[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for paer1:AAL65085.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3canA.bssp"
#ERROR : Can't open dsspfile "3ciwA.bssp"
#ERROR : Can't open dsspfile "3c8fA.bssp"
#ERROR : Can't open dsspfile "3cixA.bssp"
#ERROR : Can't open dsspfile "2a5hA.bssp"
#ERROR : Can't open dsspfile "3bz6A.bssp"
#ERROR : Can't open dsspfile "3cb8A.bssp"
#ERROR : Can't open dsspfile "2bw2A.bssp"
#ERROR : Can't open dsspfile "2a5hB.bssp"
#ERROR : Can't open dsspfile "3chvA.bssp"
#ERROR : Can't open dsspfile "3cl5A.bssp"
#ERROR : Can't open dsspfile "2ekyC.bssp"
#ERROR : Can't open dsspfile "2dzbB.bssp"
#ERROR : Can't open dsspfile "3cl4A.bssp"
#ERROR : Can't open dsspfile "2dwqB.bssp"

## Summary of PDB Search
:364
    8e-16  22%  3canA  [x.x.x] PYRUVATE-FORMATE LYASE-ACTIVATING ENZYME
    5e-15  12%  3ciwA  [x.x.x] FEFE-HYDROGENASE MATURASE
    5e-14  19%  3c8fA  [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME
    6e-14  12%  3cixA  [x.x.x] FEFE-HYDROGENASE MATURASE
    4e-13  10%  2a5hA  [x.x.x] L-LYSINE 2,3-AMINOMUTASE
    1e-12   7%  3bz6A  [x.x.x] UPF0502 PROTEIN PSPTO_2686
    1e-11  21%  3cb8A  [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME
    3e-11   9%  2bw2A  [x.x.x] BYPASS OF FORESPORE C
    2e-10  10%  2a5hB  [x.x.x] L-LYSINE 2,3-AMINOMUTASE
    2e-06   9%  3chvA  [x.x.x] PROKARYOTIC DOMAIN OF UNKNOWN FUNCTION (DUF849)
    1e-05  10%  3cl5A  [x.x.x] HEMAGGLUTININ-ESTERASE
    1e-05   9%  2ekyC  [x.x.x] UPF0045 PROTEIN MJ1052
    2e-04  18%  2dzbB  [x.x.x] DIHYDROPTEROATE SYNTHASE
    2e-04   8%  3cl4A  [x.x.x] HEMAGGLUTININ-ESTERASE
    8e-04  37%  2dwqB  [x.x.x] GTP-BINDING PROTEIN
:364

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3canA           ----------------------------------------------------------------------
3ciwA           ----------------------------------------------------------------------
3c8fA           ----------------------------------------------------------------------
3cixA           ----------------------------------------------------------------------
2a5hA           ----------------------------------------------------------------------
3bz6A           ----------------------------------------------------------------------
3cb8A           ----------------------------------------------------------------------
2bw2A           ----------------------------------------------------------------------
2a5hB           ----------------------------------------------------------------------
3chvA           ----------------------------------------------------------------------
3cl5A           ----------------------------------------------------------------------
2ekyC           ----------------------------------------------------------------------
2dzbB           ----------------------------------------------------------------------
3cl4A           ----------------------------------------------------------------------
2dwqB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxESRPMEIKPLYHFYPGTSAVTISTWGCNFPCAWCQNWHLSKTASPAGAYVPPERVVEWALE
3canA           ----------------------------------------------------------------------
3ciwA           ---------LADEIRRKYVGDEVHIRAIIEF-SNVCRKNCLYCGLRRDNKNLKRYRMTPEIVERARLAVQ
3c8fA           --------------------VDGPGIRFI-TFFQGCLMRCLYCHNRDTWDTHGGKEVTVDLMKEVVTYRH
3cixA           ---------LADEIRRKYVGDEVHIRAIIEF-SNVCRKNCLYCGLRRDNKNLKRYRMTPEIVERARLAVQ
2a5hA           -----------------PVPGLTHRYPDRVLLLITDCSYCRHCTRRRFAGQSDDSPERID-KAIDYIRNT
3bz6A           ------------STEVRILGCLIEKQATNPETPLTLNALVIACNQKTSRDPVNLTQGQV--GQSLRALEG
3cb8A           --------------------VDGPGI-RFITFFQGCLMRCLYCHNRDTWD--THGGKEVTVEDLMKEVVT
2bw2A           --------------------------------EHYEPLQVHVQLEKVYLDG--DVSIEHKHEKVFSMWAA
2a5hB           -----------------PVPGLTHRYPDRVLLLITDCSYCRHCTRRRFAGQSDDSPERI-DKAIDYIRNT
3chvA           -------------------------------ANKPCIICVAITGSVP--TKADNPAVPITVSESTQEAFE
3cl5A           ------------QYYFNKDTGVIYGLNSTETITTGFDFNCHYLVLPSGNYLAISNELLL---TVPTKAIC
2ekyC           ----------------------------------------------------------------IFMRKV
2dzbB           ------------------------------------------------------------PERALERARE
3cl4A           -----------------KDTGVIYGLNSTETITTGFDFNCHYLVLPSGNYLAISNELLL---TVPTKAIC
2dwqB           -------------------------------------------------------------EAVRRKALE


                         +         .         .         .         .         *         .:210
query           NGDSGVNVSFNEPTLLAEYAEEVFRLARARGLHASINTNGYLTEEAVRRLAEAGMEGMNIDIKGGRETYR
3canA           -GG-GVTFCGGEPLLHPEFLIDILKRCGQQGIHRAVDTTLLARKETVDEVRNCEL--LLIDLKSDSTVHQ
3ciwA           FGAKTIVLQSGEDPYMPDVISDIVKEIKKMGVA-VTLSLGEWPREYYEKWKEAGADRYLLRHETANPVLH
3c8fA           FMNASGGGVTGEAILQAEFVRDWFRACKKEGIHTCLTNGFVRRYDPVIDELLEVTDLVMLDLKQMDEIHQ
3cixA           FGAKTVLQSGEDPYYMPDVISDIVKEIKKMGVAVTLSLGEWPREYY-EKWKEAGADRYLLRHETANPVLH
2a5hA           PQVRDVLLSGGDALLVDETLEYIIAKLREIPHVEIVRRTPVVLPQRITPELVNLKKYHPVWLN----THF
3bz6A           RGLTRLVGSRADRWEVPAQVILTGLLLLRGPQSELLTRSNRHDFEDSEQVVHQLERLIARGLATLVPRQS
3cb8A           YRHFMNASSGGEAILQAEFVRDWFRACKKEGIHTCLDTNFVRRYDPVIDELLEVTDLVMLDLKQMDEIHQ
2bw2A           YAGWTLVEQKKGYVLFRKQMDDISPLSKVNGYIGVSDNVISTFHGRPEPASEPIQSFFQIDLERLESHLK
2a5hB           PQVRDVLLSGGDALLVDETLEYIIAKLREIPHVEIVRITPVVLPQRITPELVNLKKYHPVW----LNTHF
3chvA           AGAAIAHCHVRNDDGPDRFARLTEGLHTHCPGIVQFSTGGRSGAGQARGLPLKPDASLSVGSNNFPSRVY
3cl5A           LNKVQVVDSRWNNARQSDNMTAVACQPPYCYFRNSTTNYVGVYAGFTSILSGLLYDSPCFQGVFRYDNVS
2ekyC           VAEVSIIPLGKGA-SVSKYVKKAIEVFKKYDLKVETNAMGTVLEGDLDETVLNDVDRVVSSLKIDE---R
2dzbB           MVAEGLGAESTPVEEEKRRLLPVLEAVLSLGVPVSVDT---RKPEVAEEALKLGAHLLNDVTGLRDERMV
3cl4A           LNKRKDFTPVQVVDSARQSDNMTAVACQPPYCYFRNSTTNYVGVYDINHGDAGFTSILSGLLYDSPCFSQ
2dwqB           EGAEVVVVSARLEAELAELSGE-----EARELLAAYG----LQESGLQRLARAGYRALDLTFAGEKEV-R


                         .         .         .         +         .         .         .:280
query           RWLAANFDKFLSTARHAKGMGIHVEFTYLVIPGVNDHEAEEVIEAVASFGRETPLHITAYYPAHKLFNXX
3canA           TFCDVPNELILKNIRRVAEADFPYYIRIPLIEGVNADEKN--IKLSAEFLASLPRHP-------------
3ciwA           RKLDTSFENRLNLLTLKELGYETGAGSMVGLPGQTIDDLVDDLLFLKEHDFDMGIGPFIPHPDTPLAN--
3c8fA           NLVGVSNHRTLEFAKYLANKNVKVWIRYVVVPGWSDDSAHRLGEFTRDMGNVEKIELLPYHE--------
3cixA           RKLRTSFENRLNLLTLKELGYETGAGSMVGLPGQTIDDLVDDLLFLKEHDFDMGIGPFIPHPDTPLAN--
2a5hA           NHPNEITEESTRACQLLADAGVPLGNQSVLLRGVNDCVVKELVNKLVKIRRPYYIYQCDLSLGLEHF---
3bz6A           G---------------------------------------------------------------------
3cb8A           NLVGVSNHRTLEFAKYLANKNVKVWIRYVVVPGWSDDSAHRLGEFTRDMGNVEKIELLPYHE--------
2bw2A           GIPFRTKAEFEDVIEHMK----------------------------------------------------
2a5hB           NHPNEITEESTRACQLLADAGVPLGNQSVLLRGVNDVHVKELVNKLVKIRRPYYIYQCDLSLGLEHF---
3chvA           ENPLVDWLAAQRSYRVTPEIEAFDLSHILRAIDHGRGLLYGKLYVQFVGVKNAPADREVFDFYVRR----
3cl5A           ----------------------------------------------------------------------
2ekyC           KDKENTIERKLKAIGE------------------------------------------------------
2dzbB           ALAAR-------HGVAAVVMHMPAHARYRDVVAEVKAFLEAQARRALSAG--------------------
3cl4A           Q---------------------------------------------------------------------
2dwqB           AWT----VRRGTKAPRAAGE-IHSDM--------------------------------------------


                         .         *         .         .         .         .         +:350
query           XXXXXXXXXXXXXXXXXDYVYVGNVPGHPGQHTYCPRCGYAVIKRAGDRAVKIELAQGRCPKCGWExxxx
3canA           ----------------------------------------------------------------------
3ciwA           ----------------------------------------------------------------------
3c8fA           ----------------------------------------------------------------------
3cixA           ----------------------------------------------------------------------
2a5hA           ----------------------------------------------------------------------
3bz6A           ----------------------------------------------------------------------
3cb8A           ----------------------------------------------------------------------
2bw2A           ----------------------------------------------------------------------
2a5hB           ----------------------------------------------------------------------
3chvA           -----------TRAPQAEWCAAGIGANQLTVNEWAIAAGGHTRTGLED---NIRLDRQTLAPSNAA----
3cl5A           ----------------------------------------------------------------------
2ekyC           ----------------------------------------------------------------------
2dzbB           ----------------------------------------------------------------------
3cl4A           ----------------------------------------------------------------------
2dwqB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxx
3canA           --------------
3ciwA           --------------
3c8fA           --------------
3cixA           --------------
2a5hA           --------------
3bz6A           --------------
3cb8A           --------------
2bw2A           --------------
2a5hB           --------------
3chvA           --------------
3cl5A           --------------
2ekyC           --------------
2dzbB           --------------
3cl4A           --------------
2dwqB           --------------