A           AIIMIDNTWAAGVLFKALDFGI---DVSIQAATYLVGSDAMIGTAVCNARCWEQLRENAYLMGQMVHHES
2dr1B           DKLVFVDAVSADVVFSSSQPPGLAIGAFSERFLEIAEKMPERGWYFDIPLYVKYLKEKESTPSTPPMPQV
2bwpB           GALTYIDEVHAVGMVAERDGLMHRIDIFNGTLAKAYGV--FGGYIAASARMVDAVR--------------
3e9kA           GCYVGFDLAHAVGN-VELYLHDWGVDFACWCSYKYL----------------------------------
3dr4D           --LVIEDAAEAVGATYRKSGSLGDCATFSFFGNAIITDLAAKMRLLRGQGMDPNRRYWFPGFNYRMTNIQ
2e3zB           GITPFVTLYHWDL-PQALDDRYGGWLNKEEAIQDFTNYAKLCFESFGDLVQ-------------------
1c7gA           GIKIFYDATRCVENAYIKEQEAGYENVSIKDIVHEMFS--------------------------------
1b4xA           GWLPLFDFAYQGFARGLEEDAEGKELIVASSYSKFGLYNERVGACTLVAADSET----------------
2bfgA           NIRPFIEFGFMPKALASGDQTVFYWKGNVTPPKDYNKWRDLIVAVV------------------------
1ejiA           GAYLADAHISGLVAAGVPSPFEHCHVVTTTTHKTLRGCR-------------------------------
1cj0A           GAYLMADMAHISGLVVGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRRGVRSVD---------------
3bb8A           NLWLIEDCCDALGSTYDGKMAGTFGDIGTVSFYPKHITMGEGGAVFTQSAELKSIIESF-----------
3bzsA           DIPVIEDIPLARSLYKNIH---------------------------------------------------
3caiA           GALVVVDHSAAAPY-RLLDIRETDADVVTVNAHA-WGGPPIGAMVFRDPSVMNSFGSVS-----------
1b93B           NIPVATNVATADFIIQSPHFNDAVDILIPDYQRYLADR--------------------------------
1eh9A           GLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFDDAESDEVRKFILENVEYWIK----------
3bv0B           EVLLIFDEIATGFGRTGALFAADGVSPDIMCVGKLTGGYLSLAATLCTADVAHTISAGPTFMANPLACAV
3ecdD           GAKLMVDMAHIAGIAAGRHANPVEHAVVTSTTHKTLRGPRGGFVLTNDEEIAKKINS-------------
3cc1B           GLKFGIHIRGIPRQAVYENSPVLGSTKTAREIAHTNSICPWNTDYGVDPTKEGAQSYYNSLFE-------
1a47A           NIKVIIDFAPNHTSPASETD--------------------------------------------------
2ckrA           GLYVIVDWHILTPGDPYNLDRAKTFFAEIA--QRHASKTNVLYEIANEPNGVSWASIKSYAEEVI-----
3ecdC           GAKLMVDMAHIAGVAAGRHANPVEHAVVTSTTHKTLR---------------------------------
1bs0A           NGWLMVDDAHGTGVIGEQGRGSCWLQKVKPELLVVTFGKVSGAAVLCSSTVADYLLQ-------------
2dr1A           DKLVFVDAVSAMGGA-DIKFDKWGLDVVFSSSQKAFGVPPGLAIGAFSERFLEIVKYLKEKESTPSTPPM
3bcxA           NLWLIEDCCDALGTYDGKMAGTFGDITVSFYPAHHITMGEGGAVFTQSAELKSIIESF------------
3bn1D           NLLVIEDAAEAVGATYRGKKSGSLGDCATFSFTTNDDDLAAKMRLLRGQGMDPNRRYWF-----------
3bh1D           AQKALDQLKNLRGCDVHTTTILGSVDEGIFRNLGVVTSD-------------------------------
2bhzA           GLGVFLDVVYNHFGPSGNY--------LSSYAPSYFTDR-FSSAWGGLDYAEPHRRYVTGNAR-------
1bjnA           DVVVAADFSSTILSRPGVIYAGAQNIGPAGLTIVIVREDLLGIACPSILDYSILNDNGSMFNTPPTFAWY
1cguA           GIKIVIDFAPNHTSPAMETDT-----SFAENGRLYDNGTLVGGY--------------------------
3bmvA           NIKVIIDFAPN-HTSPASETDPTYAENGRLYDNGTLLGGYTNDT--------------------------
2dgmE           DIDMHIDAASGGFLAPFVAPDIVRVKSISASGHKFGLPLGCGWVIWRDEEALPQELV-------------
1ei7A           INNLIVELIRGTGSYNR-----------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXXVKRRNLSIIKPNATALLTRFPNALYKPHMPIALIPTGCNDAKLAERLLAMGVKTVPG
2egyC           ELLKEGFSERLERVRRVYREKAQAMLHALDREVPKEVRYTMFVWMELPKGLSAEGLFRRALEENVAFVPG
2douB           LRMGVEALKTPKEVVRGYARVYRERALGMAEAL-KGVLSLLPPRARLPEGVDDLEFGLRLVERGVALAPG
2egyD           QMLVHELLKEGFSERLERVRRVYREKAQAMLHALDREVPKEVRWMELPKGLSAEGLFRRALEENVAFVPG
2egyB           ELLKEGFSERLERVRRVYREKAQAMLHALDREVPKEVRYTMFVWMELPKGLSAEGLFRRALEENVAFVPG
3cbfA           QMLVHELLKEGFSERLERVRRVYREKAQAMLHALDREVPKMFVWMELPKGLSAEGLFRRALEENVAFVPG
5bj4A           QWATLEALTNQEASRRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTSPIAPDEVRAAERLLEAGVAVVPG
1bjwA           TLEALTNQEASRAFVEMARDLLLEGLTALGLKAVRPSGAFYVLMDTSPIAPDEVRAAERLLEAGVAVVPG
1c8nA           ----------------------------------------------------------------------
1dtyA           LACAAANASLAILESGDWQQQVADIEVQLREQLAPARDAEAIGVVETTHPVNMAALQKFFVEQGVWIRPF
3cq6A           AAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESNFVFFGDFSDQHAAWQAFLDRGVLIRDV
3dydA           GPCTIVQGALKSILCGEFYHNTLSFLKSNADLCYGALAAVGIEMEHFPEFENDVEFTERLVAQSVHCLPA
3bwoC           LKETCKSESESENFFKYGREMMKNRWEKLREVVKESDAFESYPAFAWLGTKEETDLVSELRRHKVMSRAG
3bwnB           QVRTAKILNVLKERWEKLREVVKESDAFTLPKYPEAFCLESYPAFAWLGTKEETDLVSELRRHKVMSRAG
2aevA           KNFNLERIRKAFERAKNFDLSKIEKLNKELKAIDDNINIVYERTPDTINIKKLIEIGFNLLNYGIITITV
3d6kA           QLAHAQFFGDVAGLKLKHAASLAPKFERVLEILDSRLSEGGYFISVDVVPGTASRVVELAKAGIALTGAG
3d6kB           AHAQFFGDVAGLKAHLKHAASLAPKFERVLEILDSRLTSPTGGYFISVVPGTASRVVELAKEGIALTGAG
1bkgA           TLEALTNQEASRAFVEMARDLLLEGLTALGLKAVRPSGAFYVLMDTSPIAPDEVRAAERLLEAGVAVVPG
2cb1A           ----------------------------------------------------------------------
2douA           LRMGVEALKTPKEVVRGYARVYRERALGMAEAL-KGVLSLLPPRARLPEGVDDLEFGLRLVERGVALAPG
1bw0B           AALGEALLNTPQEHLDQIVAKIEESAMYLYNHIGMYLMSRIDLEKYRDIKTDVEFFEKLLEEENVQVLPG
5bj3A           TLEALTNQEASRAFVEMARDLLLEGLTALGLKAVRPSGAFYVLMDTSPIAPDEVRAAERLLEAGVAVVPG
2drrA           ----------------------------------------------------------------------
3ei9B           AGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGWVHFPNQSSWDVFAEILEKTHVVTTPG
1b9iA           ----------------------------------------------------------------------
3d6kC           AHAQFFGDVAGLKAHLKHAASLAPKFERVLEILDSRLSEGYFISVDVVPGTASRVVELAKEAGIALTGAG
1b5oA           QEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTSPIAPDEVRAAERLLEAGVAVVPG
3dc1B           HEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPWIKVKGINDVKELIEEKAKMGVLMLPG
2cstA           GARIVATTLTSPQLFAEWKDNVKTMADRVLSLGTPGTWNHITDQIGMFTGLNPKQVEYMIKEKHIYLMAS
3bwnE           QVRTAKILNVLKETFKYGREMMKNRWEKLREVVKESKSLESYPAFAWLGTKEETDLVSELRRHKVMSRAG
3bwnC           ESESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYSLESYPAFAWLGTKEETDLVSELRRHKVMSRAG
3ei8A           AGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGWVHFPNQSSWDVFAEILEKTHVVTTPG
3cq5A           AAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESNFVFFGDFSDQHAAWQAFLDRGVLIRDV
3bmaD           ----------------------------------------------------------------------
1bqdA           VVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFSGLTKEQVLRLREEFGVYAVAS
1b5pA           TLEALTNQEASRAFVEMARDLLLEGLTALGLKAVRPSGAFYVLMDTSPIAPDEVRAAERLLEAGVAVVPG
2d5yA           SSPPAHGASVVATIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFFFGGLTKEQVLRLREEFGVYAVAS
3d6kD           QLAHAQFFGDVAGLKERVLEILDSRLSEYGVAKWTSPTGGYFISVDVVPGTASRVVELAKEAGIALTGAG
3bwoE           ESENFFKYGREMMKNRWEKEVVKESDAFTLPKYPEAFCLESYPAFAWLGTKEETDLVSELRRHKVMSRAG
3ei6A           NISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVVHFPNQSSWDVFAEILEKTHVVTTPG
3caeA           ----------------------------------------------------------------------
2e54A           LACRAGVTVIKELTKEGFLEEVEEKGNYLMKKLQEMKEEYLMIGIQFREEVSNREVATKCFENKLLVVPA
1dgdA           NVMGDRLRRGLLDLMERFDCIGDVRGRGLLLGVEIVKDRRTKE----PADGLGAKITRECMNLGLSMNIV
1b9hA           ----------------------------------------------------------------------
3bwoA           ESESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSGTKEETDLVSELRRHKVMSRAG
3dc1D           MISQLLHEWGEEGFMAHVDRVIDFYSLAAADKWLTGLAEWHVPAAVKGINDVKELIEEKAVKMGVLMLPG
3bwnF           CKSESESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEPAFAWLGTKEETDLVSELRRHKVMSRAG
3eiaB           AGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNHFPNQSSWDVFAEILEKTHVVTTPG
3cogD           GMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLG
2bwnD           AGAQASIAFLKTAEGQKLRDAQQMHAKMRLKALGMPIIDHGVPVVIGDPVHTKAVSDMLLSDYGVYVQPI
3dxvA           DDLPAMAERKGRLLRDGLSELAKRHPLIGDIRGRGGMELVCDRQSREPARAETAKLIYRAYQLGLVVYYV
3cq4A           AAIVALRHSADTLGTVEK---LSVERVRVAARLEELGYAVVPSESFFGDFSDQHAAWQAFLDRGVLIRDV
1agxA           ----------------------------------------------------------------------
2cfbA           ----------------------------------------------------------------------
1djuA           AAAKALKDERSWKAVEEMRKEYDRRRKLVLNEMGLPTVKPYIFPRIRDTGLTSKKFSELMLKARVAVVPG
3dzzB           IPAAIAAYEEGHDWLRELKQVLRDNFAYAREFLAKEVPEYLAWVDISALGNAEDFCKYLREKTGLIISAG
1ay4A           SFPPFHGAKIVSTVRSGMLRLREQLAGELRDLSGSDRFGFVAEHGMFSRLGATPEQVKRIKEEFGIYMVG
3cq4B           SQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESNFVFFGDQHAAWQAFLDRGVLIRDV
3bwoD           SENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSLESYPKEETDLVSELRRHKVMSRAG
3drdA           ----------------------------------------------------------------------
3bs8A           PLAMTAGLETLKQLTPDSYKNFIKKGDRLEEGISKAAEAHMIGFFFTNEPVINYETAKAASYYKGMANEG
1bw0A           AALGEALLNTPQEHLDQIVAKIEESAMYLYNHIAMYLMSRIDLEKYRDIKTDVEFFEKLLEEENVQVLPG
2dkjA           ----------------------------------------------------------------------
1d7uA           NVMGDRLRRGLLDLMERFDCIGDVRGRGLLLGVEIVKDRRTK----EPADGLGAKITRECMNLGLSMNIV
3dydB           GPCTIVQGALKSILCRTPGEFYHNTLKSNADLCYGALAAVGIEMEHFPEFENDVEFTERLVEQSVHCLPA
1ay4B           IVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLAEHRGMFSRLGATPEQVKRIKEEFGIYMVG
3b5oA           ----------------------------------------------------------------------
3bh1C           ----------------------------------------------------------------------
3e6gD           SFLALRGLKTLPLRMRA----HCENALALAQWLETHPAIEKVIYPGLASHPQHV-LAKRQMSG-------
3aatA           SNPPAHGASVVATIWEQELTDMRQRIQRMRQLFVNTLFSFIIKQNFSFSGLTKEQVLRLREEFGVYAVAS
3bwoF           QVRTAKILNVLKETRWEKLREVVKESDAFTLPKYPEAFCNYFGKSLESYPAEETDLVSELRRHKVMSRAG
3dzzA           IPAAIAAYEEGHDWLRELKQVLRDNFAYAREFLAKEVPEYLAWVDISALGNAEDFCKYLREKTGLIISAG
3eiaA           FNGASNISQAGALACHKVIGFYKENTNIIIDTFTSLGYDVYGGWVHFPNQSSWDVFAEILEKTHVVTTPG
3ei7B           AGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNHFPNQSSWDVFAEILEKTHVVTTPG
3e6gA           ----------------------------------------------------------------------
1czcA           ----------------------------------------------------------------------
1aiaA           SNPPAHGASVVATIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFSGLTKEQVLRLREEFGVYAVAS
3b46A           CANSINDALKIGYFEKMRLPYTAPEGTYFVFSKVKIPEDYPYPEEILNKGKDFRISHWLINELGVVAIPP
2aeuA           ----------------------------------------------------------------------
3cogB           GMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLG
3e6gB           SFLALRGLKTLPLRMRA----HCENALALAQWLETHPAIEKVIYPGLASHPQHV-LAKR---------QM
1bqaA           ----------------------------------------------------------------------
2d64A           SSPPAHGASVVATILEQELTDMRQRIQRMRQLFVNTLFTIKQNGMFFFGGLTKEQVLRLREEFGVYAVAS
3bwnD           CKSESESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEPAFAWLGTKEETDLVSELRRHKVMSRAG
3cq5B           AAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESNFVFFGDFSDQHAAWQAFLDRGVLIRDV
3ei7A           AGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNHFPNQSSWDVFAEILEKTHVVTTPG
1eg5A           VPGIVGAARAEIAVEELSEAAKHEKLRSKLVSGLNLGAHIINTLSVSFPNIRGSTLQNLLSGYGIYVSTH
2byjA           ----------------------------------------------------------------------
2e7uA           PLAMAAGLATLELLEEGLPHTVNRVGSMITVFFTEGPVVTFQDARR-TDTELFKRFFHGLLDRGIYWPPS
2bhxB           MLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDEGSRSLMNVTFNLRNEELNQQFLAKAKEQGFVGLNG
1asfA           ----------------------------------------------------------------------
3ei6B           NISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYVWVHFPNQSSWDVFAEILEKTHVVTTPG
1arsA           ----------------------------------------------------------------------
1eghA           ----------------------------------------------------------------------
1aheA           ----------------------------------------------------------------------
1akaA           SNPPMNGARIASLIWLVEVKGMADRIISMRTQLVSNLKKTDQIGMFCFTGLKPEQVERLTKEFSIYMTKD
2bwoD           AGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPHIVPVVIGDPVHTKAVSDMLLSDYGVYVQPI
2c7tA           ----------------------------------------------------------------------
2dgmC           ----------------------------------------------------------------------
2aatA           ----------------------------------------------------------------------
1djuB           AAAKALKDERSWKAVEEMRKEYDRRRWKRLNEMGLPTVKPYIFPRIRDTGLTSKKFSELMLKARVAVVPG
3ei9A           NISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVVHFPNQSSWDVFAEILEKTHVVTTPG
2btwA           ----------------------------------------------------------------------
1c7nA           TTLGYKACEICYKECGKWLDGCIKVIDKNQRIVKDFFEVYLQWIDFRALKMDHKAMEEFMIKAQIFFDEG
2bwpA           AGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPHIVPVVIGDPVHTKAVSDMLLSDYGVYVQPI
1cs1A           ----------------------------------------------------------------------
3bwoB           QVRTAKILNVLKETCKYGREMMKNRWEKLREVVKESKSLESYPAFAWLGTKEETDLVSELRRHKVMSRAG
2dgmB           ----------------------------------------------------------------------
1arhA           ----------------------------------------------------------------------
3b8xB           ----------------------------------------------------------------------
2e7jA           TIITLMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKDLMFFHAEVLYEISKKAKGGRFFLYRELKSR
1c4kA           FMSTSPFYPMYAALDRKLWHDLLITTIEARKKLIKAGSMNGKKWEDGDTEDMANNIDYWRFEKGAKWHAY
3bcaA           ----------------------------------------------------------------------
1ajsA           IVARTLSDPELFHEWTGNVKTMADRILSMRSELRARLEALKTPGTFSFTGLNPKQVEYLINQKHIYLLPS
3bcbA           ----------------------------------------------------------------------
3bwnA           LKETCKSESESENFFKYGREMMKNRWEKLREVVKESDALESYPAFAWLGTKEETDLVSELRRHKVMSRAG
3banA           ----------------------------------------------------------------------
3e2fA           FWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDMNSDEPYDYKFVKWMTKHKKLTAIPV
2c81A           ELMHGDMQLVKKGDIQGSNYCLSEFQSAILLDRPPQVSRQTYYGYVFFGGLNADQFCEILRELNMGTFYL
7aatA           SNPPMNGARIASLIWLVEVKGMADRIISMRTQLVSNLKKEGSSHNFCFTGLKPEQVERLTKEFSIYMTKD
2btwB           ----------------------------------------------------------------------
1aamA           ----------------------------------------------------------------------
1eg5B           VPGIVGAARAEIAVEELSEAKHEKLRSKLVSGLNLGAHIITPLLSVSFPNIRGSTLQNLLSGYGIYVSTR
1d2fA           LTAHIAAYQQGAPWLDALRIYLKDNLADKMNAAFPELNWQLAWLDLRPLNIDDNALQKALIEQEVAIMPG
3bcxB           ----------------------------------------------------------------------
3d19E           ----------------------------------------------------------------------
3dc1A           LMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKMFLWIKVKGINDVKELIEEKAVKMGVLMLPG
2bieB           MLRNVLDWIKDLGGAEAIAKQNEEKAKIIVGHAEKGSRSLMNVTFNLRNEELNQQFLAKAKEQGFVGLNG
2bkwA           RRWTPIENYEAGKGAYFATPPVQLINSLLVNGLQLTSVSRSAHGLTAVYVADPPDVIAFLKSHGVVIAGG
1ariA           ----------------------------------------------------------------------
1d2fB           LTAHIAAYQQGAPWLDALRIYLKDNLTYIADKMPQSTY--LAWLDLRPLNIDDNALQKALIEEKVAIMPG
2bwoA           AGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPHIVPVVIGDPVHTKAVSDMLLSDYGVYVQPI
3ecdA           AVAFGEALTDDFKTYIDRV---LANAQALGDVLKAGGVDHLLLVDLRPKGLKGAQVEQALERAGITCNKN
1ajrA           IVARTLSDPELFHEWTGNVKTMADRILSMRSELRARLEATDQIGMFSFTGLNPKQVEYLINQKHIYLLPS
3bc8A           ----------------------------------------------------------------------
3bn1A           ----------------------------------------------------------------------
2dgmA           ----------------------------------------------------------------------
2d61A           ----------------------------------------------------------------------
2ctzA           ----------------------------------------------------------------------
2eh6A           CRAGTVVVDEVEKLLPH----VREVGNYFLKELGKGKVKGRGLMLGLELERECKDYVLKALEKGLLINCT
2dgkC           ----------------------------------------------------------------------
1b8gB           LSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGLLRSNTFEAEMELWKKIVEVHLNISPG
2bwnE           AGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPHIVPVVIGDPVHTKAVSDMLLSDYGVYVQPI
3ecqA           ----------------------------------------------------------------------
1ecxA           IVGAARAMEIAVEELSEAAKHMEKLRSKLVSGLMNLGAHIITPLSVSFPNIRGSTLQNLLSGYGIYVSTH
1asbA           SNPPAHGASVVATIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFSGLTKEQVLRLREEFGVYAVAS
3b8xA           ----------------------------------------------------------------------
1e5eB           ----------------------------------------------------------------------
3e2yA           ----------------------------------------------------------------------
3dr4C           ----------------------------------------------------------------------
2d66A           ----------------------------------------------------------------------
3d19A           ----------------------------------------------------------------------
3dxvB           AVLETIDRDDLPAMAERKGRLLRDGLSELAKRHPLGMELVCDRQSREPARAETAKLIYRAYQLGLVVYYV
2cy8A           ----------------------------------------------------------------------
1b8gA           LSAMLSDKKLTKNYIAENHKRLKQRQKKGLQKSGISCLNGNLFCWVDMRHLAEMELWKKIVEVHLNISPG
2bwnA           AGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPHIVPVVIGDPVHTKAVSDMLLSDYGVYVQPI
1ecxB           IVGAARAMEIAVEELSEAAKHMEKLRSKLVSGLMNLGAHIITPLSVSFPNIRGSTLQNLLSGYGIYVSTR
1bybA           ----------------------------------------------------------------------
1cl1A           SLKVAEWLAEHPQVARVNHPALPGSKGHEFWKRDFTGSSGLFSFVLKKKLNNEENYLDNFSLFSMAYSWG
2dr1B           FGINVALRIIEKMGGKEKWLEMYEKRAKMVREGVREIGLDTITAVLTPPGIKGDEVYEAMRKRGFELAKG
2bwpB           ----------------------------------------------------------------------
3e9kA           ----------------------------------------------------------------------
3dr4D           AAIGLAQLERVDEHLAARERVVGWYEQKLVALTGRHVFWMYTVRLGEGLSTTRDQVIKDLDALGIESRPV
2e3zB           ----------------------------------------------------------------------
1c7gA           ----------------------------------------------------------------------
1b4xA           ----------------------------------------------------------------------
2bfgA           ----------------------------------------------------------------------
1ejiA           ----------------------------------------------------------------------
1cj0A           ----------------------------------------------------------------------
3bb8A           ----------------------------------------------------------------------
3bzsA           ----------------------------------------------------------------------
3caiA           ----------------------------------------------------------------------
1b93B           ----------------------------------------------------------------------
1eh9A           ----------------------------------------------------------------------
3bv0B           SVASVELLLGQDWRTRIGLTAGLDTARALP-AVTDVRVCGAIGVIECDRPVDLAVATPAALDRGVWLRPF
3ecdD           ----------------------------------------------------------------------
3cc1B           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
2ckrA           ----------------------------------------------------------------------
3ecdC           ----------------------------------------------------------------------
1bs0A           ----------------------------------------------------------------------
2dr1A           PQVFGINVALRIIEKMGGKEKWLEMYEKRAKMVREGVREPTITAVLTPPGIKGDEVYEAMRKRGFELAKG
3bcxA           ----------------------------------------------------------------------
3bn1D           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
2bhzA           ----------------------------------------------------------------------
1bjnA           LSGLVFKWLKANGGVAEMDKINQQKAELLYGVIAKRNRSRMNVPFQLADSALDKLFLEESFAAGLHALKG
1cguA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2dgmE           ----------------------------------------------------------------------
1ei7A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RLFQAPYSIRVGLGVEEPPRFREALEILAQGWCRA
2egyC           GPFFAENTLRLSYATLDREGIAEGVRRLGR-----
2douB           RGFGPGGKVRIALVRPL-EELLEAAKRIRE-----
2egyD           GPFFAENTLRLSYATLDREGIAEGVRRLGR-----
2egyB           GPFFAENTLRLSYATLDREGIAEGVRRLGR-----
3cbfA           GPFFAENTLRLSYATLDREGIAEGVRRLGR-----
5bj4A           TDFAAFGHVRLSYATSE-ENLRKALERFAR-----
1bjwA           TDFAAFGHVRLSYATSE-ENLRKALERFAR-----
1c8nA           -----------------------------------
1dtyA           -----GKLIYLMPPIILPQQLQRLTAAVNR-----
3cq6A           G---IAGHLRTTIGVPE--ENDAFLDAAAE-----
3dydA           TCFEYPNFIRVVITVPE-VMMLEACSRIQE-----
3bwoC           ERCSDKKHVRVSMLSRE-DVFNVFLERLAN-----
3bwnB           ERCSDKKHVRVSMLSRE-DVFNVFLERLAN-----
2aevA           AGMGASKSLRIDLTRIDDNYIIKAIV---------
3d6kA           SSFPNNENIRLAPSLPP-VAELEVADGFAT-----
3d6kB           SSFPNNENIRLAPSLPP-VAELEVADGFAT-----
1bkgA           TDFAAFGHVRLSYATSE-ENLRKALERFAR-----
2cb1A           -----------------------------------
2douA           RGFGPGGKVRIALVRPL-EELLEAAKRIRE-----
1bw0B           TIFHAPGFTRLTTTRPV-EVYREAVERIKA-----
5bj3A           TDFAAFGHVRLSYATSE-ENLRKALERFAR-----
2drrA           -----------------------------------
3ei9B           SGFGPGGEVRVSAFGHR-ENILEACRRFKQ-----
1b9iA           -----------------------------------
3d6kC           SSFPNNENIRLAPSLPP-VAELEVADGFAT-----
1b5oA           TDFAAFGHVRLSYATSE-ENLRKALERFAR-----
3dc1B           NAFYVDSYLRASFSSASPEQMDVAFQVLAQLIKES
2cstA           --------GRINMCGLTTKNLDYVAKSIHEAVTK-
3bwnE           ERCSDKKHVRVSMLSRE-DVFNVFLERLAN-----
3bwnC           ERCSDKKHVRVSMLSRE-DVFNVFLERLAN-----
3ei8A           SGFGPGGEVRVSAFGHR-ENILEACRRFKQ-----
3cq5A           G---IAGHLRTTIGVPE--ENDAFLDAAAE-----
3bmaD           -----------------------------------
1bqdA           --------GRVNVAGMTPDNMAPLCEAIVA-----
1b5pA           TDFAAFGHVRLSYATSE-ENLRKALERFAR-----
2d5yA           GRL-NVAGM-------TPDNLAPLCEAIVA-----
3d6kD           SSFPNNENIRLAPSLPP-VAELEVADGFAT-----
3bwoE           ERCGSDKKVRVSMLSRE-DVFNVFLERLAN-----
3ei6A           SGFGPGGEVRVSAFGHR-ENILEACRRFKQ-----
3caeA           -----------------------------------
2e54A           ----GNNTIRFLPPTVEYGEIDLAVETLKK-----
1dgdA           QLPGMGGVFRIAPPTVSEDEIDLGLSLLGQAIERA
1b9hA           -----------------------------------
3bwoA           ERCSDKKHVRVSMLSRE-DVFNVFLERLAN-----
3dc1D           NAFYVDSYLRASFSSASPEQMDVAFQVLAQ-----
3bwnF           ERCSDKKHVRVSMLSRE-DVFNVFLERLAN-----
3eiaB           SGFGPGGEVRVSAFGHR-ENILEACRRFKQ-----
3cogD           GFESLAELPAIMTHASVLKNDRDVLGI--------
2bwnD           NFPRGTERLRFTPSPVHDLQIDGLVHAMDLLW---
3dxvA           GMNGNVLEFTPPLTITE-TDIHKALDLLDR-----
3cq4A           G---IAGHLRTTIGVPE--ENDAFLDAAAE-----
1agxA           -----------------------------------
2cfbA           -----------------------------------
1djuA           SAFAGEGYVRISYATAY-EKLEEAMERMER-----
3dzzB           NGYNGHEFVRINLACPK-ELVIDGQRLKQG-----
1ay4A           -------DSRINIAGLNDNTIPILARAIIE-----
3cq4B           G---IAGHLRTTIGVPE--ENDAFLDAAAE-----
3bwoD           ERCGSDKKVRVSMLSRE-DVFNVFLERLAN-----
3drdA           -----------------------------------
3bs8A           VFLPPSQFEGLFLSAHTDEDIENTIQAAEK-----
1bw0A           TIFHAPGFTRLTTTRPV-EVYREAVERIKA-----
2dkjA           -----------------------------------
1d7uA           QLPGMGGVFRIAPPTVSEDEIDLGLSLLGQAIERA
3dydB           TCFEYPNFIRVVITVPE-VMMLEACSRIQE-----
1ay4B           -------DSRINIAGLNDNTIPILARAIIE-----
3b5oA           -----------------------------------
3bh1C           -----------------------------------
3e6gD           --FGGIVSIVLKGGFDAAKRFCEKTEL--------
3aatA           GFV------NVAGMTPD--NMAPLCEAIVA-----
3bwoF           ERCGSDKKVRVSMLSRE-DVFNVFLERLAN-----
3dzzA           NGYNGHEFVRINLACPK-ELVIDGQRLKQ------
3eiaA           SGFGPGGEVRVSAFGHR-ENILEACRRFKQ-----
3ei7B           SGF-GPGGVRVSAFGHR-ENILEACRRFKQ-----
3e6gA           -----------------------------------
1czcA           -----------------------------------
1aiaA           --------GRVNVAGMTPDNMAPLCEAIVA-----
3b46A           TEFAAENLLRFAVCKDD-AYLENAVERLKL-----
2aeuA           -----------------------------------
3cogB           GFEPSDTLIRLSVGLEDEEDLDQALKAAHP-----
3e6gB           SGFGGIVSIVLKGGFDAAKRFCEKTEL--------
1bqaA           -----------------------------------
2d64A           GRL-NVAGM-------TPDNLAPLCEAIVA-----
3bwnD           ERCSDKKHVRVSMLSRE-DVFNVFLERLAN-----
3cq5B           G---IAGHLRTTIGVPE--ENDAFLDAAAE-----
3ei7A           SGFGPGGEVRVSAFGHR-ENILEACRRFKQ-----
1eg5A           VLDIAQGAIRISLCKYNTEEVDYFLKKIEE-----
2byjA           -----------------------------------
2e7uA           ----NFEAAFLSVAHRE-EDVEKTLEALRK-----
2bhxB           HRSVGGCRASIYNAVPI-DACIALRELMIQFKENA
1asfA           -----------------------------------
3ei6B           SGFGPGGEVRVSAFGHR-ENILEACRRFKQ-----
1arsA           -----------------------------------
1eghA           -----------------------------------
1aheA           -----------------------------------
1akaA           --------GRISVAGVASSNVGYLAHAIHQ-----
2bwoD           NFPRGTERLRFTPSPVHDLQIDGLVHAMDLLW---
2c7tA           -----------------------------------
2dgmC           -----------------------------------
2aatA           -----------------------------------
1djuB           SAFAGEGYVRISYATAY-EKLEEAMERMER-----
3ei9A           SGFGPGGEVRVSAFGHR-ENILEACRRFKQ-----
2btwA           -----------------------------------
1c7nA           YIFGGIGFERINLAAPS-SVIQESLERLNK-----
2bwpA           NFPRGTERLRFTPSPVHDLQIDGLVHAMDL-----
1cs1A           -----------------------------------
3bwoB           ERCGSDKKVRVSMLSRE-DVFNVFLERLAN-----
2dgmB           -----------------------------------
1arhA           -----------------------------------
3b8xB           -----------------------------------
2e7jA           KIHGIKPGFKLSTYGLSDEEVDYVLNAFKE-----
1c4kA           EGYGDNQYYVDPPGINPETGDYEDFGVPATIV---
3bcaA           -----------------------------------
1ajsA           GRINMCGLTTKNLDYVA-TSIHEAVTKI-------
3bcbA           -----------------------------------
3bwnA           ERCSDKKHVRVSMLSRE-DVFNVFLERLAN-----
3banA           -----------------------------------
3e2fA           SAFKPHFEKLVRFCFIKKDTLDAAEEIFR------
2c81A           HPPYLPVHKNPLF-CPWTKNRYLKSVRKTEAYWRG
7aatA           GRISVA--------GVASSNVGYLAHAIHQ-----
2btwB           -----------------------------------
1aamA           -----------------------------------
1eg5B           HVLDAGVDRRIAQGA--------------------
1d2fA           YTYEGRGFVRLNAGCPR-SKLEKGVAGLIN-----
3bcxB           -----------------------------------
3d19E           -----------------------------------
3dc1A           NAFYVDSYLRASFSSASPEQMDVAFQVLAQLIKES
2bieB           HRSVGGCRASIYNAVPI-DACIALRELMIQFKENA
2bkwA           IHKIGPKYIRIGHGVNKNLPYKNCFDLIKL-----
1ariA           -----------------------------------
1d2fB           YTYEGRGFVRLNAGCPR-SKLEKGVAGLIN-----
2bwoA           NFPRGTERLRFTPSPVHDLQIDGLVHAMDL-----
3ecdA           GIPFDPEKPTITSGIRLGTPAAAEFREVGRLILEV
1ajrA           GRI--------NMCGLTTKNLDYVATSIHEAVTK-
3bc8A           -----------------------------------
3bn1A           -----------------------------------
2dgmA           -----------------------------------
2d61A           -----------------------------------
2ctzA           -----------------------------------
2eh6A           ----AGKVLRFLPPIIQKEHIDRAISVLRE-----
2dgkC           -----------------------------------
1b8gB           SSCTEPGWFRVCFANLPERTLDLAMQRLKA-----
2bwnE           NFPRGTERLRFTPSPVHDLQIDGLVHAMDL-----
3ecqA           -----------------------------------
1ecxA           VLDIAQGAIRISLCKYNTEEVDYFLKKIEE-----
1asbA           --------GRVNVAGMTPDNMAPLCEAIVA-----
3b8xA           -----------------------------------
1e5eB           -----------------------------------
3e2yA           -----------------------------------
3dr4C           -----------------------------------
2d66A           -----------------------------------
3d19A           -----------------------------------
3dxvB           GMNGNVLEFTPPLTITE-TDIHKALDLLDR-----
2cy8A           -----------------------------------
1b8gA           SSCTEPGWFRVCFANLPERTLDLAMQRLKA-----
2bwnA           NFPRGTERLRFTPSPVHDLQIDGLVHAMDLLW---
1ecxB           HVLIAQGAIRISLCKYNTEEVDYFLKKIEE-----
1bybA           -----------------------------------
1cl1A           GYESLILANQPEHIAAIRP---QGEIDFSGTLIR-
2dr1B           YGSVKEKTFRIGHMYMKFEDIQEMLDNLRE-----
2bwpB           -----------------------------------
3e9kA           -----------------------------------
3dr4D           FHPMHIMPPYAHLADDLKIAEACGVDGL-------
2e3zB           -----------------------------------
1c7gA           -----------------------------------
1b4xA           -----------------------------------
2bfgA           -----------------------------------
1ejiA           -----------------------------------
1cj0A           -----------------------------------
3bb8A           -----------------------------------
3bzsA           -----------------------------------
3caiA           -----------------------------------
1b93B           -----------------------------------
1eh9A           -----------------------------------
3bv0B           -----RNLVYAMPPICTPAEITQITSAMVE-----
3ecdD           -----------------------------------
3cc1B           -----------------------------------
1a47A           -----------------------------------
2ckrA           -----------------------------------
3ecdC           -----------------------------------
1bs0A           -----------------------------------
2dr1A           YGSVKEKTFRIGHMYMKFEDIQEMLDNLRE-----
3bcxA           -----------------------------------
3bn1D           -----------------------------------
3bh1D           -----------------------------------
2bhzA           -----------------------------------
1bjnA           HRVVGGMRASIYNAMPL-EGVKALTDFMVE-----
1cguA           -----------------------------------
3bmvA           -----------------------------------
2dgmE           -----------------------------------
1ei7A           -----------------------------------